Конъюгаты инсулин-инкретин



Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
Конъюгаты инсулин-инкретин
C07K2319/00 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2678134:

ИНДИАНА ЮНИВЕРСИТИ РИСЕРЧ ЭНД ТЕКНОЛОДЖИ КОРПОРЕЙШН (US)

Настоящее изобретение относится к области биотехнологии, конкретно к новому агонисту инсулина, конъюгированному с инкретиновым белком, и может быть использовано в медицине. Конъюгат инсулина и инкретина по настоящему изобретению обладает активностью агониста как в отношении инсулинового рецептора, так и соответствующего рецептора инкретина, и может применяться для лечения юношеского диабета и сахарного диабета зрелого возраста на поздней стадии. 3 н. и 5 з.п. ф-лы, 15 ил., 5 табл., 9 пр.

 

ПЕРЕКРЕСТНАЯ ССЫЛКА НА РОДСТВЕННЫЕ ЗАЯВКИ

По настоящей заявке испрашивается приоритет временной заявки на патент США № 61/783491, поданной 14 марта 2013 года, содержание которой полностью включено посредством ссылки в настоящую заявку.

ВКЛЮЧЕНИЕ ПОСРЕДСТВОМ ССЫЛКИ МАТЕРИАЛА, ПОДАННОГО В ЭЛЕКТРОННОМ ВИДЕ

Полностью включенным посредством ссылки является машиночитаемый список последовательностей, подписанный одновременно с настоящей заявкой и идентифицируемый так, как указано ниже: один файл 983KB ASCII (text), называемый "27137_PCT_SL.txt", созданный 5 марта 2014 года.

УРОВЕНЬ ТЕХНИКИ

Инсулин является признанной терапией для лечения юношеского диабета и сахарного диабета зрелого возраста на поздней стадии. Пептид биосинтезируется в виде более крупного линейного предшественника низкой активности (приблизительно от 2% до 9% нативного инсулина), называемого проинсулином. Проинсулин протеолитически преобразуется в инсулин путем избирательного удаления соединяющего пептида длиной 35 остатков, (C-пептида). Получаемый гетеродуплекс, образованный дисульфидными связями между "A-цепью" (SEQ ID NO: 1) и "B-цепью" (SEQ ID NO: 2) инсулина, содержащий всего 51 аминокислоты, обладает высокой активностью по отношению к инсулиновому рецептору (в диапазоне нМ). Нативный инсулин обладает приблизительно в сто раз большей селективной аффинностью к инсулиновому рецептору по сравнению с родственным рецептором инсулиноподобного фактора роста 1, но обладает незначительной селективностью в отношении двух различных изоформ инсулинового рецептора, называемых A и B.

Инсулиноподобные факторы роста 1 и 2 представляют собой одноцепочечные линейные пептидные гормоны, последовательности A- и B-цепи которых являются высоко гомологичными, обладающие приблизительно пятидесяти процентной гомологией с нативным инсулином. A- и B-цепи IGF соединены "C-пептидом", где C-пептиды двух IGF отличаются размером и аминокислотной последовательностью, где длина первого составляет двенадцать аминокислот, и длина второго составляет восемь аминокислот. IGF-1 человека представляет собой основной пептид 70 а.к., содержащий белковую последовательность, представленную в SEQ ID NO: 3, и обладает 43% гомологией с проинсулином (Rinderknecht et al., (1978) J. Biol. Chem., 253:2769-2776). IGF-2 человека представляет собой основной пептид длиной 67 аминокислот, содержащий белковую последовательность, представленную в SEQ ID NO: 4. IGF обладают значительно меньшей активностью по отношению к изоформе B рецептора инсулин, чем к изоформе A рецептора.

Заявители ранее идентифицировали пептидные аналоги инсулина на основе IGF-1 (где нативный дипептид Gln-Phe B-цепи заменяют Tyr-Leu), который обладают более высокой аффинностью к инсулиновому рецептору (см. PCT/US2009/068713, описание которой включено в настоящее описание). Такие аналоги (обозначаемые в настоящее описание как пептиды-аналоги IGF YL) легче синтезировать, чем инсулин, и они обеспечивают возможность разработки аналогов коагонистов рецепторов инсулина и IGF-1 и селективных специфических аналогов инсулинового рецептора. Кроме того, эти аналоги инсулина также можно формулировать в виде одноцепочечных агонистов инсулина в соответствии с настоящим изобретением.

