Полипептид, переносимый cyaa (варианты), и применение для индуцирования как терапевтического, так и профилактического иммунного ответа

Настоящее изобретение относится к биохимии и медицине. Предложена композиция для иммунотерапевтического лечения или профилактики состояния, которое является следствием инфицирования ВПЧ16 и/или ВПЧ18, содержащая фармацевтически приемлемую основу или состав и эффективное количество по меньшей мере одного вектора из белка СуaА Bordatella pertussis или его фрагмента, несущего полипептиды, содержащие эпитоп HPV16 Е7Δ30-42 и эпитоп HPV18 Е7Δ32-42, и/или MAGE-A397-178/190-295, и/или CysOVA257-294, причем указанная композиция дополнительно содержит адъювант, который представляет собой лиганд Toll-подобного рецептора, выбранный из имиквимода и поли-ICLC. Применение данной композиции обеспечивает стимуляцию иммунного ответа против соответствующих антигенных эпитопов, в том числе стимуляцию образования Т-клеток памяти. 8 з.п. ф-лы, 10 ил.

 

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Настоящее изобретение относится к средствам на основе полипептида(ов), переносимого(ых) СуаА, для применения в иммунотерапевтическом лечении первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного у хозяина-млекопитающего, путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), и в профилактике второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), при этом указанный иммунный ответ возникает после введения указанного(ых) переносимого(ых) вектором полипептида(ов) указанному хозяину, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах). Согласно конкретному варианту реализации настоящее изобретение относится к средствам на основе полипептида(ов), переносимого(ых) СуаА, для применения (i) в иммунотерапевтическом лечении первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у хозяина-млекопитающего, путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), (ii) в профилактике второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего, путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), и (iii) при предотвращении повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий), путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), при этом указанный иммунный ответ возникает после введения указанного(ых) переносимого(ых) вектором полипептида(ов) указанному хозяину, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах).

УРОВЕНЬ ТЕХНИКИ

Одним из ключевых токсинов, продуцируемых Bordetella pertussis, патоген, ответственный за судорожный кашель, является аденилатциклаза (СуаА). На мышиной модели было показано, что СуаА необходим бактериям в ходе ранней стадии колонизации легких (Goodwin and Weiss 1990). СуаА демонстрирует уникальный механизм инвазии в эукариотические клетки, осуществляемой путем направленной достквки каталитического домена в цитозоль клеток (Simsova, Sebo et al. 2004). Детоксифицированная и рекомбинантная СуаА, применяемая в качестве вакцинного вектора, демонстрирует высокую способность к нацеливанию на CD11 b/С018-экспрессирующие антиген-презентирующие клетки (АПК), такие как, например, дендритные клетки или клетки Лангерганса (Guermonprez et al. 2001). Указанные резидентные АПК являются важными природными клетками для инициации антиген-специфичного Т-клеточного ответа в методах чтрескожной иммунизации (Merad, Ginhoux et al. 2008). После специфического связывания с CD11 b+ АПК СуаА, несущая либо вирусный, либо опухолевый антиген, может направленно доставлять антигенный груз (Preville, Ladant et al. 2005). На основе этой уникальной технологии заявитель разработал бивалентную вакцину клинической стадии для лечения инфицированных ВПЧ (HPV) пациентов: ProCervix. ProCervix представляет собой бивалентную терапевтическую вакцину, полученную из смеси двух разных СуаА-вакцин: одна содержит белок Е7 ВПЧ16 (HPV16 Е7), вторая - белок Е7 ВПЧ18 (HPV18 Е7).

Действительно, инфекции, вызываемые папилломавирусом человека (ВПЧ), являются, как правило, продолжительными, и нарушенный иммунный ответ хозяина может приводить к развитию рака шейки матки, в особенности, в случае ВПЧ высокого риска, таких как ВПЧ18 и ВПЧ16. Онкобелки Е7 ВПЧ экспрессируются на протяжении всего цикла репликации указанного вируса, делая их, таким образом, подходящими мишенями для опосредуемой Т-клетками иммунотерапии (Iwasaki 2010). Было показано, что опосредуемый В-клетками иммунитет к вирусным капсидным белкам достаточен для профилактической защиты от ВПЧ-инфекции (Stanley 2010). Однако для излечения пациентов, уже инфицированных вирусом, необходим и врожденный, и опосредуемый Т-клетками иммунитет (Frazer 2009). Кроме того, доступные профилактические вакцины против ВПЧ неэффективны в лечении уже инфицированных пациентов и избавления от заболевания, что, соответственно, подчеркивает важность разработки терапевтических вакцин, стимулирующих антиген-специфичный Т-клеточный ответ против антигенов ВПЧ (Trimble and Frazer 2009). Профилактические вакцины основаны на развитии опосредованного В-клетками иммунитета. Напротив, терапевтические вакцины предназначены для развития сильного и устойчивого провоспалительного CD4+ и CD8+ Т-клеточного ответа для эффективного лечения хронической инфекции (вирусной, бактериальной и т.д.) или рака (Bachmann and Jennings 2010). Многочисленные исследования указывают на то, что индуцирование антиген-специфичной Т-клеточной иммунности, как в мышиных моделях, так и у пациентов-людей, можно скоррелировать с защитой от пораженных заболеванием клеток, либо инфицированных, либо опухолевых (Pulendran, Li et al. 2010; Sallusto, Lanzavecchia et al. 2010). Оценка качественных и количественных аспектов ответа CD8+ Т-клеток, индуцированного терапевтической вакцинацией мышей с опухолями, позволяет предсказать терапевтический эффект, т.е. прогрессию или регрессию опухоли у отдельных животных (Rosato, Zoso et al. 2006). После успешной терапевтической вакцинации, которая приводит к полной элиминации пораженных заболеванием клеток, ключевым аспектом такой иммунотерапии должен быть потенциал к генерации долгоживущих Т-лимфоцитов памяти для защиты пациента от вторичного инфицирования патогеном. Т-лимфоциты памяти можно разделить на две основных субпопуляции клеток: ТЕМ (эффекторные клетки памяти) и ТСМ (центральные клетки памяти). Тем представляют собой первые Т-клетки памяти, формирующиеся после стадии сокращения клонов иммунного ответа, соответствующей элиминации патогена. ТЕМ представляют собой CD62L-CCR7- - клетки и располагаются преимущественно в периферических тканях, таких как кожа, кишечник и легкие, где обеспечивают хозяину первую линию защиты (Woodland and Kohlmeier 2009). С течением времени Тем постепенно дифференцируются в фенотип ТСМ: CD62L+ CCR7+. Указанные Т-лимфоциты преимущественно локализованы во вторичных лимфоидных органах (Kaech, Hemby et al. 2002; Ahmed, Bevan et al. 2009). В циркулирующей крови при этом обнаруживаются как TEM, так и ТСМ. Важнейшим аспектом эффективности CD8-ответа памяти является скорость, с которой CD8+ Τ-лимфоциты памяти приобретают литический потенциал и, соответственно, элиминируют инфицированные клетки при новом инфицировании тем же патогеном для предотвращения распространения инфекции и, в свою очередь, связанного с этим развития заболевания. Было показано, что у мышей, способных к элиминации острой инфекции вируса лимфатического хориоменингита (LCMV/ЛXM) за счет развития антиген-специфичного CD8+ Т-клеточного ответа, также развивались CD8+ Т-клетки памяти, способные быстро элиминировать инфицированные клетки (Barber et al., 2003).

На основании этих данных авторы настоящего изобретения расширили метод терапевтической вакцинации, использующий опосредуемый Т-клетками иммунный ответ, для создания новой концепции терапевтического и профилактического лечения патологического(их) состояния(ий) путем комбинированного введения активных ингредиентов в составе разработанной мультивалентной иммуногенной композиции, включающей векторизованные эпитопы.

В частности, авторы разработали мультивалентные терапевтические вакцины, подходящие для индуцирования у одного и того же пациента иммунотерапевтического лечения диагностированной патологии наряду с формированием мощного профилактического ответа против антигенов или 30 эпитопов, не связанных с указанной патологией, лечение которой проводится, и, возможно, с формированием защитного и предупредительного ответа против повторного возникновения указанной патологии, лечение которой проводится.

Действительно, применение мультивалентных терапевтических подходов на основе СуаА выявляет потенциал полипептида(ов), переносимого(ых) СуаА, для лечения и, возможно, устранения 35 установленной инфекции или рака, наряду с обеспечением сильного иммунного ответа у того же пациента, предпочтительно, защитного ответа Т-клеток памяти против целевых эпитопов, содержащихся в указанном(ых) полипептиде(ах), профилактическая защита от которых желательная, и возможно защитного и предупредительного ответа против повторного возникновения указанной определенной инфекции или ракового заболевания.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фиг. 1. Последовательность белка аденилатциклазы (СуаА) В. pertussis, В. parapertussis и В. bronchiseptica (последовательности SEQ ID NO: 1-3), и нуклеотидная последовательность СуаА В. pertussis, В. parapertussis и В. bronchiseptica (последовательности SEQ ID NO: 4-6).

Фиг. 2. Выравнивание белков СуаА В. pertussis, В. parapertussis и В. bronchiseptica.

Фиг. 3. Схематическая карта pkTRACE5, на которой указаны сайты рестрикции и встроенные последовательности, соответствующие CyaA-HPV16E7D30-42 (А) и для CyaA-HPV18E7D32-42 (В).

Фиг. 4. (А) Схематическая карта pTRACE5, на которой указаны сайты рестрикции и встроенные последовательности, соответствующие CyaA-CysOVA; (В) Схематическая карта pkTRACE5, на которой указаны сайты рестрикции и встроенные последовательности, соответствующие СуаА-MAGEA397-178/190-295- * MAGE-A3190-295 представляет собой остатки 190-221, присоединенные к остаткам 242-295 MAGE A3. Номерами 97, 178, 190, 221, 242 и 295 обозначены положения аминокислотных остатков полной последовательности MAGE-А3; (С) Последовательность белка вектора CyaA-MAGEA3 (SEQ ID NO: 7). Последовательность MAGEA3 подчеркнута. Сайты рестрикции выделены жирным шрифтом: Nhel (AS), Kpnl (GT), Agel (TG) и Spel (TS).

Фиг. 5. Терапевтическая вакцинация ProCervix с адъювантом на 11 день устраняет верифицированные солидные ТС-1-индуцированные опухоли. В конце мониторинга: в группе мышей, вакцинированных ФСБ+AldaraTM, у 3/10 мышей наблюдается регрессия опухоли (А), в группе мышей, вакцинированных только 8 мкг ProCervix, у 0/10 мышей наблюдается регрессия опухоли (В). У 7/10 мышей, вакцинированных ProCervix либо с адъювантом Aldara (Имиквимод для местного применения) (С), либо с поли-ICLC (D), наблюдается регрессия опухоли.

Фиг. 6. Терапевтическая вакцинация ProCervix с адъювантом обеспечивает как высокий уровень выживаемости, так и высокий процент не имеющих опухолей мышей в день 50. В 50 день у мышей, вакцинированных либо ProCervix+Aldaraтм, либо ProCervix+поли-ICLC, не наблюдается опухолей (А). Что касается уровня выживаемости, в день 50 были живы 100% и 70% мышей, получивших, соответственно, ProCervix+Aldaraтм и ProCervix+поли-ICLC (В) на 11 день.

Фиг. 7. Через шестьдесят дней после терапевтической вакцинации препаратом ProCervix с адъювантом у не имеющих опухолей мышей обнаруживались функциональные HPV16 E749-57- и HPV18 Е7АS43-49-специфичные CD8+ Т-клетки памяти. В день 60 не имеющим опухолей мышам разных групп инъецировали в/в CFSEhi HPV16 Е749-57-сенсибилизированные клетки-мишени, CFSEin - несенсибилизированные клетки-мишени и CFSElo НРV18Е7АS43-49-сенсибилизированные клетки-мишени в соотношении 1:1:1. На следующее утро мышей умерщвляли, извлекали селезенку и измеряли антиген-специфичную in vivo цитотоксичность с применением FACS-анализа. Каждая точка обозначает результаты, полученные на отдельной мыши; незакрашенными кружками обозначен процент киллинга HPV18 Е7АS43-49-сенсибилизированных клеток-мишеней; закрашенными кружками обозначен процент киллинга HPV16 Е749-57-сенсибилизированных клеток-мишеней. Столбиками отмечено среднее значение для группы мышей.

Фиг. 8. Общая схема вакцинации («D» означает «день»); в таблице обобщены способы и места инокуляции клеток и вакцинаций (/: без инокуляции).

Фиг. 9. Терапевтическая вакцинация СуаА-бивалентными вакцинами с адъювантом Aldaraтм, несущими антиген HPV16 Е7, приводит к элиминации индуцированных ТС-1 солидных опухолей. Объем опухолевых клеток ТС1 (мм) отслеживали с 0 (D0) по 100 (D100) день, на правом боку 10 мышей на группу. Мышей группы 1 вакцинировали плацебо, мышей группы 2 вакцинировали плацебо + Aldaraтм, мышей группы 3 вакцинировали СуаА-MAGEA397-178/190-295/CyaA-HPV16 Е7 с адъювантом Aldarтм, мышей группы 4 вакцинировали CyaA-cysOVA/CyaA-HPV16 Е7 с адъювантом Aldara, и мышей групп 5 и 6 вакцинировали ProCervix с адъювантом Aldara. Число справа от каждого графика соответствует числу, определенному для каждой мыши каждой группы.

Фиг. 10. Мыши, излечившиеся от индуцированной ТС1 опухоли в результате бивалентной вакцинации на основе СуаА, защищены от провокации другой неродственной опухолью антиген-специфичным образом. Объем опухолевых клеток В16 MAGE A3 (а и с) или опухолевых клеток EG7-OVA (b и d) на левом боку выживших после провокации ТС1 в день 60 мышей отслеживали с 60 (D60) по 100 (D100) день. Число справа от каждого графика соответствует числу, определенному ранее для каждой мыши при провокации ТС1 (Фиг. 9).

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Изобретение относится к средствам для применения (i) в иммунотерапевтическом лечении первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного у хозяина-млекопитающего, и (ii) в профилактике второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего, и (iii) возможно при предотвращении повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий). Иммунный ответ получают посредством (i) стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в полипептиде(ах), применяемого(ых) в качестве активного(ых) ингредиента(ов) для лечения указанного(ых) диагностированного(ых) патологического(их) состояния(ий), и (ii) путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в полипептиде(ах), применяемом(ых) в качестве активного(ых) ингредиента(ов) для предотвращения наступления или развития указанного(ых) второго(ых) определенного(ых) состояния(ий), и (iii) возможно путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов для предотвращения повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий), при этом указанный иммунный ответ возникает после введения указанного(ых) переносимого(ых) вектором полипептида(ов) указанному хозяину, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах). Указанные средства включают:

(1) в качестве активных ингредиентов - переносимый(ые) вектором полипептид(ы), отличающий(ие)ся тем, что несущий полипептид(ы) вектор состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего;

(2) композицию, содержащую или включающую такие активные ингредиенты, в том числе композицию, содержащую переносимый(ые) вектором полипептид(ы) согласно (1) в комбинации с фармацевтически приемлемой основой или составом; и

(3) композицию, содержащую первый(ые) переносимый(ые) вектором полипептид(ы), содержащий(ие) первую группу эпитопов и второй(ые) отдельный(ые) переносимый(ые) вектором полипептид(ы), содержащий(ие) вторую группу эпитопов.