Ранее были получены одноцепочечные аналоги инсулина, содержащие A- и B-цепи инсулина (см. EP 1193272 и US 2007/0129284). Однако одноцепочечные агонисты инсулина с высокой активностью также можно получать вставкой C-пептида IGF-1 или его аналогов в качестве соединяющего пептида, связывающего B- и A-пептиды инсулина. Избирательные мутация отдельных аминокислот в последовательности C-пептида приводят к пептидам, которые являются высокоселективными в отношении инсулинового рецептора по сравнению с рецептором IGF-1.

Инкретины представляют собой группу желудочно-кишечных гормонов, которые участвуют в широком спектре физиологических функций, включая гомеостаз глюкозы, секрецию инсулина, опорожнение желудка и рост кишечника, а также регуляцию потребления пищи. Препроглюкагон представляет собой полипептид-предшественник длиной 158 аминокислот, который подвергается обработке в различных тканях с образованием ряда различных пептидов. Инкретины включают ряд получаемых из проглюкагона пептидов, включая глюкагон (SEQ ID NO: 701), глюкагоноподобный пептид-1 (GLP-1; аминокислоты 7-36 предоставлены как SEQ ID NO: 703 и аминокислоты 7-35 как SEQ ID NO: 704), глюкагоноподобный пептид-2 (GLP-2; SEQ ID NO: 708) и оксинтомодулин (OXM; SEQ ID NO: 706).

Глюкагон представляет собой пептид длиной 29 аминокислот, который соответствует аминокислотам 33-61 препроглюкагона, тогда как GLP-1 продуцируется как пептид длиной 37 аминокислот, который соответствует аминокислотам 72-108 препроглюкагона. Амид GLP-1(7-36) (SEQ ID NO: 703; C-конец представляет собой аргининамид) или кислота GLP-1(7-37) (SEQ ID NO: 704; C-конец представляет собой глицин) представляют собой биологически активные формы GLP-1, которые обладают по существу эквивалентной активностью в отношении рецептора GLP-1.

Глюкагон является жизненно важным лекарственным средством, которое используют для неотложного лечения тяжелой гипогликемии. Опубликовано, что оксинтомодулин обладает фармакологической способностью подавлять аппетит и снижать массу тела. Клинические исследования с агонистами рецептора GLP-1 или стабилизированными аналогами GLP-1 подтвердили, что это семейство пептидов является эффективным средством лечения диабета II типа.

Кроме того, желудочный ингибиторный полипептид (GIP) также известен как глюкозозависимый инсулинотропный пептид и является представителем семейства гормонов секретинов. GIP образуется из пропротеина длиной 153 аминокислот, кодируемого геном GIP, и циркулирует в виде биологически активного пептида длиной 42 аминокислоты (SEQ ID NO: 707). Ген GIP экспрессируется в тонком кишечнике, а также в слюнных железах и является слабым ингибитором секреции желудочной кислоты. В дополнение к своему ингибирующему действию в желудке в присутствии глюкозы GIP усиливает выделение инсулина островковыми бета-клетками поджелудочной железы при введении в физиологических дозах. Полагают, что GIP функционирует как интестинальный фактор, который стимулирует выделение инсулина поджелудочной железой и который может играть физиологическую роль в поддержании гомеостаза глюкозы.

Как описано в настоящем описании, конъюгаты могут образовываться между пептидом инсулина и инкретином, включая, например, родственный глюкагону пептид, где конъюгат обладает активностью агонистов инсулинового рецептора и соответствующего рецептора инкретина. Более конкретно, ожидают, что конъюгация родственного глюкагону пептида (например, GIP, GLP-1 или глюкагона) обеспечивает благоприятную модификацию пептидной активности инсулина. Например, ожидают, что связывание пептида с активностью агониста рецептора глюкагона с инсулиновым пептидом повысит направленную доставку конъюгата в печень, т.к. рецептор глюкагона преимущественно локализуется в печени. Направленная доставка конъюгата в печень является желательной, т.к. печень преимущественно участвует в продукции глюкозы, а не утилизации. Таким образом, направленная доставка в печень может являться более безопасным подходом блокирования продукции глюкозы, которую наблюдают, когда инсулин контактирует с другими тканями, такими как мышечная или жировая, где в дополнение к "выключению" продукции глюкозы он также стимулирует использование глюкозы, приводящее к более высокому риску гипогликемии. Также существуют рецепторы глюкагона, содержащиеся на альфа-клетках поджелудочной железы. Доставка комплекса в альфа-клетки может подавлять дополнительную продукцию глюкагона или делать альфа-клетка более чувствительными к гипогликемии. Заявители также ожидают, что наличие глюкагона в конъюгатах глюкагон-инсулин может служить в качестве буферной системы по отношению к активности связанного инсулина, обеспечивая в большей степени фоновую активность и, таким образом, предотвращая пики уровней глюкозы в крови.

Аналогично, ожидается, что конъюгаты инсулиновых пептидов с другими родственными глюкагону пептидами, включая инкретины GLP-1 и GIP и другие родственные пептиды, обладающие активностью по отношению к рецепторам GLP-1 и/или GIP, образуют конъюгаты, обладающие благоприятными свойствами. Например, конъюгат GLP-инсулин можно направлять в гипоталамус для снижения аппетита, а также снижения уровня в глюкозы крови. Альтернативно или дополнительно, конъюгат GLP-инсулин можно направлять в бета-клетки для активации анаболической реакции (повышение продукции островковыми бета-клетками инсулина).

Конъюгаты родственный глюкагону пептид-инсулиновый пептид также являются подходящими для дополнительных усилений структуры, которые предусматривают для обеспечения улучшенного терапевтического индекса посредством использования химии пролекарства; увеличенной продолжительности действия путем связывания белками плазмы, такими как альбумин, или другие модификации, включая пегилирование и ацилирование; и повышенную физическую стабильность путем гликозилирования. Получение одноцепочечных аналогов инсулина с использованием C-пептидного линкера также обеспечивает новое положение в структуре, где многие из этих химических модификаций можно эффективно проводить. Первоочередное использование конъюгатов инсулина предусматривают для лечения инсулинозависимого диабета.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Изобретение относится к конъюгату агонист инсулина/инкретин, где конъюгат обладает активностью агониста инсулинового рецептора и соответствующего рецептора инкретина. Инсулиновый пептидный компонент конъюгата может представлять собой нативный инсулин или любой известный аналог инсулина, который обладает активностью по отношению к инсулиновому рецептору, включая, например, любой инсулиновый пептид, раскрытый в опубликованных международных заявках WO96/34882, WO 2010/080607, WO 2010/080609, WO 2011/159882, WO/2011/159895 и патенте США № 6630348, описания которых включены посредством ссылки в настоящее описание. Инкретиновый компонент конъюгата может представлять собой любой родственный глюкагону пептид, как описано в настоящем описании, включая, например, нативный глюкагон, GLP-1, GIP или любой известный инкретин или родственный глюкагону пептид, который обладает активностью по отношению к одному или более рецепторов инкретина. Родственные глюкагону пептиды, пригодные для использования в соответствии с этим изобретением, включают, например, любой родственный глюкагону пептид, раскрытый в опубликованных международных заявках WO 2009/155258, WO 2009/058734, WO 2011/094337, WO 2009/148089, WO 2011/163473 и WO 2010/071807, описания которых явным образом полностью включены в настоящее описание.

В соответствии с одним из вариантов осуществления, C-конец родственного глюкагону пептида связан с N-концом инсулинового пептида непосредственно через пептидную связь (образующую слитый пептид) или опосредованно через спейсер. В соответствии с одним из вариантов осуществления предоставлены конъюгаты, образуемые слияниями глюкагона или GLP-1 с инсулином, которые обладают высокой активностью, сбалансированной активностью по отношению к соответствующим рецепторам конъюгата и снижающей уровень глюкозы способностью при введении нормальным мышам. В одном из вариантов осуществления C-концевая область родственных глюкагону пептидов ковалентно связана с инсулиновым пептидом через положение, независимо выбранное из боковой цепь аминокислоты в положении, выбранном из группы, состоящей из A9, A14 и A15 A-цепь, положений B1, B2, B10, B22, B28 или B29 B-цепи, N-концевого альфа-амина B-цепи, C-конца A- или B-цепь и в боковой цепи аминокислоты в любом положении связывающей группы, которая связывает A-цепь и B-цепь одноцепочечного аналога инсулина.

В настоящем описании, ссылка на C-концевую область родственного глюкагону пептида предназначена включать нативный C-конец пептида глюкагона или любую аминокислоту, добавляемую к нативному C-концу аналога глюкагона или к C-концевой аминокислоте аналога глюкагона, который укорачивали делецией аминокислот на C-конце, соответственно, относительно последовательности нативного глюкагона. Например, C-конец нативного родственного глюкагону пептида можно удлинять на 1-3 аминокислоты, которые затем связывают с инсулиновым пептидом через боковую цепь аминокислоты C-концевой области или через C-концевую карбоксигруппу. В одном из вариантов осуществления карбокси-концевая область родственного глюкагону пептида ковалентно связана с амино-концевой областью B-цепи инсулинового пептида. В одном из вариантов осуществления инсулиновый пептид представляет собой одноцепочечный аналог инсулина. В одном из вариантов осуществления инсулиновый пептид представляет собой одноцепочечный аналог инсулина, где карбокси-концевая область родственного глюкагону пептида ковалентно связана амино-концом B-цепи инсулинового пептида.