Таким образом, согласно первому варианту реализации настоящее изобретение относится к переносимому(ым) вектором полипептиду(ам), отличающему(им)ся тем, что указанный несущий полипептид(ы) вектор состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, для применения (i) в иммунотерапевтическом лечении первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у указанного хозяина-млекопитающего, путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах) и (ii) в профилактике второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), и (iii) возможно при предотвращении повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий) путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), при этом указанный иммунный ответ возникает после введения указанного(ых) переносимого(ых) вектором полипептида(ов) указанному хозяину, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах). Настоящее изобретение также относится к композиции, содержащей, в комбинации с фармацевтически приемлемой основой, переносимый(ые) вектором полипептид(ы), отличающейся тем, что указанный несущий полипептид(ы) вектор состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, для применения (i) в иммунотерапевтическом лечении первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у указанного хозяина-млекопитающего, путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах) и (ii) в профилактике второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), и (iii) возможно при предотвращении повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий) путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах); указанные иммунные ответы достигаются после введения указанной композиции указанному хозяину, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в переносимом(ых) вектором полипептиде(ах) указанной введенной композиции.

Настоящее изобретение также относится к композиции, содержащей, возможно в комбинации с фармацевтически приемлемой основой:

(a) первый(ые) переносимый(ые) вектором полипептид(ы), отличающий(ие)ся тем, что указанный первый вектор, несущий полипептид(ы), состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, и тем, что первая группа эпитопов содержится в указанном(ых) полипептиде(ах) указанного первого вектора;

(b) второй(ые) отдельный(ые) переносимый(ые) вектором полипептид(ы), отличающий(ие)ся тем, что указанный второй вектор, несущий полипептид(ы), состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, и тем, что вторая группа эпитопов содержится в указанном(ых) полипептиде(ах) в указанном втором векторе; и

(с) возможно, один или более дополнительных переносимых вектором полипептидов, отличных от описанных в (а) и (b), для применения при (i) комбинированном иммунотерапевтическом лечении патологии, связанной с указанной первой группой эпитопов и (ii) иммунопрофилактическом лечении, связанном с указанной второй группой эпитопов, и (iii) возможно предотвращением повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий), причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в переносимом(ых) вектором полипептиде(ах) указанной введенной композиции.

Согласно конкретному варианту реализации указанная композиция с (а), (b) и (с) предназначена для применения (i) в иммунотерапевтическом лечении первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у указанного хозяина-млекопитающего, путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов и (ii) в профилактике второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), и (iii) возможно при предотвращении повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий) путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), указанные иммунные ответы достигаются после введения указанной композиции указанному хозяину.

Термин «СуаА» означает аденилатциклазу (или аденилциклазу) видов Bordetella, в частности, СуаА Bordetella pertussis, Bordetella parapertussis или Bordetella bronchiseptica. Белок-аденилатциклаза Bordetella pertussis представляет собой токсин из 1706 остатков (SEQ ID ΝΟ: 1), содержащий N-концевой каталитический домен из 400 аминокислотных остатков и С-концевую часть из 1306 остатков. С-концевая часть отвечает за связывание токсина с мембраной клетки-мишени и последующую доставку каталитического фрагмента в цитозоль клетки-мишени. Последовательность СуаА Bordetella pertussis приведена на Фиг. 1. Белок СуаА В. parapertussis и В. bronchiseptica содержит 1740 аминокислот, и соответствующие им последовательности (SEQ ID NO: 2 и SEQ ID NO: 3) раскрыты на Фиг. 1.

Выражение «фрагмент СуаА» означает часть белка СуаА, возможно включающую полностью или частично С-концевую часть полного белка СуаА, при условии, что указанный фрагмент обладает способностью к презентированию указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, т.е. способен приводить к индукции специфического иммунного ответа(ов) против эпитопов, содержащихся в переносимом(ых) вектором полипептиде(ах), или содействовать указанному ответу. В частности, указанный фрагмент СуаА способен специфично связываться с CD11b-экспрессирующими клетками и возможно доставлять указанный(ые) полипептид(ы) в цитозоль клеток. Указанный фрагмент включает белок СуаА, который был усечен (делетирован по N-концу и/или С-концу) или полный белок с удаленным(и) внутренним(и) аминокислотным(и) остатком(ами). Соответственно, конкретный фрагмент белка СуаА в соответствии с настоящим изобретением состоит из аминокислотных остатков 372-1706 белка СуаА В. pertussis (усечение первых 371 остатков). Другой конкретный фрагмент представляет собой белок СуаА В. pertussis, в котором удалены аминокислотные остатки 225-234, с получением фрагмента СуаА, состоящего из остатков 1-224 и 235-1706 (внутренняя делеция). Термин «специфичный» в контексте настоящего изобретения означает, что аденилатциклаза или ее фрагмент при применении в качестве векторной молекулы нацелен(а) преимущественно на CD11b-экспрессирующие клетки, тем самым представляя собой средство нацеливания полипептида(ов) на поверхность указанных клеток или внутрь указанных клеток селективным образом относительно прочих клеток (не экспрессирующих CD11b).

Термин «СуаА» также охватывает белок СуаА или его фрагменты, модифицированный(ые), предпочтительно посредством одного или более следующего: замены аминокислот(ы), внутренней вставки аминокислот(ы) или внутренней делеции аминокислот(ы), с получением детоксифицированного или нетоксичного продукта, либо продукта, лишенного ферментативной (инвазивной и цитотоксической) активности. Соответственно, такой белок СуаА (или его фрагменты) не обладает каталитической активностью, но его способность презентировать указанный(ые) полипептид(ы) иммунной системе хозяина-млекопитающего и, возможно, специфически связываться с рецептором CD11b/CD18 и/или процесс транслокации каталитического домена исходного белка СуаА не нарушен(ы). Примером общеизвестного нетоксичного белка СуаА является СуаА Bordetella pertussis, в котором дипептид Leu-Gln встроен внутри рамки между остатками Asp188 и Ilе189 (важная часть каталитического участка). Определение отсутствия токсичности или ферментативной активности указанного белка СуаА (или его фрагментов) может проводиться, как описано у Ladant et al. (1992). Способность белка СуаА (или его фрагментов) к нацеливанию на клетки CD11b/CD18 можно оценить, в частности, в соответствии со способами, описанными в ЕР 03291486 или в WO 02/22169. Кроме того, способность белка СуаА (или его фрагментов) к перемещению антигенного полипептида в цитозоль клетки-мишени можно оценить с помощью способа, описанного в WO 02/22169.

Согласно еще одному конкретному варианту реализации термин «СуаА» охватывает также белок СуаА (или его фрагменты), который(ые) был(и) модифицирован(ы) посредством посттрансляционных модификаций, например, посттрансляционного пальмитоилирования по меньшей мере одного остатка, в частности, двух внутренних остатков лизина (лизины 860 и 983). Указанная (указанные) посттрансляционная(ые) модификация(ии) может(гут) быть получена(ы) с помощью совместной экспрессии генов суаА и суаС. Таким образом, белок СуаА или его фрагмент в составе переносимого(ых) вектором полипептида(ов) может представлять собой белок СуаА или его фрагмент, полученный в результате совместной экспрессии в клетке, в частности, в рекомбинантной клетке, генов суаА и суаС.

Термин «вектор» или «векторная молекула» при использовании в настоящей заявке охватывает полноразмерный белок СуаА или его фрагменты, модифицированные или немодифицированные, согласно подробному описанию в настоящей заявке.

Термин «CD11b-экспрессирующие клетки» означает Т-клетки, экспрессирующие на поверхности рецептор CD11b/CD18 (CD11b+). В частности, это гранулоциты/нейтрофилы, макрофаги, естественные киллеры, субпопуляции CD8+ Т-клеток, субпопуляции В-клеток, клетки Лангерганса, дендритные клетки и миелоидные дендритные клетки.

Выражение «переносимый(ые) вектором полипептид(ы)» означает, что белок СуаА (или его фрагменты) несет по меньшей мере один полипептид, гетерологичный относительно СуаА, в частности, не являющийся фрагментом СуаА согласно определению в настоящей заявке, и, в частности, не вступающий в иммунологическую перекрестную реакцию с СуаА. Выражение «по меньшей мере один» означает один полипептид или более, в частности, 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 полипептид(ов), предпочтительно 1, 2 или 3 полипептид(а).

Термин «переносит» (несет) охватывает различные структуры, связывающие белок СуаА или его фрагмент согласно настоящему изобретению с полипептидом(ами). Такие структуры могут быть получены в результате:

- химического связывания по меньшей мере одного полипептида в соответствии с настоящим изобретением с СуаА или его фрагментами. Способы химического связывания полипептида с СуаА или его фрагментами общеизвестны в данной области техники и включают, например, дисульфидную(ые) связь(и), предпочтительно с применением N-пиридил сульфонил-активированного сульфгидрила. Так как в составе первичной последовательности природного белка СуаА отсутствуют остатки цистеина, остаток цистеина генетически встраивают в белок СуаА, в частности, в каталитический домен, предпочтительно в пермиссивный сайт согласно приведенному ниже определению (например, в позицию 235) или по одному из концов СуаА; и

- соединение генов или гибридизация генов по меньшей мере одного полипептида и СуаА или его фрагментов. Соединение или гибридизация генов включает генетическое встраивание нуклеиновой кислоты, кодирующей указанный по меньшей мере один полипептид в соответствии с настоящим изобретением в рамке в нуклеиновую кислоту, кодирующую белок СуаА или его фрагмент (т.е. без сдвига рамки белка СуаА), предпочтительно в область каталитического домена белка СуаА, с получением в результате рекомбинантного белка. Соответственно, указанный по меньшей мере один полипептид может быть встроен в любой пермиссивный сайт белка СуаА (см. WO 93/21324). Термин «пермиссивный сайт» в контексте настоящей заявки относится к участку, куда может(гут) быть встроен(ы) полипептид(ы) без существенного нарушения необходимых функциональных свойств аденилатциклазы, т.е. без нарушения способности белка СуаА презентировать указанные полипептиды иммунной системе хозяина-млекопитающего, в частности, без нарушения специфического связывания с рецептором CD11b/CD18 и возможно без нарушения процесса транслокации полипептида(ов) в цитозоль клетки-мишени. Пермиссивные сайты аденилатциклазы Bordetella pertussis включают, но не ограничиваются перечисленными: остатки 107-108 (Gly-His), 132-133 (Met-Ala), 137-138 (Val-Ala), 224-225 (Arg-Ala), 228-229 (Glu-Ala), 232-233 (Gly-Leu), 235-236 (Arg-Glu), 317-318 (Ser-Ala) и 335-336 (Gly-Gln) (Sebo et al., 1985; Glaser et al., 1988). У других видов Bordetella соответствующие пермиссивные сайты могут быть определены путем сравнения последовательностей и определения соответствующих остатков (Фиг. 2). В соответствии с другим вариантом реализации соединение генов также включает присоединение нуклеиновой кислоты, кодирующей указанный по меньшей мере один полипептид, к одному и/или другому концу белка СуаА или его фрагментов. В том случае, если белок СуаА (или его фрагменты) переносит(ят) более чем один полипептид, либо все указанные полипептиды могут переноситься посредством химического связывания или посредством соединения генов (предпочтительно все встроены генетически), либо один(одни) из них переносит(ят)ся посредством химического связывания, в то время как другой(ие) переносит(ят)ся посредством соединения генов. Согласно конкретному варианту реализации, в том случае, если все указанные полипептиды генетически встраивают в СуаА, предпочтительно в пермиссивные сайты СуаА, указанные полипептиды встраивают в разные сайты, предпочтительно - разные пермиссивные сайты. Согласно другому варианту реализации, в том случае, если все указанные полипептиды генетически встраивают в СуаА, предпочтительно в пермиссивные сайты СуаА, указанные полипептиды встраивают в один и тот же сайт, предпочтительно в один и тот же пермиссивный сайт.

Термин «полипептид» относится к последовательному соединению аминокислот, и длина его составляет по меньшей мере 9 аминокислотных остатков, в частности, 9-500 остатков, 9-200, 9-100, 9-50 остатков, или от 30 или 50 до 500 или до 200 остатков, или от 100 до 500, или от 100 до 200 остатков. В рамках настоящего изобретения термин «полипептид» означает полипептид, способный при переносе векторной молекулой индуцировать иммунный ответ, в частности, Т-клеточный иммунный ответ, против эпитопа(ов), содержащихся в указанном полипептиде. Полипептид(ы), содержащий(ие)ся в векторной(ых) молекуле(ах) могут быть получены из опухолевого антигена, т.е. пептида, экспрессируемого опухолью или раковыми клетками, независимо от того, является ли опухоль самостоятельной или индуцирована патогеном; указанный опухолевый антиген может быть собственным (в частности, полученным из организма человека) или происходить из патогена, индуцирующего опухоль.

Термин «опухолевый антиген» охватывает следующие группы опухолевых антигенов, и полипептид(ы), содержагций(ие)ся в векторной(ых) молекуле(ах) согласно настоящему изобретению может(гут) быть выбран(ы) из по меньшей мере одной из следующих групп: (а) онкофетальный опухолевые антигены, (b) онковирусные опухолевые антигены, (с) избыточно экспрессируемые/накапливающиеся опухолевые антигены, экспрессируемые в разнообразных нормальных тканях и избыточно экспрессируемые в опухолях, (d) общие опухолеспецифичные антигены или антигены СТ, экспрессируемые во многих опухолях, но не экспрессируемые в нормальных тканях (включая семейство ВAGE, семейство GAGE, семейство MAGE, семейство SAGE и семейство XAGE), (е) линиеспецифические опухолевые антигены, (f) мутантные опухолевые антигены, появляющиеся в результате точечных мутаций генов, которые экспрессируются повсеместно; и (g) опухолевые антигены дифференцировки, экспрессируемые в нормальной ткани, из которой происходят опухоли, но не опухолеспецифичные.

Согласно одному варианту реализации в тех случаях, когда более одного полипептида применяется в одной векторной молекуле для получения иммунотерапевтического ответа, или в одной векторной молекуле для получения иммунопрофилактического ответа, все указанные полипептиды являются производными опухолевых антигенов.

Согласно другому варианту реализации полипептид(ы), содержащий(ие)ся в векторной(ых) молекуле(ах) могут в качестве дополнения или альтернативы быть получены из антигена патогена, т.е. антигена, синтезируемого патогеном внутри инфицированного хозяина-млекопитающего, и вероятно процессируемого в клетках указанного инфицированного хозяина-млекопитающего, или компонента указанного патогена. Примерами антигенов патогенов являются бактериальный антиген, вирусный антиген, антиген гриба или антиген паразита. В указанных примерах, как частных вариантах реализации, можно вычленить патогены, участвующие в образовании опухолей (онкопатогены), и патогены, не вовлеченные в образование опухолей. Примерами патогенов являются внутриклеточные патогены, в частности, патогены, индуцирующие Т-клеточный(ые) иммунный(ые) ответ(ы) у хозяина. Соответственно, указанные полипептид(ы) может(гут) быть получен(ы) из указанных организмов, но не ограничиваясь ими: Chlamydia, Plasmodium, Leishmania, Mycobacterium tuberculosis, ВИЧ, ВПЧ, НВV (ВГВ), НСV (ВГС), аденовирусов, ЕВV (ВЭБ), герпесвируса, вируса HTLV.1 (ТЛВЧ-1) и ЦМВ. Согласно конкретному варианту реализации полипептид(ы), содержащий(ие)ся в векторной(ых) молекуле(ах) может(гут) быть получены из поверхностного белка патогена (такого как оболочечный белок ВИЧ), либо из полипептида, взаимодействующего с механизмами инфицированной клетки (такого как Е6 или Е7 ВПЧ).

Согласно одному варианту реализации в тех случаях, когда в одной векторной молекуле или в комбинации векторов применяют более одного полипептида, все указанные полипептиды являются производными антигенов патогенов, возможно, разных патогенов, родов или видов.

Согласно конкретному варианту реализации все полипептиды, содержащиеся в векторной(ых) молекуле(ах), получены из бактериальных антигенов, из вирусных антигенов, из антигенов грибов или из антигенов паразитов. Согласно другому варианту реализации отдельные полипептиды, содержащиеся в векторной(ых) молекуле(ах), описанных в настоящей заявке, получены независимо из бактериального антигена, вирусного антигена, антигена гриба или антигена паразита. Согласно другому варианту реализации полипептиды в составе одной векторной молекулы или комбинации векторов получены из опухоли и из патогена.

Выражение «получен из» (является производным) в отношении полипептида, переносимого векторной молекулой, означает либо полный антигенный белок, либо фрагмент указанного антигенного белка, либо синтетический не встречающийся в природе полипептид, несущий эпитоп(ы), состоящий из нескольких слитых фрагментов антигенного белка, либо синтетический не встречающийся в природе полипептид, состоящий из одного или нескольких слитых фрагментов нескольких белков, при условии, что указанный фрагмент или указанный синтетический не встречающийся в природе полипептид способен при переносе молекулой(ами) вектора индуцировать иммуный ответ, в частности, Т-клеточный иммунный ответ, против антигенной детерминанты, содержащейся в указанном фрагменте или полипептиде. Согласно данному определению полипептид(ы), переносимый(ые) молекулой(ами) вектора представляет собой или содержит уникальный эпитоп, либо представляет собой или содержит группу эпитопов. Выражение «группа эпитопов» охватывает по меньшей мере один эпитоп, т.е. один эпитоп или более, в частности, от 10 до 500 эпитопов, от 50 до 200 эпитопов и от 80 до 150 эпитопов. Согласно конкретному варианту реализации выражение «группа эпитопов» означает 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 эпитопов. Согласно конкретному варианту реализации полипептид(ы), переносимый(ые) молекулой(ами) вектора представляет(ют) собой или содержит(ат) полиэпитоп, т.е. а полипептид с по меньшей мере двумя эпитопами, в частности, по меньшей мере двумя Т-клеточными эпитопами. Эпитопы согласно настоящему изобретению являются линейными или конформационными, предпочтительно - линейными, и представляют собой любую последовательность аминокислот, вовлеченную в индуцирование опосредованного клетками иммунного ответа, в частности, Т-клеточного иммунного ответа. Соответственно, эпитопы в описанном(ых) в настоящей заявке переносимом(ых) вектором полипептиде(ах) включают процессируемые АПК (антиген-презентирующими клетками) хозяина, в частности, Т-эпитопы, опознаваемые в комплексе с молекулами МНС (главного комплекса гистосовместимости) класса I, такие как эпитопы, клетками-мишенями которых являются CD8+ T-лимфоциты, или Т-эпитопы, опознаваемые в комплексе с молекулами МНС класса II, например, такие, клетками-мишенями для которых являются CD4+ Т-лимфоциты. Согласно конкретному варианту реализации указанный(ые) полипептид(ы) также содержит(ат) В-эпитоп(ы), вовлеченный(ые) в гуморальный ответ. Согласно конкретному варианту реализации полипептид(ы), переносимый(ые) молекулой(ами) вектора, состоит(ят) из или включает(ют) несколько разных или несколько идентичных эпитопов. В соответствии с настоящим изобретением переносимый(ые) вектором полипептид(ы) содержит(ат) по меньшей мере две разные группы эпитопов, т.е. одна группа эпитопов способна вызывать Т-клеточный иммунный ответ, обеспечивая иммунотерапевтическое лечение первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у хозяина-млекопитающего, в то время как вторая группа эпитопов способна вызывать иммунный ответ Т-клеток памяти, обеспечивая профилактику второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего. Согласно конкретному варианту реализации указанная первая группа эпитопов возможно способна вызывать, помимо Т-клеточного ответа, обеспечивающего иммунотерапевтическое лечение первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у хозяина-млекопитающего, иммунный ответ Т-клеток памяти против указанной первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), обеспечивая предотвращение повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий).

В соответствии с настоящим изобретением, в отсутствие указанной второй группы эпитопов в указанном(ых) переносимом(ых) вектором полипептиде(ах), профилактика второго(ых) определенного(ых) патологического(ых) состояния(ий) не наблюдается. Это означает, что вторая группа эпитопов согласно определению в настоящей заявке необходима для достижения профилактики второго(ых) определенного(ых) патологического(их) состояния(ий).

Согласно конкретному варианту реализации указанная вторая группа эпитопов [в переносимом(ых) вектором полипептиде(ах)] необходима и достаточна для достижения профилактики второго(ых) определенного(ых) патологического(их) состояния(ий); согласно указанному варианту реализации вклад только второй группы эпитопов в индуцированный иммунный ответ достаточен для достижения профилактики второго(ых) определенного(ых) патологического(их) состояния(ий). Иными словами, между введением указанной второй группы эпитопов и указанным профилактическим ответом имеется причинно-следственная связь.

Согласно другому варианту реализации указанная вторая группа эпитопов [в переносимом(ых) вектором полипептиде(ах)] необходима для осуществления профилактики второго(ых) определенного(ых) патологического(их) состояния(ий), но недостаточна, либо вклад первой группы оказывает благоприятное влияние, что означает, что профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) достигается при сочетании индуцированного иммунного ответа против второй группы эпитопов и индуцированного иммунного ответа против первой группы эпитопов. В указанном последнем случае вклад обеих групп эпитопов необходим для осуществления профилактики второго(ых) определенного(ых) патологического(их) состояния(ий).

Необходимость вклада второй группы эпитопов в профилактике второго(ых) определенного(ых) патологического(их) состояния(ий) может быть показана путем сравнения эффекта от введения переносимого(ых) вектором полипептида(ов) согласно настоящему изобретению на указанное второе(ые) определенное(ые) патологическое(ие) состояние(ия) [термин «профилактика» определен ниже] в двух следующих группах млекопитающих, в частности, в двух следующих группах группах мышей: (1) млекопитающие, которым вводят переносимый(ые) вектором полипептид(ы) согласно настоящему изобретению, не несущий(ие) вторую группу эпитопов согласно определению в настоящей заявке и (2) млекопитающие, которым вводят переносимый(ые) вектором полипептид(ы) согласно настоящему изобретению, несущий(ие) вторую группу эпитопов согласно Определению в настоящей заявке.

Как ясно из выражения «при этом указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается (не происходит) в тех случаях, когда указанная вторая группа эпитопов не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах)», исключено, что первая группа эпитопов согласно определению в настоящей заявке достаточна (т.е. сама по себе) для достижения профилактики второго(ых) определенного(ых) патологического(их) состояния(ий).

Соответственно, согласно одному варианту реализации последовательность аминокислот первой группы эпитопов (или полипептида(ов), состоящего(их) из указанной первой группы эпитопов) отличается от последовательности аминокислот второй группы эпитопов (или полипептид(ы), состоящие из указанной второй группы эпитопов). Термин «отличается» означает, что две последовательности различаются по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90%, или по меньшей мере на 95%, при расчете с учетом всей длины последовательности указанных полипептидов (глобальное выравнивание выполняют, например, с применением алгоритма Нидлмана - Вунша). Согласно альтернативному определению или одному варианту реализации указанных «отличных (разных) последовательностей», по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 80%, по меньшей мере 90% эпитопов первой группы имеют последовательность, которая отличается от последовательности эпитопов второй группы. Согласно еще одному одному варианту реализации первая и вторая группы эпитопов (или полипептид(ы), состоящий(ие) из первой группы эпитопов и полипептид(ы), состоящий(ие) из второй группы эпитопов) не имеют общих последовательностей эпитопов. Согласно одному варианту реализации индуцированный Т-клеточный иммунный ответ против первой группы эпитопов эффективен против патологического(их) состояния(их), связанного(ых) с первой группой эпитопов, и неэффективен или не слишком эффективен против патологического(их) состояния(ий), связанного(ых) с второй группой эпитопов. Таким образом, согласно одному варианту реализации индуцированный Т-клеточный иммунный ответ против группы эпитопов специфичен для указанной группы, т.е. Т-клетки, вовлеченные в иммунный ответ против указанной группы эпитопов, не распознают другую группу эпитопов. Согласно одному варианту реализации указанные полипептид(ы) содержат по меньшей мере один эпитоп из штаммов ВПЧ, в частности, штаммов ВПЧ, выбранных из родов альфа-папилломавирус, бета-папилломавирус, гамма-папилломавирус, дельта-папилломавирус, эпсилон-папилломавирус, зета-папилломавирус, эта-папилломавирус, тэта-папилломавирус, lota-папилломавирус, каппа-папилломавирус, лямбда-папилломавирус, мю-папилломавирус, ню-папилломавирус, кси-папилломавирус, омикрон-папилломавирус и пи-папилломавирус.Согласно одному варианту реализации предпочтительными являются папилломавирусы с тропизмом к человеку, например, штаммы рода альфа-папилломавирус, бета-папилломавирус, гамма-папилломавирус, мю-папилломавирус или ню-папилломавирус.Согласно более одному варианту реализации полипептид(ы) содержит(ат) по меньшей мере один эпитоп штаммов ВПЧ рода альфа-папилломавирус, в частности, штамма видов ВПЧ 7 и 9 рода альфа-папилломавирус (de Villiers et al. Virology 2004). Соответственно, указанный(ые) полипептид(ы) содержит(ат) по меньшей мере один эпитоп из высокоонкогенных типовых видов ВПЧ, таких как ВПЧ16, ВПЧ18, ВПЧ31, ВПЧ33, ВПЧ35, ВПЧ45, ВПЧ52 или ВПЧ58. Среди указанных типовых видов особенный интерес представляют ВПЧ18 и ВПЧ16. Согласно варианту реализации полипептиды, переносимые молекулой(ами) вектора(ов) согласно описанию в настоящей заявке, получены из разных штаммов ВПЧ или разных типовых видов ВПЧ, выбранных из описанных выше. Согласно другому одному варианту реализации и независимо от выбора штаммов ВПЧ или типовых видов ВПЧ, указанные полипептиды получены из белков L1, L2, E1, Е2, Е4, Е5, Е6 или Е7, при этом особенный интерес представляют полипептиды с эпитопами белков Е6 или Е7 штаммов ВПЧ или типовых видов ВПЧ. Согласно одному варианту реализации полипептиды, переносимые молекулой(ами) вектора(ов) согласно описанию в настоящей заявке, получены из одного и того же белка ВПЧ, но разных штаммов ВПЧ, либо разных типовых видов ВПЧ, выбранных из описанных выше. Согласно одному варианту реализации настоящего изобретения для конструирования полипептидов применяют белки Е6 или Е7 ВПЧ16 и белки Е6 или Е7 ВПЧ18, более предпочтительно белок Е7 типовых видов ВПЧ16 и ВПЧ18. В соответствии с конкретным вариантом реализации настоящего изобретения векторная молекула переносит несколько полипептидов, предпочтительно за счет встраивания генов, при этом каждый из них содержит или представляет собой один или несколько эпитопов одного или нескольких белков ВПЧ по меньшей мере двух различных штаммов ВПЧ или двух видов различных типов ВПЧ. Соответственно, в конкретном варианте реализации предложены переносимые вектором полипептиды, состоящие из белка СуаА или его фрагмента, несущего полипептид или несколько полипептидов, содержащих эпитопы, происходящие из белка Е6 или белка Е7 видов типа ВПЧ, как ВПЧ16, так и ВПЧ18. Согласно другому варианту реализации настоящее изобретение относится к композиции, содержащей первую векторную молекулу, несущую полипептид или несколько полипептидов, содержащих эпитопы, происходящие из белка Е6 или Е7 ВПЧ16 (первые переносимые вектором полипептиды с первой группой эпитопов), и отдельную векторную молекулу, несущую полипептид или несколько полипептидов, содержащий(их) эпитопы, происходящие из белка Е6 или Е7 ВПЧ18 (отдельные переносимые векторами полипептиды с второй группой эпитопов). В том случае, если несколько полипептидов переносит одна векторная молекула, указанные полипептиды могут состоять из разных фрагментов одного и того же белка, например, белка Е7 или Е6, встроенных в различные участки, в частности, в пермиссивные сайты векторной молекулы.

Соответственно, композиция для применения согласно настоящему изобретению содержит переносимый(ые) вектором полипептид(ы), полученный(ые) из белка Е7 ВПЧ16, и переносимый(ые) вектором полипептид(ы), полученный(ые) из белка Е7 ВПЧ18. Пример такой композиции включает:

(a) первую векторную молекулу, несущую первый полипептид, который представляет собой фрагмент, содержащий остатки 1-29, или фрагмент, состоящий из остатков 1-29 Е7 ВПЧ16, и несущую второй полипептид, который представляет собой фрагмент, содержащий остатки 43-98 или фрагмент, состоящий из остатков 43-98 белка Е7 ВПЧ16. Согласно предпочтительному варианту реализации первый полипептид представляет собой первые 29 аминокислотных остатков ВПЧ16-Е7 и встроен между кодонами 319 и 320 СуаА, а второй полипептид состоит из остатков 43-98 ВПЧ16-Е7 и встроен между кодонами 224 и 235 СуаА (примером служит вектор PKTRACE5 - HPV16Е7Δ30-42); и

(b) отдельную векторную молекулу, несущую первый полипептид, который представляет собой фрагмент, содержащий остатки 1-31 Е7 ВПЧ18, или фрагмент, состоящий из остатков 1-31 Е7 ВПЧ18, и второй полипептид, который представляет собой фрагмент, содержащий остатки 43-105 Е7 ВПЧ18, или фрагмент, состоящий из остатков 43-105 Е7 ВПЧ18. Согласно предпочтительному варианту реализации первый полипептид представляет собой первый 31 аминокислотный остаток Е7 ВПЧ18 и встроен между кодонами 319 и 320 СуаА, а второй полипептид состоит из остатков 43-105 Е7 ВПЧ18 и встроен между кодонами 224 и 235 СуаА (примером служит вектор PKTRACE5-ΗΡV18Ε7Δ32-42).

Согласно другому варианту реализации указанный(ые) полипептид(ы) содержи(а)т по 30 меньшей мере один эпитоп, происходящий из опухолевого антигена MAGE A3, например, полипептид, состоящий из остатков 97-178 MAGE A3 (SEQ ID NO: 8), или, например, полипептид, состоящий из остатков 190-221, присоединенных к остаткам 242-295 MAGE A3 (SEQ ID NO: 9). Согласно одному варианту реализации переносимый(ые) вектором полипептид(ы) согласно настоящему изобретению (или содержащая его/их композиция) состои(я)т из белка СуаА, предпочтительно, СуаА В. pertussis, в котором два полипептида, происходящих из MAGE A3, встроены в два различных участка. Такой(ие) переносимый(ые) вектором полипептид(ы) состои(я)т из СуаА В. pertussis, отличающегося тем, что (1) первый полипептид, состоящий из остатков 97-178 MAGE A3, встроен между кодонами 319 и 320 СуаА, а (2) второй полипептид, состоящий из остатков 190-221, присоединенных к остаткам 242-295 MAGE A3, встроен между кодонами 234 и 235 СуаА. Конкретный пример CyaA-MAGE А3-вектора приведен на Фиг. 4С (SEQ ID NO: 7).