В одном из вариантов осуществления инсулиновый пептид конъюгата представляет собой двухцепочечный аналог инсулина, содержащий A-цепь и B-цепь, связанные друг с другом посредством межмолекулярных дисульфидных связей. В дополнительном варианте осуществления конъюгат содержит двухцепочечный аналог инсулина, где первый и второй родственный глюкагону пептид являются ковалентно связанными с инсулиновым пептидом в положении, выбранном из группы, состоящей из амино-конца B-цепи, карбокси-концевой области A-цепи и карбокси-концевой области B-цепи. В одном из вариантов осуществления первый и второй родственные глюкагону пептиды обладают различной аффинностью/селективностью к глюкагону, рецепторам GLP-1 и GIP.

В одном из вариантов осуществления родственный глюкагону пептид выбран из группы, состоящей из нативного глюкагона, нативного GLP-1 и нативного GIP. В одном из вариантов осуществления родственный глюкагону пептид представляет собой нативный глюкагон или аналог глюкагона, обладающий активностью по отношению к одному или более рецепторов инкретина, выбранных из рецептора глюкагона, рецептора GLP-1 или рецептора GIP. В одном из вариантов осуществления компонент родственного глюкагону пептида конъюгата содержит:

(i) аминокислотную последовательность: X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z (SEQ ID NO: 839) с 1-3 модификациями аминокислот в ней, где

X1 и/или X2 представляет собой ненативную (относительно SEQ ID NO: 701) аминокислоту, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

Z выбран из группы, состоящей из -COOH, -Asn-COOH, Asn-Thr-COOH и Y-COOH, где Y представляет собой от 1 до 2 аминокислот, и дополнительно где

(1) лактамовый мостик соединяет боковые цепи аминокислоты в положении i и аминокислоты в положении i+4, где i равно 12, 16, 20 или 24, или

(2) одна, две, три или все аминокислоты в положениях 16, 20, 21 и 24 родственного глюкагону пептида замещены α,α-двузамещенный аминокислотой;

и указанный родственный глюкагону пептид обладает активностью агонистов глюкагона;

(ii) аминокислотную последовательность SEQ ID NO: 701, модифицированную, чтобы содержать по меньшей мере одну модификацию аминокислот, выбранную из группы, состоящей из:

замены Asn в положении 28 на заряженную аминокислоту;

замены Asn в положении 28 на заряженную аминокислоту, выбранную из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замены в положении 28 на Asn, Asp или Glu;

замены в положении 28 на Asp;

замены в положении 28 на Glu;

замены Thr в положении 29 на заряженную аминокислоту;

замены Thr в положении 29 на заряженную аминокислоту, выбранную из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замены в положении 29 на Asp, Glu, или Lys;

замены в положении 29 на Glu;

вставки 1-3 заряженных аминокислот после положения 29;

вставки после положения 29 Glu или Lys;

вставки после положения 29 Gly-Lys или Lys-Lys, или их комбинации;

и по меньшей мере одну модификацию аминокислоты, выбранную из группы A или группы B, или их комбинации;

где группа A представляет собой модификацию аминокислоты, выбранную из группы, состоящей из замены Asp в положении 15 на Glu и замены Ser в положении 16 на Thr или AIB; и

где группа B представляет собой модификацию аминокислоты, выбранную из группы, состоящей из:

замены His в положении 1 на ненативную аминокислоту, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

замены Ser в положении 2 на ненативную аминокислоту, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

замены Tyr в положении 10 на Phe или Val;

замены Lys в положении 12 на Arg;

замены Gln в положении 20 на Ala или AIB;

замены Asp в положении 21 на Glu;

замены Gln в положении 24 на Ala или AIB;

замены Met в положении 27 на Leu или Nle;

делеции аминокислот в положениях 27-29;

делеции аминокислот в положениях 28-29;

делеции аминокислот в положениях 29;

или их комбинации;

и где указанный родственный глюкагону пептид обладает активностью агониста глюкагона;

(iii) родственный глюкагону пептид SEQ ID NO: 701, модифицированный, чтобы содержать:

(a) модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP,

(b) (1) лактамовый мостик между боковыми цепями аминокислот в положениях i и i+4 или между боковыми цепями аминокислот в положениях j и j+3, где i равно 12, 13, 16, 17, 20 или 24, и где j равно 17, или

(2) одна, две, три или все аминокислоты в положениях 16, 20, 21 и 24 аналога является замещенными α,α-двузамещенной аминокислотой,

(c) модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, и

(d) 1-6 дополнительных модификаций аминокислот,

где EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее;

(iv) последовательность X1X2X3GTFTSDX10SX12YLX15X16X17X18AX20X21FX23X24WLX27X28X29 (SEQ ID NO: 72), где

X1 выбран из группы, состоящей из His, D-His, (Des-амино)His, гидроксил-His, ацетил-His, гомо-His или альфа,альфа-диметилимидазолуксусной кислоты (DMIA), N-метил-His, альфа-метил-His и имидазолуксусной кислоты;

X2 выбран из группы, состоящей из Ser, D-Ser, Ala, D-Ala, Val, Gly, N-метил-Ser, аминоизомасляной кислоты (Aib) и N-метил-Ala;

X3 выбран из группы, состоящей из Gln, Glu, Orn и Nle;

X10 выбран из группы, состоящей из Tyr, Val и Trp;

X12 выбран из группы, состоящей из Ser, Lys, цитруллина, Orn и Arg;

X15 выбран из группы, состоящей из Asp, Glu, цистеиновой кислоты, гомоглутаминовой кислоты и гомоцистеиновой кислоты;

X16 выбран из группы, состоящей из Ser, Gly, Glu, Gln, гомоглутаминовой кислоты и гомоцистеиновой кислоты;

X17 выбран из группы, состоящей из Arg, Gln, Lys, Cys, Orn, гомоцистеина и ацетилфенилаланина;

X18 выбран из группы, состоящей из Arg, Ala, Lys, Cys, Orn, гомоцистеина и ацетилфенилаланина;

X20 выбран из группы, состоящей из Gln, Lys, Arg, Orn и цитруллина;

X21 выбран из группы, состоящей из Gln, Glu, Asp, Lys, Cys, Orn, гомоцистеина и ацетилфенилаланина;

X23 выбран из группы, состоящей из Val и Ile;

X24 выбран из группы, состоящей из Ala, Gln, Glu, Lys, Cys, Orn, гомоцистеина и ацетилфенилаланина;

X27 выбран из группы, состоящей из Met, Val, Leu и Nle;

X28 выбран из группы, состоящей из Asn, Arg, цитруллина, Orn, Lys и Asp;

и

X29 выбран из группы, состоящей из Thr, Gly, Lys, Cys, Orn, гомоцистеина и ацетилфенилаланина; или аналог SEQ ID NO: 72, где указанный аналог отличается от SEQ ID NO: 72 на 1-3 модификации аминокислот, выбранные из положений 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 24, 27, 28 и 29, где указанный родственный глюкагону пептид обладает по меньшей мере 20% активности нативного GLP-1 в отношении рецептора GLP-1;

(v) аминокислоту, которая отличается от SEQ ID NO: 701 не более, чем на десять модификаций аминокислот, содержащих одну или более замен аминокислот на AIB в положениях 16, 20, 21, и/или 24, и модификацию аминокислоты в положении 1 и/или 2, которая обеспечивает пониженную чувствительность к расщеплению дипептидилпептидазой IV, где указанный родственный глюкагону пептид обладает по меньшей мере 20% активности нативного GLP-1 в отношении рецептора GLP-1.

В одном из вариантов осуществления инсулиновый пептид конъюгата содержит A-цепь и B-цепь, где указанная A-цепь содержит последовательность GIVX4X5CCX8X9X10CX12LX14X15LX17X18YCX21-R13 (SEQ ID NO: 19), и указанная B-цепь содержит последовательность R22-X25LCGX29X30LVX33X34LYLVCGX41X42GLX45 (SEQ ID NO: 20), где:

X4 представляет собой глутаминовую кислоту или аспарагиновую кислоту;

X5 представляет собой глутамин или глутаминовую кислоту;

X8 представляет собой гистидин, треонин или фенилаланин;

X9 представляет собой серин, аргинин, лизин, орнитин или аланин;

X10 представляет собой изолейцин или серин;

X12 представляет собой серин или аспарагиновую кислоту;

X14 представляет собой тирозин, аргинин, лизин, орнитин или аланин;

X15 представляет собой глутамин, глутаминовую кислоту, аргинин, аланин, лизин, орнитин или лейцин;

X17 представляет собой глутаминовую кислоту, аспарагиновую кислоту, аспарагин, лизин, орнитин или глутамин;

X18 представляет собой метионин, аспарагин, глутамин, аспарагиновую кислоту, глутаминовую кислоту или треонин;

X21 выбран из группы, состоящей из аланина, глицина, серина, валина, треонина, изолейцина, лейцина, глутамина, глутаминовой кислота, аспарагина, аспарагиновой кислота, гистидина, триптофана, тирозина и метионина;

X25 представляет собой гистидин или треонин;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислоты и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X41 выбран из группы, состоящей из глутаминовой кислоты, аспарагиновой кислоты или аспарагина;

X42 выбран из группы, состоящей из аланина, орнитина, лизина и аргинина;

X45 представляет собой тирозин или фенилаланин;

R22 выбран из группы, состоящей из AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), трипептида глицин-пролин-глутаминовая кислота, трипептида валин-аспарагин-глутамин, дипептида пролин-глутаминовая кислота, дипептида аспарагин-глутамин, глутамина, глутаминовой кислоты и N-концевого амина; и

R13 представляет собой COOH или CONH2. В одном из вариантов осуществления конъюгат содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 132, SEQ ID NO: 135, SEQ ID NO: 139 и SEQ ID NO: 140, или ее аналог, который отличается от SEQ ID NO: 132, SEQ ID NO: 135, SEQ ID NO: 139 или SEQ ID NO: 140 на 1, 2, 3, 4 или 5 модификаций аминокислот. В одном из вариантов осуществления конъюгат содержит последовательность, которая отличается от SEQ ID NO: 132, SEQ ID NO: 135, SEQ ID NO: 139 или SEQ ID NO: 140 на 1, 2 или 3 замены аминокислоты.

В одном из вариантов осуществления конъюгат родственный глюкагону пептид-инсулин содержит гидрофильную группу, связанную с N-концевым альфа-амином B-цепи или с боковой цепью аминокислоты в положении, выбранном из группы, состоящей из A9, A14 и A15 A-цепи, или положениях B1, B2, B10, B22, B28 или B29 B-цепи, или с боковой цепью аминокислоты связывающей группы в одноцепочечном аналоге инсулина. Альтернативно, или кроме того, гидрофильную группу можно связывать с родственным глюкагону пептидом в любом из положений аминокислот 19, 20, 23, 24, 27, 32, 43 или C-концевой области.

В одном из вариантов осуществления гидрофильная группа представляет собой полиэтиленовую цепь, и в дополнительном варианте осуществления полиэтиленовая цепь ковалентно связана с боковой цепью аминокислоты связывающей группы компонента инсулинового пептида, где инсулиновый пептид представляет собой одноцепочечный аналог инсулина. В одном из вариантов осуществления инсулиновый пептид представляет собой одноцепочечный инсулин, где связывающая группа, соединяющая B- и A-цепи, содержит аминокислотную последовательность длиной не более 17 аминокислот, и содержащую последовательность GYGSSSX57X58 (SEQ ID NO: 21), GAGSSSRR (SEQ ID NO: 22) или GYGSSSX57X58APQT; (SEQ ID NO: 69), где X57 и X58 независимо представляют собой аргинин, лизин или орнитин, и аминокислота, обозначаемая X57 или X58, необязательно дополнительно содержит гидрофильную группу, связанную с боковой цепью аминокислоты в этом положении. В одном из вариантов осуществления гидрофильная группа представляет собой цепь полиэтиленгликоля.

Ацилирование или алкилирование может увеличивать время полужизни пептидов конъюгатов родственного глюкагону пептида-инсулин в кровяном русле. Ацилирование или алкилирование может преимущественно замедлять начало активации и/или увеличивать продолжительность действия на инсулиновые рецепторы. Пептиды конъюгаты родственный глюкагону пептид-инсулин можно подвергать ацетилированию или алкилированию в том же положении аминокислоты, в которой связана гидрофильная группа (включая, например, в положении 8 связывающей группы), или в другом положении аминокислоты.