Переносимый(ые) вектором полипептид(ы) согласно определению в настоящей заявке, отдельно или в составе композиции, применяют для достижения у одного и того же хозяина-млекопитающего, в частности, человека, (i) иммунотерапевтического лечения первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у указанного хозяина-млекопитающего, путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах) и (ii) профилактики второго(ых) определенного(ых) патологического(их) состояния(ий) путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), и (iii) возможно предотвращения повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий) путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), при этом указанный иммунный ответ возникает после введения указанного(ых) переносимого(ых) вектором полипептида(ов) указанному хозяину, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах). В соответствии с одним из вариантов реализации настоящего изобретения полипептид(ы) согласно определению в настоящей заявке, переносимый(ые) молекулой(ами) вектора, выбирают в соответствии с нужными группами эпитопов, и они могут быть классифицированы в две группы:

- первая группа эпитопов относится к полипептиду(а), который(ые) получен(ы) из антигена, который, по имеющимся данным, экспрессируется в иммунной системе или презентируется иммунной системе хозяина-млекопитающего, который инфицирован определенным патогеном, у которого развивается определенная опухоль или присутствует(ют) первое(ые) определенное(ые) патологическое(ие) состояние(ия), при этом у указанного хозяина-млекопитающего диагностированы указанная конкретная инфекция, указанная конкретная опухоль или указанное(ые) первое(ые) определенное(ые) патологическое(ие) состояние(ия) до введения переносимого(ых) вектором полипептида(ов) или композиции согласно определению в настоящей заявке; и

- вторая группа эпитопов относится к полипептиду(ам), который(ые) получен(ы) из антигена, который, по имеющимся данным, экспрессируется в иммунной системе или презентируется иммунной системе хозяина-млекопитающего, который инфицирован определенным патогеном, у которого развивается определенная опухоль или присутствует(ют) второе(ые) определенное(ые) патологическое(ие) состояние(ия), при этом указанный хозяин млекопитающее не инфицирован, либо не был ранее инфицирован указанным другим конкретным патогеном, у него не развивался указанный другой тип опухоли или не имелось(ись) указанного(ых) другого(их) второго(ых) определенного(ых) патологического(их) состояния(ий) до введения переносимого(ых) вектором полипептида(ов) или композиции согласно определению в настоящей заявке.

Настоящее изобретение основано на следующих наблюдениях:

(i) иммунотерапевтическое лечение первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у хозяина-млекопитающего, может быть достигнуто путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в полипептиде(ах), переносимом(ых) векторной молекулой; (ii) профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) у того же хозяина-млекопитающего может быть достигнута путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащиеся в полипептиде(ах); и

(iii) возможно, предотвращение повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий) может быть достигнуто путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, содержащихся в указанном(ых) полипептиде(ах), переносимом(ых) векторной молекулой;

указанная вторая группа эпитопов переносится либо той же векторной молекулой, либо отдельной векторной молекулой, и вводится в составе одной и той же композиции и одновременно с первой векторной молекулой.

Соответственно, векторная молекула как таковая согласно определению в настоящей заявке, или в составе композиции, либо векторные молекулы в композиции согласно определению в настоящей заявке, переносит(ят) по меньшей мере один, предпочтительно один, полипептид, содержащий эпитоп(ы) первой группы, и по меньшей мере один полипептид, содержащий эпитоп(ы) второй группы. Согласно другим вариантам реализации векторная молекула как таковая согласно определению в настоящей заявке, или в составе композиции, либо векторные молекулы в композиции согласно определению в настоящей заявке, переносит(ят) (а) один полипептид, содержащий эпитоп(ы) первой группы, и по меньшей мере один полипептид, содержащий эпитоп(ы) второй группы, (b) один полипептид, содержащий эпитоп(ы) первой группы, и по меньшей мере один полипептид, содержащий эпитоп(ы) второй группы, выбранный из 1, 2, 3, 4, 5 или 6 полипептидов, (с) по меньшей мере один полипептид, содержащий эпитоп(ы) первой группы, выбранный из 2 или 3 полипептидов, и по меньшей мере один полипептид, содержащий эпитоп(ы) второй группы; и (d) по меньшей мере один полипептид, содержащий эпитоп(ы) первой группы, выбранный из 2 или 3 полипептидов, и по меньшей мере один полипептид, содержащий эпитоп(ы) второй группы, выбранный из 1, 2, 3, 4, 5 или 6 полипептидов.

В случае, если один переносимый вектором полипептид применяют самостоятельно или в составе композиции, указанный вектор может переносить один полипептид, содержащий эпитоп(ы) первой группы и эпитоп(ы) второй группы, т.е. указанная вторая группа эпитопов содержится в том же полипептиде, что и первая группа эпитопов.

Согласно другому варианту реализации указанные первая и вторая группа эпитопов содержатся в разных полипептидах. Полипептид, содержащий эпитоп(ы) первой группы, и полипептид, содержащий эпитоп(ы) второй группы, могут переноситься одной и той же векторной молекулой, Согласно другому варианту реализации полипептид, содержащий эпитоп(ы) первой группы, и полипептид, содержащий эпитоп(ы) второй группы, могут переноситься разными векторными молекулами и быть включены в состав одной композиции. В том случае, если применяют композицию, содержащую первый(ые) и второй(ые) отдельный(ые) переносимый(ые) вектором полипептид(ы), первая векторная молекула переносит по меньшей мере один полипептид, содержащий эпитоп(ы) первой группы, что означает, что один полипептид, содержащий эпитоп(ы) первой группы, как минимум, переносится указанной первой векторной молекулой. В той же композиции вторая векторная молекула переносит по меньшей мере один полипептид, содержащий эпитоп(ы) второй группы, что означает, что один полипептид, содержащий эпитоп(ы) второй группы как минимум, переносится указанной второй отдельной векторной молекулой. Наконец, необязательный один или более (например, 1, 2, 3, 4, 5 или 6) переносимых вектором полипептид овможет также быть включен в указанную композицию, какая бы группа эпитопов не содержалась в указанном/указанных переносимом(ых) вектором полипептиде(ах).

Под «иммунным ответом» подразумевается опосредуемый клетками иммунный ответ, в частности, опосредуемый Т-клетками иммунный ответ. Согласно одному варианту реализации указанный опосредуемый Т-клетками иммунный ответ представляет собой клеточный цитотоксичный иммунный ответ цитотоксических лимфоцитов (CTL), в частности, CD8+ иммунный ответ. В том случае, если полипептид(ы) происходит(ят) из опухолевого антигена, указанный иммунный ответ представляет собой предпочтительно опухолеспецифичный цитотоксичный иммунный ответ, в который вовлечены опухолеспецифичные цитотоксические лимфоциты. Согласно одному варианту реализации указанный опосредуемый Т-клетками иммунный ответ представляет собой CD4+ иммунный ответ, в частности, иммунный ответ Т-хелперов. Согласно одному варианту реализации иммунный ответ, в частности, индуцированный(ые)иммунный(ые) ответ(ы) против эпитопов второй группы (согласно определению в настоящей заявке) после введения переносимого(ых) вектором полипептида(ов) или композиции согласно определению в настоящей заявке, представляет собой иммунный ответ Т-клеток памяти. Выражение «иммунный ответ» может также охватывать, помимо клеточного иммунного ответа, описанного выше, гуморальный иммунный ответ (выработку антител). Описываемые в настоящей заявке иммунные ответы достигаются после введения хозяину переносимого(ых) вектором полипептида(ов) согласно настоящему изобретению, как таковых или в составе композиции.

Выражение «иммунотерапевтическое лечение» относится к лечению (первого(ых)) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у хозяина-млекопитающего, путем стимуляции, в частности, Т-клеточного иммунного ответа против первой группы эпитопов, содержащихся в полипептиде(ах), переносимых вводимой(ыми) векторной(ыми) молекулой(ами) согласно определению в настоящей заявке. Применение переносимого(ых) вектором полипептида(ов) или композиции согласно настоящему изобретению направлено на улучшение клинического(их) состояния(ий) у нуждающегося в этом хозяина-млекопитающего, у которого диагностирована инфекция патогена, или страдающего от патологического состояния, такого как опухоль, или направлено на элиминацию причинного фактора или организма-возбудителя заболевания, или на подавление указанного фактора или организма. В случае инфекции патогеном иммунотерапевтическое лечение приводит к значительному снижению патогенной нагрузки в области инфекции или в области репликации указанного патогена, в частности, в плазме или слизистых оболочках хозяина, и может приводить к уровню патогенной нагрузки, например, нагрузки в плазме, ниже детектируемого при измерении, либо к уменьшению размера или развития опухоли, в случае ее наличия.

Выражение «иммунопрофилактика» или «профилактика» относится к ответу, предотвращающему или защищающему от воздействия, инфекции, наступления или развития второго(ых) определенного(ых) патологического(их) состояния(ий), или заболевания, или его клинических последствий у того же хозяина-млекопитающего путем стимуляции, в частности, иммунного ответа Т-клеток памяти против второй группы эпитопов, содержащихся в полипептиде(ах), переносимом(ых) вводимой(ыми) векторной(ыми) молекулой(ами) согласно определению в настоящей заявке. Применение переносимого(ых) вектором полипептида(ов) или композиции, описанные в настоящей заявке, приводит к профилактическому иммунному ответу против будущей инфекции, будущих злокачественных процессов или заболеваний, и, соответственно, предотвращает наступление патологического состояния у указанного хозяина-млекопитающего.

Эффективность ответа в случае профилактики можно проанализировать посредством отслеживания маркера патологического состояния. Согласно одному варианту реализации критерии эффективности выбирают так, чтобы добиться статистической значимости.

Выражение «предотвращение повторного возникновения» относится к достижению иммунного ответа для предотвращения нового будущего воздействия, новой будущей инфекции, нового будущего наступления или нового будущего развития первого(ых) определенного(ых) патологического(их) состояния(ий), состояний, ранее диагностированных и подвергавшихся лечению после введения переносимого(ых) вектором полипептида(ов) или композиции согласно определению в настоящей заявке.

Выражение «хозяин-млекопитающее» охватывает всех млекопитающих, в частности, приматов и людей (например, пациента).

Необходимо понимать, что после введения(ий) переносимого(ых) вектором полипептида(ов) или композиции, описанных в настоящей заявке, и Т-клеточный иммунный ответ против первой группы эпитопов, и иммунный ответ Т-клеток памяти против второй группы эпитопов, и, возможно, ответ против указанной первой группы эпитопов, индуцируются у одного и того же хозяина-млекопитающего, в течение определенного периода времени. Соответственно, указанное по меньшей мере одно введение переносимого(ых) вектором полипептида(ов) или композиции, описанных в настоящей заявке, приводит к индуцированию Т-клеточного иммунного ответа против первой группы эпитопов и иммунного ответа Т-клеток памяти против второй группы эпитопов и, возможно, иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, которые возможно обнаружить и/или измерить в течение периода начиная от 1 месяца после введения до 12 месяцев после введения (в частности, через 2, 3, 6, 9 или 12 месяцев), хотя Т-клетки, вовлеченные в один из указанных вариантов или в оба указанных варианта иммунного ответа, могут все еще обнаруживаться через несколько лет после введения. Выражение «по меньшей мере одно введение» или «однократное введение» означает, что переносимый(ые) вектором полипептид(ы) или композиции, описанные в настоящей заявке, вводят хозяину-млекопитающему, в частности, пациенту, один или более раз, предпочтительно однократно или двукратно. При каждом введении вводится по меньшей мере один переносимый вектором полипептид, при условии, что первую группу эпитопов и вторую группу эпитопов, содержащихся в по меньшей мере одном полипептиде, переносимом по меньшей мере одной векторной молекулой, с по меньшей мере одним эпитопом из указанной второй группы эпитопов, вводят хозяину-млекопитающему одновременно. При необходимости, второе и возможное(ые) последующее(ие) введение(ия) (прайм-буст) проводят с применением того(тех) же переносимого(ых) вектором полипептида(ов) или с применением той же композиции, соответствующей указанному(ым) полипептиду(ам), что и при первом введении. Описанные ниже в настоящей заявке эксперименты показали, что иммунотерапевтическое лечение и профилактика, и, возможно, предотвращение повторного возникновения, могут быть достигнуты после однократного введения переносимого(ых) вектором полипептида(ов) или композиции согласно определению в настоящей заявке. Согласно одному варианту реализации настоящее изобретение относится к переносимому(ым) вектором полипептиду(ам) или композиции, описанные в настоящей заявке, для применения (i) в иммунотерапевтическом лечении первого(ых) патологического(их) состояния(ий), следующего(их) за патогенной инфекцией, в частности, следующего(их) за бактериальной или вирусной инфекцией, диагностированного(ых) у хозяина-млекопитающего, и (ii) в профилактике второго(ых) патологического(их) состояния(ий), являющегося(ихся) последствием инфекции другим патогеном, в частности, следующего(их) за инфекцией другими бактериями или другим вирусом (либо другим его/их штаммом) и (iii) возможно при предотвращении повторного возникновения указанного(ых) первого(ых) патологического(их) состояния(ий), отличающегося тем, что профилактика указанного(ых) второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в том случае, если вторая группа эпитопов, вязанная с указанным другим патогеном (например, другими бактериями или другим вирусом) не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах). Согласно конкретному случаю патологического(их) состояния(ий), следующего(их) за другими вирусными штаммами, в частности, другими штаммами ВПЧ или видами других типов ВПЧ, настоящее изобретение относится к переносимому(ым) вектором полипептиду(ам) или композиции, описанные в настоящей заявке, для применения (i) в иммунотерапевтическом лечении первого(ых) патологического(их) состояния(ий), являющегося(ихся) последствием инфекции первым вирусом, первым штаммом ВПЧ или штаммами первого типа ВПЧ, диагностированного(ых) у хозяина-млекопитающего, и (ii) в профилактике второго(ых) патологического(их) состояния(ий), являющегося(ихся) последствием инфекции другим вторым вирусом, другим вторым штаммом ВПЧ или штаммом другого второго типа ВПЧ, и (iii) возможно для предотвращения повторного возникновения указанного(ых) первого(ых) патологического(их) состояния(ий), причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда вторая группа эпитопов, связанных с указанным другим вторым вирусом, другим вторым штаммом ВПЧ или штаммом другого второго типа ВПЧ, не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах). Согласно предпочтительному варианту реализации настоящее изобретение относится к переносимому(ым) вектором полипептиду(ам) или композиции согласно определению в настоящей заявке, содержащей полипептид, полученный из белка Е7 ВПЧ16, и полипептид, полученный из белка Е7 ВПЧ18, для применения либо: (1) (i) в иммунотерапевтическом лечении первого(ых) патологического(их) состояния(ий), являющегося(ихся) последствием инфекции ВПЧ16, диагностированного у хозяина-млекопитающего, и (ii) в профилактике второго(ых) патологического(их) состояния(ий), вляющегося(ихся) последствием инфекции ВПЧ18, и (iii) возможно для предотвращения повторного возникновения указанного(ых) первого(ых) патологического(их) состояния(ий), причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда полипептид, происходящий из белка Е7 ВПЧ18, не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах); или (2) (i) в иммунотерапевтическом лечении первого(ых) патологического(их) состояния(ий), являющегося(ихся) последствием инфекции ВПЧ18, диагностированного(ых) у хозяина-млекопитающего, и (ii) в профилактике второго(ых) патологического(их) состояния(ий), являющегося(ихся) последствием инфекции ВПЧ16 и (iii) возможно для предотвращения повторного возникновения указанного(ых) первого(ых) патологического(их) состояния(ий), причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда полипептид, происходящий из белка Е7 ВПЧ16, не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах).