Также настоящее изобретение относится к фармацевтическим композициям, содержащим конъюгаты родственный глюкагону пептид-инсулин и фармацевтически приемлемый носитель. Один из вариантов осуществления относится к фармацевтической композиции, содержащей любые конъюгаты родственного глюкагону пептида-инсулин, описываемые в настоящее описание предпочтительно с уровнем чистоты по меньшей мере 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%, и фармацевтически приемлемый разбавитель, носитель или эксципиент. Такие композиции могут содержать одноцепочечный пептид-агонист инсулина, как описано в настоящем описании, в концентрации по меньшей мере 0,5 мг/мл, 1 мг/мл, 2 мг/мл, 3 мг/мл, 4 мг/мл, 5 мг/мл, 6 мг/мл, 7 мг/мл, 8 мг/мл, 9 мг/мл, 10 мг/мл, 11 мг/мл, 12 мг/мл, 13 мг/мл, 14 мг/мл, 15 мг/мл, 16 мг/мл, 17 мг/мл, 18 мг/мл, 19 мг/мл, 20 мг/мл, 21 мг/мл, 22 мг/мл, 23 мг/мл, 24 мг/мл, 25 мг/мл или выше. В одном из вариантов осуществления фармацевтические композиции содержат водные растворы, которые стерилизуют и необязательно хранят в различных упаковочных контейнерах. В других вариантах осуществления фармацевтические композиции содержат лиофилизированный порошок. Фармацевтические композиции можно дополнительно упаковывать в виде части набора, который содержит одноразовое устройство для введения композиции пациенту. Контейнеры или наборы можно помечать для хранения при нормальной комнатной температуре или при температуре охлаждения.

Один из вариантов осуществления относится к улучшенному способу регуляции уровней глюкозы в крови у инсулинзависимых пациентов. Способ включает стадии введения пациенту одноцепочечного пептида агониста инсулина или его производного в количестве, терапевтически эффективном для борьбы с диабетом.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фиг. 1. представляет собой схематическое описание стратегии получения инсулина человека на основе двухстадийного синтеза. Подробное описание способа приведено в примере 1.

Фиг. 2 представляет собой график, сравнивающий специфическое связывание инсулинового рецептора синтетическим инсулином человека относительно очищенного нативного инсулина. Синтетический инсулин получали подходом, подробно описанным на фигуре 1, где связь A7-B7 является первой образующейся дисульфидной связью. Две молекулы обладают сходными активностями связывания, на что указывает представленные на графике данные.

Фиг. 3 представляет собой график, сравнивающий относительное связывание инсулинового рецептора с нативным инсулином и с аналогом инсулина A19 (инсулин(p-NH2-F)19). Две молекулы обладают сходными активностями связывания, на что указывает представленные на графике данные.

Фиг. 4 представляет собой график, сравнивающий относительное связывание инсулинового рецептора с нативным инсулином и аналогом IGF1(YB16LB17). Две молекулы обладают сходными активностями связывания, на что указывает представленные на графике данные.

Фиг. 5 представляет собой выравнивание аминокислотных последовательностей проинсулина человека (A-цепь, SEQ ID NO: 1; B-цепь, SEQ ID NO: 2 и C-цепь, SEQ ID NO: 141) и инсулиноподобных факторов роста I и II (IGF I; SEQ ID NO: 3 и IGF II; SEQ ID NO: 4). Выравнивание демонстрирует, что эти три пептиды обладают высоким уровнем идентичности последовательности (* означает участок с несоответствующей аминокислотой, и прочерк (-) означает аминокислоту, идентичную аминокислоте, содержащейся в инсулине).

На фиг. 6 представлена последовательность набора слитых пептидов GLP1 и глюкагона, образуемых с одноцепочечным аналогом инсулина. Более конкретно, предоставлены последовательности, демонстрирующие конъюгат GLP-1-инсулин (GLP1-DP8; SEQ ID NO: 132) и конъюгат глюкагон-инсулин (Glu-DP8; SEQ ID NO: 135). Предоставлены дополнительные модификации этих двух последовательностей, где 1) тирозин в положении A19 заменяют аланином, чтобы эффективно подавлять активность инсулина: Ala19 A-цепь GLP-инсулин (GLP1-DP8A19; SEQ ID NO: 133) и Ala19 A-цепь глюкагон-инсулин (Glu-DP8A19; SEQ ID NO: 136)); 2) фенилаланин в положении 22 заменяют аланином, чтобы эффективно подавлять активность GLP-1: Ala22 GLP1 (SEQ ID NO: 134)); 3) глутамин в положении 3 на глутаминовую кислоту для подавления активности глюкагона (E3 глюкагон; SEQ ID NO: 137) и 4) замена серина в положении 16 глутаминовой кислотой для придания активности GLP-1 и глюкагона (E16 глюкагон (SEQ ID NO: 138)).