Согласно одному варианту реализации настоящее изобретение относится к переносимому(ым) вектором полипептиду(ам) или композиции, описанным в настоящей заявке, для применения (i) в иммунотерапевтическом лечении первого(ых) патологического(их) состояния(ий), являющегося(ихся) последствием первых опухолевых клеток, диагностированных у хозяина-млекопитающего, и (ii) в профилактике второго(ых) патологического(их) состояния(ий), следующего(их) являющегося(ихся) последствием вторых опухолевых клеток, происхождение и/или гистология которых отличны от первых опухолевых клеток, и (iii) возможно для предотвращения повторного возникновения указанного(ых) первого(ых) патологического(их) состояния(ий), причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда вторая группа эпитопов, связанная с указанными вторыми опухолевыми клетками, не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах).

Согласно одному варианту реализации настоящее изобретение относится к переносимому(ым) вектором полипептиду(ам) или композиции, описанным в настоящей заявке, для применения (i) в иммунотерапевтическом лечении первого(ых) патологического(их) состояния(ий), являющегося(ихся) последствием патогенной инфекции, в частности, являющегося(ихся) последствием бактериальной или вирусной инфекции, диагностированного(ых) у хозяина-млекопитающего, и (ii) в профилактике второго(ых) патологического(их) состояния(ий), являющегося(ихся) последствием развития опухолевых клеток, и (iii) возможно для предотвращения повторного возникновения указанного(ых) первого(ых) патологического(их) состояния(ий), причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда вторая группа эпитопов, связанная с указанными опухолевыми клетками, не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах). Согласно одному варианту реализации настоящее изобретение относится к переносимому(ым) вектором полипептиду(ам) или композиции, описанным в настоящей заявке, для применения (i) в иммунотерапевтическом лечении первого(ых) патологического(их) состояния(ий), являющегося(ихся) последствием развития опухолевых клеток, диагностированного(ых) у хозяина-млекопитающего, и (ii) в профилактике второго(ых) патологического(их) состояния(ий), являющегося(ихся) последствием патогенной инфекцией, в частности, являющегося(ихся) последствием а бактериальной или вирусной инфекцией, и (iii) возможно для предотвращения повторного возникновения указанного(ых) первого(ых) патологического(их) состояния(ий), причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда вторая группа эпитопов, связанная с указанным другим патогеном (например, другими бактериями или другим вирусом) не содержится в указанном(ых) введенном(ых) переносимом(ых) вектором полипептиде(ах).

Настоящее изобретение также относится к способу достижения у одного хозяина-млекопитающего и (i) иммунотерапевтического лечения первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у указанного хозяина-млекопитающего, главным образом путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, и (ii) профилактики второго(ых) определенного(ых) патологического(их) состояния(ий), главным образом путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в указанных введенных переносимого(ых) вектором полипептида(ов); указанный способ включает введение, по меньшей мере однократное, указанному хозяину-млекопитающему, либо:

(1) переносимого(ых) вектором полипептида(ов), отличающего(их)ся тем, что указанный несущий полипептид(ы) вектор состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, при этом указанные первая группа эпитопов и вторая группа эпитопов заключены по меньшей мере в одном полипептиде, переносимом указанным вектором, и по меньшей мере один эпитоп указанной второй группы эпитопов отличается от эпитопов первой группы эпитопов;

(2) композиции, содержащей переносимый(ые) вектором полипептид(ы) согласно (1) в комбинации с фармацевтически приемлемой основой; либо

(3) композиции, содержащей (а) первый(ые) переносимый(ые) вектором полипептид(ы), отличающаяся тем, что указанный первый вектор, несущий полипептид(ы), состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, при этом указанная первая группа эпитопов заключена по меньшей мере в одном полипептиде, переносимом указанным первым вектором, и (b) второй(ые) отдельный(ые) переносимый(ые) вектором полипептид(ы), отличающий(ие)ся тем, что молекула указанного второго вектора, несущего полипептид(ы), состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, при этом указаная вторая группа эпитопов заключена по меньшей мере в одном полипептиде, переносимом указанным вторым вектором.

Согласно одному варианту реализации настоящее изобретение также относится к способу достижения у одного и того же хозяина-млекопитающего (i) иммунотерапевтического лечения первого(ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у хозяина-млекопитающего, главным образом путем стимуляции Т-клеточного иммунного ответа против первой группы эпитопов, (ii) профилактики второго(ых) определенного(ых) патологического(их) состояния(ий), главным образом путем стимуляции иммунного ответа Т-клеток памяти против второй группы эпитопов, и (iii) возможного предотвращения повторного возникновения указанного(ых) первого(ых) определенного(ых) патологического(их) состояния(ий), главным образом путем стимуляции иммунного ответа Т-клеток памяти против указанной первой группы эпитопов, причем указанная профилактика второго(ых) определенного(ых) патологического(их) состояния(ий) не наблюдается в тех случаях, когда указанная вторая группа эпитопов не содержится в указанного(ых) введенного(ых) переносимого(ых) вектором полипептида(ов), причем указанный способ включает по меньшей мере однократное введение указанному пациенту либо:

(1) переносимого(ых) вектором полипептида(ов), отличающего(их)ся тем, что указанный несущий полипептид(ы) вектор состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, указанная первая группа эпитопов и вторая группа эпитопов содержатся по меньшей мере в одном полипептиде, переносимом указанным вектором, и по меньшей мере один эпитоп указанной второй группы эпитопов отличается от эпитопов первой группы эпитопов;

(2) композиции, содержащей переносимый(ые) вектором полипептид(ы) согласно (1) в комбинации с фармацевтически приемлемой основой; либо

(3) композиции, содержащей (а) первый(ые) переносимый(ые) вектором полипептид(ы), отличающий(ие)ся тем, что первый вектор, несущий полипептид(ы), состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, при этом указанная первая группа эпитопов заключена по меньшей мере в одном полипептиде, переносимом указанным первым вектором, и (b) второй(ые) отдельный(ые) переносимый(ые) вектором полипептид(ы), отличающий(ие)ся тем, что молекула указанного второго вектора, несущего полипептид(ы), состоит из белка СуаА или его фрагмента, пригодного для презентирования указанного(ых) полипептида(ов) иммунной системе хозяина-млекопитающего, при этом указанная вторая группа эпитопов содержится по меньшей мере в одном полипептиде, переносимом указанным вторым вектором.

Композиции, определенные в настоящей заявке, могут, в одном варианте реализации, содержать фармацевтически приемлемую основу или состав, или физиологически приемлемый разбавитель, который выбирают из буферных агентов, солевого раствора, фосфатно-буферного солевого раствора, декстрозы, глицерина, воды, этанола и т.п., и их комбинаций.

Кроме того, переносимый(ые) вектором полипептид(ы) или композиция, определенные в настоящей заявке, как средства обеспечения иммунотерапевтического лечения и профилактики, могут быть скомбинированы или смешаны с по меньшей мере одним иммуностимулятором, либо композиция, определенная в настоящей заявке, как средство достижения иммунотерапевтического лечения и профилактики, может также содержать по меньшей мере один иммуностимулятор, например, по меньшей мере один адъювант, предпочтительно один адьювант, и/или сурфактант и/или иммуномодулирующие вещества (такие как цитокины или хемокины).

В данной области техники известны различные адъюванты, и они включают полный адъювант Фрейнда (CFA), неполный адъювант Фрейнда (IFA), монтанид ИЗА (неполный адъювант Seppic), мурамилпептиды, такие как мурамилдипептид (MDP) MDP-Lys (L18) (Nа-ацетилмурамил-L-аланил-D-изоглутаминил-Nестеароил-L-лизин), сульфат цинка, коллоидный гидроксид железа, фосфат кальция или хлорид кальция; CpG-олигодезоксинуклеотиды (CPG ODN), такие как CPG ODN 1826 и CPG ODN 2007; MF59, который представляет собой стабизированную детергентом эмульсию типа масло-в воде, содержащую 5% сквалена (масса/объем), 0,5% Tween® 80 (масса/объем) и 0,5% Span (масса/объем) в воде, лиганды TLR4 (такие как MPL, GLA), лиганды TLR3 (такие как Hiltonol®), полисахариды (такие как инулин) и липосомы (такие как катионные липосомы, ISCOM).

Согласно одному варианту реализации указанный по меньшей мере один адъювант выбирают из молекул, обладающих способностью активировать Т-клеточный иммунный ответ, в частности, ответ Т-клеток памяти. Предпочтительные адъюванты связываются с TLR или представляют собой агонисты TLR (Toll-подобных рецепторов) 3, 4, 7, 8 и/или 9 в иммунных клетках (такие как АПК). Согласно одному варианту реализации адъювант представляет собой лиганд TLR, в частности, лиганд TLR, выбранный из группы, состоящей из лигандов TLR класса 3, таких как поли-ICLC, лигандов TLR класса 4, лигандов TLR класса 9, таких как CpG, и лигандов TLR класса 7/8, таких как имиквимод. Примерами адъювантов являются имиквимод, продаваемый в виде крема, содержащего 5% имиквимода (Aldara), и поли-ICLC, продаваемый корпорацией Oncovir (Вашингтон, США) под названием Hiltonol®.

«Комбинированный» означает, что контакт с хозяином как переносимого(ых) вектором полипептида(ов) или композиции согласно определению в настоящей заявке, так и иммуностимулятора осуществляют в разное время, либо с применением разных способов введения, предпочтительно на одном и том же участке. Согласно одному варианту реализации переносимый(ые) вектором полипептид(ы) или композицию, описанные в настоящей заявке инъецируют хозяину, а иммуностимулятор (например, адъювант) вводят указанному хозяину местно, например, на кожу. Например, переносимый(ые) вектором полипептид(ы) или композицию согласно определению в настоящей заявке инъецируют хозяину, а иммуностимулятор (например, адъювант) наносят на кожу хозяина после инъекции, на участке инъекции. В отличие от этого, «смешанный» означает, что переносимый(ые) вектором полипептид(ы) или композиция согласно определению в настоящей заявке и иммуностимулятор входят в один состав для введения.

Следует отметить, что в соответствии с настоящей заявкой при смешивании или комбинировании иммуностимулятора (например, адъюванта) с переносимым(и) вектором полипептидом(ами) или композицией, определенными в настоящей заявке, указанный иммуностимулятор используют по меньшей мере каждый раз при введении указанного(ых, ой) переносимого(ых) вектором полипептида(ов) или композиции согласно настоящему изобретению хозяину. Согласно одному варианту реализации переносимый(ые) вектором полипептид(ы) или композицию согласно настоящему изобретению вводят дважды, а иммуностимулятор применяют (либо смешивая, либо комбинируя, предпочтительно накожно) на участке введения переносимого(ых) вектором полипептида(ов) или композиции согласно настоящему изобретению в день каждого введения. Согласно другому одному варианту реализации переносимый(ые) вектором полипептид(ы) или композицию согласно настоящему изобретению вводят дважды, а иммуностимулятор применяют (либо смешивая, либо комбинируя, предпочтительно накожно) на участке введения переносимого(ых) вектором полипептида(ов) или композиции согласно настоящему изобретению, в день каждого введения и на следующий день после каждого введения. Согласно одному варианту реализации переносимый(ые) вектором полипептид(ы) или композицию согласно настоящему изобретению вводят дважды, а адъювант (предпочтительно Имиквимод, например, Aldaraтм) применяют накожно на участке введения переносимого(ых) вектором полипептида(ов) или композиции согласно настоящему изобретению, в день каждого введения и на следующий день после каждого введения.

Переносимый(ые) вектором полипептид(ы) согласно определению в настоящей заявке или композиция согласно определению в настоящей заявке, как средства достижения иммунотерапевтического лечения и профилактики, и, возможно, предотвращения повторного возникновения, могут дополнительно быть скомбинированы или смешаны согласно схемам ввзанного(ых) с другими активными соединениями, подходящими для лечения патогенной инфекции, опухолевых клеток или патологического(их) состояния(ий), связанного(ой, ых) с указанной инфекцией или опухолью, такими как противоопухолевые или противовирусные активные соединения.

Переносимый(ые) вектором полипептид(ы) или композиции, описанные в настоящей заявке, могут быть введены пациенту различными путями: с помощью подкожной (п/к), внутрикожной (в/к), внутримышечной (в/м) или внутривенной (в/в) инъекции, перорально и мукозально, в частности, интраназально или путем ингаляции. Согласно одному варианту реализации переносимый(ые) вектором полипептид(ы) или композиции, описанные в настоящей заявке, вводят внутрикожно.

Согласно одному варианту реализации переносимый(ые) вектором полипептид(ы) или композиции согласно определению в настоящей заявке, либо смешанные или скомбинированные с по меньшей мере одним иммуностимулятором, либо нет, независимо от способа введения вводят на участке, независимом от (первого/ых) определенного(ых) патологического(их) состояния(ий), диагностированного(ых) у млекопитающего-хозяиня, т.е. в случае опухоли - на участке, отличном от участка развития опухоли (например, не на участке слизистой оболочки), а в случае патогена - на участке, отличном от участка репликации указанного патогена.

Переносимый(ые) вектором полипептид(ы) или композиции, описанные в настоящей заявке, могут быть представлены твердой формой (крахмальные капсулы, порошок, капсулы с твердой оболочкой, пилюли, суппозитории, таблетки для быстрого высвобождения, гастрорезистентные таблетки с отсроченным высвобождением таблетки с отсроченным высвобождением), порошкообразной формой, предпочтительно после лиофилизации (лиофилизированная форма или лиофилизированная порошкообразная форма), которую необходимо восстанавливать, например, разбавителем(ями), перед инъекцией; или жидкой формой, такой как раствор для инъекций или суспензия для инъекций. Количество вводимого(ых) переносимого(ых) вектором полипептида(ов) (дозировка) зависит от субъекта, лечение которого проводят, в том числе от оценки состояния пациента, состояния иммунной системы индивидуума, способа введения и размеров хозяина. Стандартные дозировки варьируют от 1 до 1200 мкг, 100-1000 мкг, 200-1000 мкг, 500-1000 мкг. Конкретную дозировку выбирают из группы, состоящей из 100, 200, 300, 400, 500, 600, 700, 800, 900 и 1000 мкг. Согласно другому варианту реализации стандартные дозировки варьируют от 1 до 100 пг, от 1 до 50 г, и от 1 до 10 г переносимого(ых) вектором полипептида(ов). Указанные примеры могут быть модифицированы специалистом в даной области техники в зависимости от обстоятельств.

Каждый конкретный вариант реализации может быть скомбинирован с любым другим частным вариантом реализации.

ПРИМЕРЫ

А. МАТЕРИАЛЫ И МЕТОДЫ

Мыши

Самок мышей C57BL/6 возрастом шесть недель (Н-2b) приобретали в Charles River Laboratories. Мышей содержали в беспатогенных условиях со свободным доступом к воде и пище. Процедуры с участием животных и уход за ними осуществляли в соответствии с правилами Genticel, согласующимися с национальным и международным законодательством и принципами и проверенными местным комитетом по этике.

Линии опухолевых клеток

Опухолевые клетки ТС-1 (тканевая культура №1) (Lin, Guarnieri et al. 1996) готовили посредством трансформации первичных клеток легких мышей C57BL/6 онкогенами ВПЧ16 Е6 и Е7 и активированным онкогеном человека c-Ha-Ras. Клетки, использованные для этого исследования, были получены из АТСС. Клетки ТС1 размораживают перед каждым экспериментом, затем культивируют и размножают in vitro на протяжении по меньшей мере 10 дней до инъекции.

EG7, линию OVA-трансфицированных клеток лимфомы мыши EL4 (генетический фон -C57BL/6), применяют для индукции солидной опухоли, экспрессирующей белок овальбумин. Указанная модель хорошо описана и применяется в качестве мышиной модели раковой опухоли (Schreiber, Deyev et al. 2009). Клетки EG7 размораживают перед каждым экспериментом, затем культивируют и размножают in vitro на протяжении по меньшей мере 10 дней до инъекции.

Инокулирование опухолевых клеток

В день 0 мышам C57BL/6 инъецировали клетки ТС-1 (0,5×106 клеток на мышь в случае HPV_TUR008, 1×109 клеток на мышь в других исследованиях), разведенные в 100 мкл ФСБ 1X, в бок, подкожно. В некоторых экспериментах клетки EG7, разведенные в100 мкл ФСБ 1X инъецировали мышам подкожно в бок в день 60.

Получение векторов

- Конструирование и очистка рекомбинантных CyaA-HPV16E7Δ30-42 (C1 6-1) и CyaA-HPVl8Е7Δ30-42 (C1 8-1) (Фиг. 3А и 3В) уже описаны в EP1 576967В1. Два готовых объема CyaA-HPV16Ε7Δ30-42 (C1 6-1) и СуаА- Η ΡV18Ε7Δ30-42 (C1 8-1) смешивали в Genticel в соотношении 1:1 для получения ProCervix, которую затем хранили в аликвотах при -80°C.

- В CyaA-CysOVA свтроен OVA257-264 (SIINFEKL) Н-2b-рестриктированный эпитоп белка овальбумина (OVA). Его код - ВTpr_103, партия HPV043_Cova_ РВ_8М, очищен в Genticel. Указанная партия CyaA-CysOVA характеризуется иммуногенностью у мышей по данным Genticel (собственные результаты) (Фиг. 4).

- Вектор CyaA-MAGEA397-178/190-295 (Фиг. 4С и SEQ ID NO: 7) включает два полипептида:

(1) Эпитоп MAGE А397-178, встроенный между остатками 319 и 320 СуаА В. pertussis: LGDNQMPKAGLLIlVLAIIAbŒGDCAPEEKIPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISG (SEQ ID NO: 8); и

(2) Эпитоп MAGE-А3190-295*, соответствующий остаткам 190-221, присоединенным к остаткам 242-295 последовательности MAGE A3, встроенной между остатками 224 и 235 СуаА: TFPDLESEFQAAIJSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGI ELMEVDPIGHLYTP (SEQ ID NO:9).

Введение вакцины

На 11 день после измерения опухолей мышей с определяющимися солидными опухолями вакцинируют посредством внутрикожной (в/к) инъекции в дерму ушей (инъекции делают в оба уха). В некоторых экспериментах мышам проводят двухступенчатую вакцинацию на 11 день и 39 день после инокулирования опухолевых клеток ТС-1. Что касается ProCervix, мышам вводили 5 мкг СуаА-НРУ16Е7Δ30-42 и 5 мкг СуаА-НРУ18Е7Δ30-42.

Молекулы адъюванта

Aldaraтм представляет собой лекарственную форму молекулы, активирующей врожденный иммунитет путем предпочтительного связывания TLR7 в иммунных клетках, например, АПК. Указанная активная молекула представляет собой имиквимод, небольшое синтетическое соединение. Aldara продается в виде крема, содержащего 5% имиквимода, в одноразовых пакетиках по 250 мг (12,5 мг активного имиквимода). Доза, индуцирующая эффект адъюванта при вакцинации мышей ProCervix, составляет 25 мг Aldaraтм на область иммунизации, и, соответственно, 1,25 мг активного имиквимода на область инъекции (50 мг на одну мышь). Местное (накожное) нанесение Aldaraтм осуществляют в день иммунизациии и спустя 24 ч после иммунизации. Подготавливают индивидуальные пробирки, каждая из которых содержит по 25 мг Aldaraтм для нанесения на кожу уха (по 2 пробирки на мышь). Для того, чтобы точно оценить реальное количество крема Aldaraтм, на участок инъекции ProCervix (соответствующий каждому уху отдельных мышей); каждую пробирку Эппендорф взвешивают до и после закладывания крема. После нанесения крема Aldara на кожу ушей повторно измеряют массу пробирок Эппендорф для расчета приблизительного количества крема, втертого в кожу. Весь содержащийся в каждой пробирке крем втирают на протяжении по меньшей мере 15 секунд, до завершения впитывания в кожу.

Poli-ICLC (агонист TLR3) был предоставлен компанией Oncovir (Inc, Вашингтон, США) во флаконах, содержащих по 1 мл опалесцентного стерильного раствора 2 мг/мл. Poli-ICLC оставляют в исходном резервуаре и хранят при +4°C. Poli-ICLC для инъекции содержит 2 мг/мл поли-IС, стабилизированного 1,5 мг/мл поли-L-лизина и 5 мг/мл карбоксиметилцеллюлозы натрия в 0,9% растворе хлорида натрия, доведенного до рН 7,6-7,8 с применением гидроксида натрия.

Измерение опухолей

При оценке развития опухолей у мышей учитывают различные параметры:

- Размер опухолей: Опухоли измеряют вручную с применением калипера дважды в неделю, начиная через 5 дней после инокулирования опухолевых клеток и до 60 дня. Затем рассчитывают объем опухоли следующим образом: объем = (длина × ширина2)/2;

- Выживаемость мышей: по этическим причинам умерщвляют мышей, у которых развиваются аномально большие (предельный размер: 2000 мм3) и/или некротические опухоли, либо вызванное опухолью нарушение подвижности; и

- Число не имеющих опухолей мышей: Данная информация указывает на индуцированную терапевтической вакцинацией полную регрессию опухоли (отсутствие пальпируемой опухоли).

Оценка цитотоксических ответов CD8 Т-клеток памяти

Способ измерения цитотоксичности CD8+ Т-клеток in vivo был подробно описан (Barchet, Oehen et al. 2000; Ingulli 2007). Вкратце, сингенные спленоциты интактных мышей метят разными концентрациями CFSE (сукцинимидилэфира карбоксифлуоресцеина, Molecular Probes Invitrogen) и либо сенсибилизируют in vitro соответствующими Н-2b-рестриктированными пептидами, либо оставляют несенсибилизированными. Популяции и сенсибилизированных пептидами и несенсибилизированных клеток-мишеней адоптивно переносили внутривенно сингенным вакцинированным хозяевам и измеряли уменьшение сенсибилизированных пептидами мишеней в селезенке методом проточной цитометрии (BD FACSCalibur). Процент киллинга оценивают, исходя из снижения соотношения процента сенсибилизированных клеток-мишеней и несенсибилизированных клеток, скорректированного по исходному соотношению (см. ниже). Подготовленные клетки анализируют проточной цитометрией до инъекции для проверки мечения CFSE разных клеток-мишеней и получения исходных значений (реального процента каждой популяции клеток) для расчета киллинга in vivo. Три популяции клеток-мишеней затем инъецируют внутривенно каждой из вакцинированных мышей в соотношении 1:1:1. Процент in vivo киллинга рассчитывают согласно имеющимся описаниям по следующей формуле (Barber, Wherry et al. 2003)

ELISpot-анализ (твердофазный иммуноферментный спот-анализ) интерферона - гамма (IFN-γ)

Частоты продуцирующих IFN-γ HPV16 Е749-57 и HPV18 E7AS43-49-специфичных CD8+ Т-клеток определяют на ex-vivo рестимулированных спленоцитах с использованием анализа ELISpot на IFN-γ:

- ELISpot проводят на отдельных мышах, не на объединенном пуле селезенок.

- Накануне мыши получали внутривенную инфузию сингенных CFSE-нагруженных целевых спленоцитов (в ходе in vivo киллинг-анализа, см. выше).

Вкратце, все спленоциты, полученные от вакцинированных мышей оставляют без стимуляции либо повторно стимулируют в течение 20 ч при 37°C, 5% СО2 с использованием 1 мкг/мл каждого пептида согласно приведенному ниже описанию:

- 1×106 клеток на лунку с пептидом HPV16 Е749-57 (Н-2b-рестриктированный релевантный эпитоп)

- 1×106 клеток на лунку с OVA257-264 (Н-2b-рестриктированный нерелевантный эпитоп).

- 0,25×106 клеток на лунку с HPV18E7AS43-49 (Н-2b-рестриктированный релевантный эпитоп).

Секрецию IFΝ-γ отслеживали сэндвич-анализом ELISpot, проявляемым BCIP/NBT с применением стрептавидина-АКФ. Данные анализировали на Bioreader 5000-Pro S (Biosys).

Терапевтические/профилактические вакцинации

Терапевтическая схема, подробно описанная ниже, обобщена на Фиг. 8.

На нулевой день двум группам мышей (группы 1 и 2) в правый бок инокулировали клетки ТС-1 (1×106 клеток на мышь). Затем мыши получали две вакцинации, первую на 11 день и вторую на 39 день, с использованием плацебо (ФСБ 1X+мочевина) (группа 1) или плацебо+Aldaraтм (группа 2). Группы 1 и 2 представляли собой отрицательный контроль.

На нулевой день четырем группам мышей (группы 3-6) инокулировали в правый бок клетки ТС-1 (1×106 клеток на мышь)(группы 3-6); затем мыши получали две вакцинации, первую на 11 день и вторую на 39 день, векторами СуаА- MAGEA397-178/190-295/CyaA-HPV16 Е7 (5 мкг каждого вектора на основе СуаА) в присутствии Aldaraтм (группа 3), векторами CyaA-cysOVA/CyaA-HPV16 Е7 (5 мкг каждого вектора на основе СуаА) в присутствии Aldaraтм (группа 4) или ProCervix с адъювантом Aldaraтм (группы 5 и 6, в качестве положительного контроля элиминации опухоли ТС-1). За правым боком указанных мышей наблюдали до дня 100 (Фиг. 9). В день бОвыжившим мышам инокулировали вторую линию опухолевых клеток, либо В16-опухолевые клетки, экспрессирующие белок MAGE A3 (группы 3 и 5), либо опухолевые клетки EG7 (злокачественные сингенные клетки, экспрессирующие белок овальбумин) (группы 4 и 6). За левым боком указанных мышей наблюдали до дня 100.

В случае применения Aldara его наносят местно (накожно) на участок вакцинации в день вакцинации и на следующий день после вакцинации (т.е. в дни 12 и 40).

В. РЕЗУЛЬТАТЫ

У мышей с HPV16 Е7-экспрессирующими солидными опухолями, вакцинированных ProCervix, наблюдается высокий уровень регрессии опухолей и повышение выживаемости

У мышей, вакцинированных ФСБ на 11 день с нанесением Aldaraтм, не наблюдалось подавления роста опухоли, за исключением 2-х мышей из 10, у которых опухоль полностью элиминировалась до 50 дня (Фиг. 5А и 6А). 4 мыши указанной группы были живы на день 50 (Фиг. 6В; окончание мониторинга размеров опухоли). Группу, получавшую только ФСБ, не включали в это исследование, и, соответственно, сложно точно оценить влияние Aldaraтм по сравнению с естественным противоопухолевым ответом у мышей. Как бы то ни было, очевидно, что эффект, наблюдаемый при применении только Aldaraтм, значительно слабее наблюдаемого при применении ProCervix с адъювантом Aldaraтм (см. далее). Это указывает на то, что даже в том случае, если Aldaraтм может оказывать некоторое неспецифическое влияние на прогрессирование опухоли, возможно, за счет активации врожденного иммунитета и сопутствующих воспалительных процессов (провоспалительные цитокины и т.д. (Schon и Schon 2008)), он не обладает достаточной эффективностью для самостоятельного применения в указанной терапевтической схеме для лечения солидных ВПЧ-индуцированных опухолей.

У мышей, вакцинированных на 11 день ProCervix без адъюванта, также наблюдалось значительное разрастание опухолей, и в день 50 не имеющие опухолей мыши отсутствовали (Фиг. 5В и 6А). Только две мыши указанной группы были живы в день 50 (Фиг. 6В). Терапевтическая вакцинация ProCervix с адъювантом-имиквимодом для местного применения (Aldaraтм) индуцировала значительную регрессию опухоли (Фиг. 5D), что приводило к высоким уровням выживаемости (Фиг. 6В) и отсутствию опухолей у большинства мышей к концу исследования (Фиг. 6А). В получавшей ProCervix с адъювантом Aldara группе наблюдалась устойчивость опухолей после периода видимого контроля (размер уменьшался до менее чем 50 мм3) у 3 мышей из 10. Устойчивость формировалась между 30 и 40 днями, со значительным ростом до дня 50. Указанное явление может возникать за счет механизмов ускользания, реализуемых опухолями, и в этом случае оно должно быть учтено для коррекции терапевтической схемы, однако более вероятно, что это происходит из-за утраты молекул МНС-класса I на поверхности опухолевых клеток, которая была ранее описано для клеток ТС-1 (Zwaveling, Ferreira Mota et al. 2002). Терапевтическая вакцинация веществом ProCervix с поли-ICLC в качестве адъюванта давала сопоставимые результаты в отношении регрессии опухоли и уровня выживаемости (Фиг. 5С и 6). Эти результаты указывают на то, что терапевтическая вакцинация мышей с HPV16 Е7 - экспрессирующими солидными опухолями веществом ProCervix либо с адъювантом поли-ICLC, либо с имиквимодом для местного применения (Aldaraтм) приводит к выраженному терапевтическому эффекту.

Терапевтическая вакцинация ProCervix способствует развитию как HPV16 Е7-, так и HVP18 El-специфичных функциональных цитотоксических лимфоцитов (CTL) памяти

Rafu Ahmed с коллегами описали на примере мышиной модели острой вирусной инфекции вируса ЛХМ способность CD8+ Т-клеток памяти демонстрировать быстрый логический потенциал in vivo (Barber, Wherry et al. 2003). Основываясь на указанных наблюдениях, авторы решили выяснить, обнаруживаются ли у мышей, у которых произошло полное исчезновение ТС-1 - индуцированных солидных опухолей после введения ProCervix в день 11, функциональные антиген-специфичные CD8+ Т-клетки памяти после эрадикации опухолей.

Для этого в день 60 после инокулирования клеток ТС-1, оставшимся не имеющим опухолей мышам каждой группы адоптивно переносили нагруженные CFSE сингенные спленоциты для параллельного измерения цитотоксичности in vivo (как описано выше в разделе «Материалы и методы») CD8+ Т-клеток памяти в отношении двух следующих Н-2b рестриктированных эпитопов: HPV16 Е749-57 и HPV18 E7AS43-49. Из групп мышей, вакцинированных ProCervix либо с адъювантом Aldaraтм, либо с адъювантом Poli-ICLC, брали по 5 не имеющих опухолей мышей (произвольно выбранных в группе) для проведения анализа киллинга in vivo. У всех задействованных в исследовании мышей, у которых произошла полная эрадикация опухоли, обнаружена сильная цитотоксичность в отношении HPV16 Е749-57- сенсибилизированных клеток-мишеней (Фиг. 7). Различий между группами не наблюдалось. НРУ16Е7-специфичный цитотоксичный ответ в группе, вакцинированной плацебо с Aldara, оценивали путем применения указанного теста у двух не имеющих опухолей мышей (все остальные мыши в день 60 были мертвы из-за разрастания опухоли). Эти данные указывают на то, что указанные две мыши обладали способностью к развитию HPV16 Е7-специфичного иммунного ответа, достаточно мощного для устранения индуцированных ТС-1 солидных опухолей. Интересно, что только у мышей, вакцинированных ProCervix с адъювантом, также обнаружены HPV18E7-сенсибилизированные клетки-мишени. Эти данные более информативны: поскольку клетки ТС-1 не экспрессируют антигены ВПЧ18, они, соответственно, указывают на то, что отмеченная ВПЧ18-специфическая цитотоксичность имела место исключительно благодаря индуцированным вакциной Т-клеткам памяти. Фактически, никакой цитотоксичности in vivo в отношении НРУ18Е7-сенсибилизированных клеток-мишеней у получавших только Aldaraтм мышей не наблюдалось (Фиг. 7).

В совокупности полученные авторами данные демонстрируют выдающуюся эффективность ProCervix в стимулировании путем единственной инъекции функционального СБ8-зависимого ответа памяти против антигенов Е7 как ВПЧ 16, так и ВПЧ18. Однократная вакцинация ProCervix способна индуцировать дифференцировку пула антиген-специфичных CD8+ Т-лимфоцитов памяти, обеспечивающих вакцинированным мышам как длительную защиту от вторичной провокации привитыми сингенными клетками, экспрессирующими Е7 ВПЧ 16 (антиген, экспрессируемый опухолями), так и, параллельно, защиту от новой провокации привитыми сингенными клетками, экспрессирующими Е7 ВПЧ 18 (антиген, не экспрессируемый опухолями и доставляемый исключительно вектором CyaA-HPV18E7 432-42).

Терапевтическая бивалентная вакцинация CyaA-HPV16E7Δ30-42/CyaA-MAGE A3 обеспечивает эрадикацию HPV16 Е7-экспрессирующих солидных опухолей и защиту от развития MAGE - A3 индуцируемых опухолей

У мышей, вакцинированных CyaA-HPV16E7Δ30-42/CyaA-MAGE A3 + Aldara в качестве чрескожного адъюванта (группа 3), и у мышей, вакцинированных ProCervix с адъювантом Aldara (группы 5 и 6), TCl-индуцированные солидные опухоли исчезали в течение 40 дней: у 9 из 10 мышей в группе 3 (Фиг. 9с); у 8 из 10 мышей в группе 5, и у 9 из 10 в группе 6 (Фиг. 9е и f). Значительная элиминация опухолей наблюдалась до дня 100. Напротив, у мышей, которых вакцинировали плацебо, с адъювантом или без адъюванта (группа 1 и 2, соответственно), в качестве отрицательного контроля, развивались TCl-индуцированные солидные опухоли: у 9/10 мышей в группе 1 (Фиг. 9а) и у 8/10 мышей в группе 2 (Фиг. 9b).

В день 60 выжившим мышам из групп 3 и 5 инокулировали в левый бок опухолевые клетки В16, экспрессирующие белок MAGE A3. Ни у одной из мышей, которых вакцинировали СуаА-HPV16E7Δ30-42/CyaA-MAGE A3 в присутствии Aldaraтм, и у которых исчезали ТС1 - индуцированные опухоли, не наблюдалось развития опухолей B16-MAGEA3 после провокации (у 0 из 9 мышей развивались опухоли B16-MAGEA3; Фиг. 10а), что указывает на то, что указанные мыши были защищены от провокации B16-MAGE А3-индуцированными солидными опухолями.

Напротив, у мышей, вакцинированных ProCervix с адъювантом Aldaranv, у которых исчезали ТС1 - индуцированные опухоли, развивались опухоли B16-MAGEA3 (у 6 из 8 мышей развивались опухоли B16-MAGEA3; Фиг. 10с), что указывает на то, что Procervix (HPV16E7/HPV18E7) не обеспечивала защитный иммунитет Т-клеток памяти против провокации опухолевыми клетками В16-MAGEA3. Соответственно, защита от развития MAGE А3-индуцированных опухолей, наблюдаемая у мышей в группе 3, достигалась в результате индуцирования MAGE А3-специфического опосредованного Т-клетками памяти ответа у мышей, вакцинированных CyaA-MAGEA3, в то время как опосредуемый Т-клетками памяти ответ, достигнутый у мышей в группе 5, был направлен против антигена (HPV18 Е7), не зависит от природы опухолевых клеток B16-MAGEA3.

В заключение, указанные эксперименты показывают, что бивалентный СуаА может применяться, после однократного введения, как для эрадикации клеток ТС-1 (НРУ18Е7-специфичный иммунный ответ), так и для предотвращения развития опухолевых клеток B16-MAGEA3 (MAGE А3-специфичный опосредуемый Т-клетками памяти ответ). Кроме того, результаты, полученные после дня 60, показали, что достигнутый профилактический эффект, направленный против опухолевых клеток B16-MAGEA3, не мешал достигнутому терапевтическому эффекту, направленному против клеток ТС-1 (эрадикация клеток ТС1 до дня 100; Фиг. 9с). Терапевтическая вакцинация бивалентной СуаА-НРУ16Е7Δ30-42/CyaA-cysOVA обеспечивает эрадикацию HPV16 Е7-экспрессирующих солидных опухолей и защиту от развития EG7-ОVА-индуцированных опухолей

У мышей, вакцинированных CyaA-HPV16E7Δ30-42/CyaA-CysOVA в присутствии Aldarтм в качестве чрескожного адъюванта (группа 4), и мышей, вакцинированных ProCervix с адъювантом Aldara (группа 5 и 6) ТС1-индуцированные солидные опухоли исчезали в пределах 40 дней: у 9 из 10 мышей в группе 4 (Фиг. 9d), у 8 из 10 мыши в группе 5, и у 9 из 10 в группе 6 (Фиг. 9е и f). Выраженная элиминация опухолей наблюдалась до дня 100. Напротив, у мышей, которых вакцинировали плацебо с адъювантом или без адъюванта (группа 1 и 2, соответственно) в качестве отрицательного контроля, развивались ТС1-индуцированные солидные опухоли: у 9/10 мышей в группе 1 (Фиг. 9а) и у 8/10 мышей в группе 2 (Фиг. 9b).

В день 60 выжившим мышам из групп 4 и 6 инокулировали в левый бок EG7-OVA опухолевые клетки (злокачественные сингенные клетки, экспрессирующие белок овальбумин). В группе 6 у мыши 6004 опухоль развилась после 60 дня (Фиг. 9f), поэтому ей инокулировали опухолевые клетки EG7-OVA, как и остальным 9 мышам указанной группы, у которых не развивались опухоли. Ни у одной из мышей, которых вакцинировали CyaA-HPV16Е7Δ30-42/СуаА-CysOVA в присутствии Aldarтм и у которых исчезали ТС1-индуцированные опухоли, не наблюдалось развития опухоли EG7-OVA после провокации (у 0 из 9 мышей развивались опухоли EG7-OVA; Фиг. 10b), что доказывает, что указанные мыши были защищены от провокации опухолевыми клетками EG7-OVA. Напротив, у мышей, которых вакцинировали ProCervix с адъювантом Aldaraтм и у которых исчезали ТС1 - индуцированные опухоли, развивались опухоли EG7-OVA (у 8 из 10 мышей развивались опухоли EG7-OVA; Фиг. 10d), что указывает на то, что Procervix (HPV16E7/HPV18E7) не обеспечивала защитный иммунитет Т-клеток памяти от провокаций опухолевыми клетками EG7-OVA. Соответственно, защита от развития ЕС7-ОУА-индуцированных солидных опухолей, наблюдаемая в группе 4, достигалась в результате индуцирования OVA-специфичного опосредованного Т-клетками памяти ответа у мышей, вакцинированных CyaA-HPV16E7Δ30-42/CyaA-CysOVA, в то время как опосредуемый Т-клетками памяти ответ, индуцированный у мышей группы 6, был направлен против антигена (HPV18 Е7), не связан с 15 природой опухолей EG7-OVA. В заключение, указанные эксперименты показывают, что бивалентный СуаА может применяться, после однократного введения, как для эрадикации клеток ТС-1 (HPV18E7-специфичный иммунный ответ), так и для предотвращения развития ЕС7-ОУА - индуцированных солидных опухолей. Кроме того, результаты, полученные после дня 60, показали, что индуцированный профилактический эффект, направленный против опухолевых клеток EG7-OVA, не мешал индуцированному терапевтическому эффекту, направленному против клеток ТС-1 (эрадикация клеток ТС1 до дня 100; Фиг. 9d).

С. ЗАКЛЮЧЕНИЕ

Предложенный в настоящем изобретении новый подход, включающий бивалентную терапевтическую вакцинацию ProCervix, предназначен, с одной стороны, для лечения, например, инфицированных ВПЧ 16 пациентов, эрадикации инфекции, и, с другой стороны, для обеспечения опосредованного Т-клетками памяти ответа как на антиген HPV16 Е7, так и на антиген HPV18 Е7, с формированием у вакцинированных ProCervix пациентов длительной защиты от возможной повторной инфекции ВПЧ 16, а также от более поздней инфекции ВПЧ 18.

Это было подтверждено двумя другими бивалентными вакцинациями (СуаА-НРУ16Е7Δ30-42/CyaA-MAGE A3 и CyaA-HPV16E7Δ30-42/CyaA-CysOVA), которые, как было показано, с одной стороны, излечивали инфицированных ВПЧ 16 мышей (эрадикация клеток ТС1), и, с другой стороны, обеспечивали защиту от развития опухолей B16-MAGE A3 или опухолей EG7-OVA, соответственно.

С использованием доклинической мышиной модели карциномы шейки матки [опухолевые клетки ТС-1 (Lin, Guarnieri et al. 1996; Zwaveling, Ferreira Mota et al. 2002)] было показано, что терапевтическая вакцинация мышей с солидными HPV16 Е7-экспрессирующими опухолями ProCervix в комбинации с молекулой адъюванта [агонистами TLR, такими как Aldaraтм (Johnston и Bystryn 2006; Heib, Becker et al. 2007; Schon and Schon 2008) или Poli-ICLC (Longhi, Trampfheller et al. 2009)], приводит к эффективной регрессии опухоли.

Кроме того, было показано, что индуцированную вакциной элиминация опухоли можно связать с наличием ответа долгоживущих HPV16 Е7-специфичных CTL памяти у мышей с полной эрадикацией опухоли. Также неожиданно обнаружено, что у указанных не имеющих опухолей мышей при терапевтической вакцинации ProCervix параллельно формируется ответ функциональных HPV18 Е7-специфичных CTL памяти. И HPV16 Е7-, и HPV18 Е7-специфичные CTL памяти демонстрировали литический потенциал in vivo. Наблюдения, указывающие на то, что переносимые СуаА полипептиды способны вызывать предупредительный ответ Т-клеток памяти против второй группы эпитопов у хозяина-млекопитающего (профилактический иммунный ответ), в то же время обеспечивая иммунотерапевтическое лечение по меньшей мере одного первого определенного патологического состояния, диагностированного у указанного хозяина-млекопитающего, путем стимуляции Τ-клеточного иммунного ответа против первой группы эпитопов, являются неожиданными. Действительно, общеизвестно, что между разными эпитопами существует конкуренция в отношении либо доступа к АПК, процессирования и презентации АПК, либо доступности цитокинов. Указанное явление приводит к формированию иерархии доминантных и субдоминантных эпитопов, и обеспечивает активацию Т-клеточного иммунного ответа и подавление другого(их) Т-клеточного(ых) 20 иммунного(ых) ответа(ов). Ожидалось, что указанное явление будет наблюдаться и в данной ситуации, в которой Т-клетки, распознающие первую группа эпитопов, уже присутствуют у пациента до введения переносимых вектором полипептидов (так как один или несколько эпитопов первой группы уже презентированы иммунной системе хозяина), в то время как нативные Т-клетки должны активироваться за счет второй группы эпитопов. Интересно то, что в настоящем изобретении продемонстрировано, что, вопреки ожиданиям, предупредительный иммунный ответ против второй группы эпитопов, содержащейся в переносимых СуаА полипептидах, судя по всему, не угнетается по сравнению с терапевтическим иммунным ответом против первой группы эпитопов. Указанные результаты означают, что конкуренции между индуцированным иммунным ответом против первой группы эпитопов и индуцированным иммунным ответом против второй группы эпитопов не наблюдается. Таким образом, авторы показали, что полипептиды, переносимые СуаА, достаточно эффективны для запуска Т-клеточного иммунного ответа в иммунотерапевтическом лечении по меньшей мере одного первого определенного патологического состояния, диагностированного у хозяина-млекопитающего, и запуска иммунного ответа Т-клеток памяти при профилактике по меньшей мере одного второго определенного патологического состояния у того же хозяина-млекопитающего.

СПИСОК ЛИТЕРАТУРЫ

Ahmed, R., M.J. Bevan, et al. (2009). "The precursors of memory: models and controversies." Nat Rev Immunol 9 (9): 662-668.

Bachmann, M.F. and G T. Jennings (2010). "Vaccine delivery: a matter of size, geometry, kinetics and molecular patterns." Nat Rev Immunol 10(11): 787-796.

Barber, D.L, E. J. Wherry, et al. (2003). "Cutting edge: rapid in vivo killing by memory CD8 Τ cells." J Immunol 171 (1): 27-31.

Barchet, W., S. Oehen, et al. (2000). "Direct quantitation of rapid elimination of viral antigen-positive lymphocytes by antiviral CD8(+) Τ cells in vivo." Eur J Immunol 30 (5): 1356-1363.

Frazer, I.H. (2009). "Interaction of human papillomaviruses with the host immune system: a well evolved relationship." Virology 384 (2): 410-414.

Goodwin, M.S. and A.A. Weiss (1990). "Adenylate cyclase toxin is critical for colonization and pertussis toxin is critical for lethal infection by Bordetella pertussis in infant mice." Infect Immun 58 (10): 3445-3447.

Guermonprez et al. Journal of Experimental Medicine, 1 93 (9), ppl 035-1 044, 2001 Heib, V., M. Becker, et al. (2007). "Mast cells are crucial for early inflammation, migration of Langerhans cells, and CTL responses following topical application of TLR7 ligand in mice." Blood 110 (3): 946-953.

Ingulli, E. (2007). "Tracing tolerance and immunity in vivo by CFSE-labeling of administered cells." Methods Mol Biol 380: 365-376.

Iwasaki, A. (2010). "Antiviral immune responses in the genital tract: clues for vaccines." Nat Rev Immunol 10 (10): 699-711.

Johnston, D. and J.C. Bystryn (2006). "Topical imiquimod is a potent adjuvant to a weakly-immunogenic protein prototype vaccine." Vaccine 24 (11): 1958-1965.

Kaech, S.M., S. Hemby, et al. (2002). "Molecular and functional profiling of memory CD8 Τ cell differentiation." CeN 111 (6): 837-851.

Ladant et al. Journal of Biological Chemistry, 267 (4): 2244-2250, 1992.

Lin, K.Y., F.G. Guarnieri, et al. (1996). "Treatment of established tumors with a novel vaccine that enhances major histocompatibility class II presentation of tumor antigen." Cancer Res 56 (1): 21-26.

Longhi, M.P., C. Trumpfheller, et al. (2009). "Dendritic cells require a systemic type I interferon response to mature and induce CD4+ Thl immunity with poly IС as adjuvant." J Exp Med 206 (7): 1589-1602.

Merad, M., F. Ginhoux, et al. (2008). "Origin, homeostasis and function of Langerhans cells and other langerin-expressing dendritic cells." Nat Rev Immunol 8 (12): 935-947.

Preville, X., D. Ladant, et al. (2005). "Eradication of established tumors by vaccination with recombinant Bordetella pertussis adenylate cyclase carrying the human papillomavirus 16 E7 oncoprotein." Cancer Res 65 (2): 641-649.

Pulendran, В., S. Li, et al. (2010). "Systems vaccinology." Immunity 33 (4): 516-529.

Rosato, Α., A. Zoso, et al. (2006). "Predicting tumor outcome following cancer vaccination by monitoring quantitative and qualitative CD8+ Τ cell parameters." J Immunol 176 (3): 1999-2006.

Sallusto, F., A. Lanzavecchia, et al. (2010). "From vaccines to memory and back." Immunity 33 (4): 451 -463.

Schon, M.P. and M. Schon (2008). "TLR7 and TLR8 as targets in cancer therapy." Oncogene 27 (2): 190-199.

Schreiber, T.H., V.V. Deyev, et al. (2009). "Tumor-induced suppression of CTL expansion and subjugation by gp96-lg vaccination." Cancer Res 69 (5): 2026-2033.

Simsova, M., P. Sebo, et al. (2004). "The adenylate cyclase toxin from Bordetella pertussis-a novel promising vehicle for antigen delivery to dendritic cells." Int J Med Microbiol 293 (7-8): 571-576.

Stanley, M. (2010). "Potential mechanisms for HPV vaccine-induced long-term protection." Gynecol Oncol 118 (1 Suppl): S2-7.

Trimble, C.L. and I.H. Frazer (2009). "Development of therapeutic HPV vaccines." Lancet Oncol 10 (10): 975-980.

Woodland, D.L. and J.E. Kohlmeier (2009). "Migration, maintenance and recall of memory Τ cells in peripheral tissues." Nat Rev Immunol 9 (3): 153-161.

Zwaveling, S., S.C. Ferreira Mota, et al. (2002). "Established human papillomavirus type 16-expressing tumors are effectively eradicated following vaccination with long peptides." J Immunol 169 (1): 350-358.

1. Композиция для иммунотерапевтического лечения или профилактики состояния, которое является следствием инфицирования ВПЧ16 и/или ВПЧ18, содержащая фармацевтически приемлемую основу или состав и эффективное количество по меньшей мере одного вектора из белка СуaА Bordatella pertussis или его фрагмента, несущего полипептиды, содержащие эпитопы:

(i) HPV16 Е7Δ30-42, и

(ii) HPV18 Е7Δ32-42, и/или MAGE-A397-178/190-295, и/или CysOVA257-294,

причем указанная композиция дополнительно содержит адъювант, который представляет собой лиганд Toll-подобного рецептора, выбранный из имиквимода и поли-ICLC.

2. Композиция по п. 1, содержащая два вектора, несущих полипептиды, отличающаяся тем, что первый эпитоп содержится в первом векторе, а по меньшей мере один второй эпитоп содержится в отдельном векторе.

3. Композиция по п. 1, в которой все эпитопы содержатся в одном векторе.

4. Композиция по п. 1, отличающаяся тем, что по меньшей мере один, а предпочтительно все, полипептиды генетически встроены в пермиссивные участки СуаА.

5. Композиция по п. 1, отличающаяся тем, что указанный фрагмент СуаА обладает способностью специфично связываться с CD11b-экспрессирующими клетками и возможно доставлять полипептиды в цитозоль клеток, например, фрагмент СуаА В. pertussis, состоящий из остатков 1-224 и 235-1706.

6. Композиция по п. 1, отличающаяся тем, что белок СуаА или фрагмент СуаА детоксифицирован, нетоксичен или не обладает ферментативной активностью, например, СуаА В. pertussis, в котором дипептид Leu-Gln встроен внутри рамки между остатками 188 и 189.

7. Композиция по п. 1, отличающаяся тем, что по меньшей мере один, а предпочтительно все указанные полипептиды переносятся указанным белком СуаА или фрагментом СуаА в результате генетической гибридизации.

8. Композиция по п. 1, содержащая:

(a) первый вектор, несущий полипептиды, состоящий из первых 29 аминокислотных остатков ВПЧ16-Е7, встроенных между кодонами 319 и 320 СуаА, и остатков 43-98 Е7 ВПЧ16, встроенных между кодонами 224 и 235 СуаА; и

(b) отдельный вектор, несущий полипептиды, состоящий из первых 31 аминокислотных остатков ВПЧ18-Е7, встроенных между кодонами 319 и 320 СуаА, и остатков 43-105 ВПЧ18-Е7, встроенных между кодонами 224 и 235 СуаА.

9. Композиция по п. 1, отличающаяся тем, что вектор, содержащий эпитопы MAGE A3, состоит из СуаА В. pertussis, при этом:

(1) первый полипептид, состоящий из остатков 97-178 MAGE A3, встроен между кодонами 319 и 320 СуаА; и

(2) второй полипептид, состоящий из остатков 190-221, слитых с остатками 242-295 MAGE A3, встроен между кодонами 224 и 235 СуаА.



 

Похожие патенты:

Группа изобретений относится к биотехнологии, а именно к получению сопряженных диенов методом ферментативной дегидратации. Способ получения сопряженного диена включает стадию ферментативного превращения соединения общей формулы СnН2nO в соединение общей формулы CnH2n-2+Н2О, где 3<n<7, с использованием линалоол-дегидратазы (ЕС 4.2.1.127).

Группа изобретений относится к микроорганизму, продуцирующему путресцин, и способу получения путресцина с использованием указанного микроорганизма. В предложенном микроорганизме усилена активность белка, имеющего аминокислотную последовательность, представленную в SEQ ID NO: 21 или 23, по сравнению с активностью указанного белка у микроорганизма дикого типа.

Группа изобретений относится к области биотехнологии. Предложена рекомбинантная бактерия для получения ацетона, которая содержит ген, кодирующий фосфокетолазу, в которой инактивирован путь Эмбдена-Мейерхофа-Парнаса путем удаления генов, кодирующих фосфофруктокиназу, и в которой инактивирована окислительная ветвь пентозафосфатного пути в результате удаления генов, кодирующих глюкозо-6-фосфатдегидрогеназу.

Изобретение относится к области генной инженерии, конкретно к получению микробных продуцентов, и может быть использовано для получения микробного масла. Сконструирована жирообразующая клетка дрожжей, способная к конверсии источника углерода в жирную кислоту, производное жирной кислоты и/или триацилглицерин.

Группа изобретений относится к области биотехнологии. Предложен вариант мутантной рекомбинантной гепариназы I из Pedobacter heparinus, содержащий следующие аминокислотные замены по сравнению с аминокислотной последовательностью исходной гепариназы I: E117Q, Q118P, Е362Р, Y363P.

Группа изобретений относится к области биотехнологии. Представлен генетически модифицированный микроорганизм для получения бутадиена, представляющий собой бактерию, дрожжи, нитевидные грибы, простейшие или водоросли и содержащий один или более полинуклеотидов, кодирующих ферменты в метаболическом пути, катализирующие превращение ферментируемого источника углерода в кротонил-КоА, и один или более полинуклеотидов, кодирующих ферменты в метаболическом пути, катализирующие превращение кротонил-КоА в бутадиен, где указанными ферментами являются или кротонил-КоА-редуктаза (бифункциональная) (Е.С.1.1.1) и дегидратаза кротонилового спирта (Е.С.4.2.1, 4.2.1.127), или дегидрогеназа кротонилового альдегида (Е.С.1.2.1), дегидрогеназа кротонилового спирта (Е.С.1.1.1, 1.1.1.1) и дегидратаза кротонилового спирта (Е.С.4.2.1, 4.2.1.127).

Изобретение относится к способу получения 2,4-дигидроксипентановой кислоты, включающему превращение пирувата в 4-гидрокси-2-оксопентановую кислоту с помощью альдольного присоединения и превращение 4-гидрокси-2-оксопентановой кислоты в 2,4-дигидроксипентановую кислоту посредством химического или ферментативного восстановления.

Предложены модифицированная рекомбинантная клетка-хозяин для производства фенольного соединения и способ производства фенольного соединения (варианты). Клетка-хозяин содержит три системы экспрессии.

Группа изобретений относится к области биохимии. Предложен полинуклеотид, кодирующий белок, обладающий активностью изопренсинтазы.

Группа изобретений относится к области биотехнологии. Представлен способ получения алкена, включающий превращение 3-гидроксиалканоата в указанный алкен с помощью первого фермента, который обладает активностью превращать 3-гидроксиалканоат в соответствующий 3-фосфоноксиалканоат, и второго фермента, который структурно отличается от первого фермента и который обладает активностью превращать указанный 3-фосфоноксиалканоат в указанный алкен, при этом первый и второй ферменты представляют собой ДФМ (дифосфат мевалонат) декарбоксилазу.

Группа изобретений относится к средствам диагностики хронических патологий головного мозга млекопитающих ишемического генеза. Набор реагентов для диагностики хронических патологий головного мозга млекопитающих ишемического генеза включает гибридный пептид, имеющий по меньшей мере 90% идентичность по всей длине с последовательностью SEQ ID NO:1 и иммобилизованный на твердом носителе, и реагент для определения присутствия аутоантител к упомянутому гибридному пептиду в биологической жидкости млекопитающего, имеющий сродство к иммуноглобулинам млекопитающего.

Настоящее изобретение относится к области биотехнологии, конкретно к рекомбинантному получению слитого белка, состоящего из иммунорегуляторного белка гандермы и человеческого сывороточного альбумина (HSA), и может быть использовано в медицине для лечения лейкопении и как противоопухолевое средство.

Изобретение относится к области биотехнологии, конкретно к получению химерных антигенных рецепторов (CAR), называемых многоцепочечными CAR, и может быть применено в медицине для противоопухолевой терапии.

Изобретение относится к биотехнологии. Описан способ модифицирования заданного сайта-мишени в последовательности нуклеиновой кислоты-мишени в клетке-хозяине с помощью программируемого нуклеопротеинового молекулярного комплекса.

Изобретение относится к области биотехнологии, конкретно к шаттлам для гематоэнцефалического барьера, что может быть использовано в медицине. Получают шаттл для гематоэнцефалического барьера, который связывается с рецептором трансферрина, содержит специфичный к нему scFab, линкер и эффекторный элемент для головного мозга, что используют в фармацевтических композициях для транспорта эффекторного элемента для головного мозга через гематоэнцефалический барьер.

Изобретение относится к области биохимии, в частности к способу получения терапевтически активного слитого белка, содержащего группировку направленного взаимодействия с опухолью и по меньшей мере одну иммуномодулирующую группировку, противодействующую иммунной толерантности раковой клетки, а также к препарату для лечения эпителиальных форм рака, содержащему эффективное количество гомогенных терапевтически активных слитых белков, полученных указанным способом.

Изобретение относится к биохимии. Описано антитело для увеличения количества связываний антигена антителом, для улучшения удержания антитела в плазме или для стимулирования захвата антителом антигена в клетке, содержащее антигенсвязывающий домен и FcRn-связывающий домен человека, активность связывания антигена которого отличается в двух различных условиях концентрации кальция и является более низкой в условиях низкой концентрации кальция, чем в условиях высокой концентрации кальция, где низкая концентрация кальция представляет собой концентрацию ионизированного кальция от 0,1 до 30 мкМ, а высокая концентрация кальция представляет собой концентрацию ионизированного кальция от 100 мкМ до 10 мМ, где указанное антитело содержит по крайней мере четыре аминокислоты, выбранные из группы, включающей аминокислоты в положениях 30, 31, 32, 50 и 92 в соответствии с нумерацией по Kabat в легкой цепи, которые обладают хелатирующей активностью в отношении металла.

Изобретение относится к биотехнологии. Предложен способ получения вирусоподобных частиц (VLP) в растении, который включает введение нуклеиновой кислоты, содержащей регуляторную область, активную в растении, и функционально связанную с химерной нуклеотидной последовательностью, в растение или часть растения, последующую инкубацию растения или его части в условиях, обеспечивающих экспрессию нуклеиновой кислоты с получением VLP.

Изобретение относится к области биотехнологии, конкретно к С5-связывающим полипептидам, содержащим С5-связывающий мотив ВМ, что может быть использовано в медицине. Получают С5-связывающий полипептид, содержащий С5-связывающий мотив ВМ, причем этот мотив состоит из аминокислотной последовательности, соответствующей EX2X3X4AX6X7EIDX11LPNLX16X17X18QWX21AFIX25X26LX28D, и применяют полученный полипептид для лечения связанного с С5 состояния, например для ингибирования гемолитического эффекта.

Изобретение относится к биотехнологии. Предложены рекомбинантный полипептид гемагглютинин (НА) вируса гриппа для вызова иммунного ответа на вирус гриппа H3N2, молекула нуклеиновой кислоты, его кодирующая, и вектор экспрессии, слитый белок и вирусоподобная частица (VLP), содержащие указанный полипептид НА, и выделенная клетка для выработки и экспрессии указанной VLP, а также композиция, содержащая указанные полипептид, VLP и слитый белок, и способ вызова иммунного ответа в отношении вируса гриппа H3N2.
Настоящее изобретение относится к биотехнологии. Предложены вакцинная композиция, подходящая для системного введения, для защиты животного против клинического заболевания, возникающего из инфекции Bordetella bronchiseptica, и способы поддержки защиты псовых и животных против такого клинического заболевания путем системного введения вакцинной композиции.

Настоящее изобретение относится к биохимии и медицине. Предложена композиция для иммунотерапевтического лечения или профилактики состояния, которое является следствием инфицирования ВПЧ16 иили ВПЧ18, содержащая фармацевтически приемлемую основу или состав и эффективное количество по меньшей мере одного вектора из белка СуaА Bordatella pertussis или его фрагмента, несущего полипептиды, содержащие эпитоп HPV16 Е7Δ30-42 и эпитоп HPV18 Е7Δ32-42, иили MAGE-A397-178190-295, иили CysOVA257-294, причем указанная композиция дополнительно содержит адъювант, который представляет собой лиганд Toll-подобного рецептора, выбранный из имиквимода и поли-ICLC. Применение данной композиции обеспечивает стимуляцию иммунного ответа против соответствующих антигенных эпитопов, в том числе стимуляцию образования Т-клеток памяти. 8 з.п. ф-лы, 10 ил.

Наверх