На фиг. 7 представлены значения EC50 хроматографически выделенных объединенных фракций синтезированного конъюгата GLP1-DP8 для рецепторов инсулина и GLP1 относительно нативного инсулина, IGF-1 и нативного глюкагона. Структура конъюгата GLP1-DP8 представлена на фиг. 6. Совокупность 1 демонстрировала практически такую же активность как нативный инсулин в отношении инсулинового рецептора. Все три совокупности демонстрировали высокую активность по отношению к рецептору GLP1. Таким образом, конъюгат совокупности 1 демонстрирует такую же высокую активность, как нативный инсулин и нативный GLP1 по отношению к своим двум соответствующим рецепторам.

На фиг. 8 представлены значения EC50 хроматографически выделенных объединенных фракций синтезированного конъюгата Glu-DP8 для рецепторов инсулина, глюкагона и GLP1 относительно нативного инсулина, IGF-1 и нативного глюкагона. Структура конъюгата Glu-DP8 представлена на фиг. 6. Совокупность 1 демонстрирует такую же активность как нативный инсулин в отношении инсулинового рецептора, где наличие последовательности глюкагона снижает активность конъюгата в отношении инсулинового рецептора. Совокупности 1 и 3 демонстрировали высокую активность в отношении рецептора глюкагона. Все три совокупности демонстрируют слабую активность в отношении рецептора GLP-1. Таким образом, конъюгат совокупности 1 демонстрирует высокую активность в отношении рецептора инсулина и глюкагона, но сохраняя селективность по отношению к рецептору GLP1.

На фиг. 9A-9C продемонстрирован эффект in vivo нативного инсулина и конъюгатов Glu-DP8 и GLP1-DP8 на уровни глюкозы в крови. Мышам подкожно инъецировали нативный инсулин (фиг. 9A) в двух дозах (12 нмоль/кг или 60 нмоль/кг) или один из конъюгатов GLP1-DP8 (фиг. 9B) или Glu-DP8 (фиг. 9C), вводимых в трех различных концентрациях (12 нмоль/кг, 60 нмоль/кг и 300 нмоль/кг). Для конъюгатов демонстрировали менее резкое падение уровня глюкозы в крови и большее время полужизни, чем для нативного инсулина (большая положительность действия). Кроме того GLP1-DP8 (фиг. 9B) являлся более активным в отношении снижения уровня глюкозы, чем Glu-DP8 (фиг. 9C), полагают, что это обусловлено гашением глюкагоном активности инсулина.

На фиг. 10 представлена активность in vitro GLP1-DP8 и GLP1-DP8A19 (GLP1-DP8, где положение 19 A-цепи инсулина модифицировали на аланин) в отношении инсулинового рецептора. Замена аланин в положении A19 эффективно подавляет активность инсулина в отношении инсулинового рецептора. Значения EC50 указывают на то, что инсулин и GLP1-DP8 являются эффективными агонистами инсулинового рецептора, при этом GLP-1 и GLP1-DP8A19 обладают слабой активностью в отношении инсулинового рецептора.

На фиг. 11 представлена активность по отношению к инсулиновому рецептору in vitro (значения EC50) Glu-DP8 и Glu-DP8A19, конъюгата глюкагон-инсулин, модифицированного так, чтобы подавлять активность глюкагона (GluE3-DP8; где положение 3 пептида глюкагона модифицировали до глутаминовой кислоты), и модификация, которая сохраняет активность в отношении рецептора глюкагона (GluE16-DP8; где положение 16 модифицировали до глутаминовой кислоты). Известно, что замена глутаминовой кислоты в положении 3 глюкагона эффективно подавляет активность глюкагона. Известно, что замена аланина в положении A19 инсулина эффективно подавляет активность инсулина по отношению к инсулиновому рецептору. Значения EC50 указывают на то, что инсулин и Glu-DP8 являются эффективными агонистами инсулинового рецептора, при этом глюкагон и Glu-DP8A19 обладают слабой активностью в отношении инсулинового рецептора. GluE3-DP8 и GluE16-DP8 также обладали высокой активностью в отношении инсулинового рецептора.

На фиг. 12 представлена активность по отношению к рецептору глюкагона in vitro (значения EC50) Glu-DP8, GluE3-DP8 и GluE16-DP8, Glu-DP8A19 и GLP-1-DP8. Известно, что замена глутаминовой кислоты в положении 3 глюкагона эффективно подавляет активность глюкагона, и известно, что замена аланина в положении A19 инсулина эффективно подавляет активность инсулина в отношении инсулинового рецептора. Заменой глутаминовой кислоты в положении 16 глюкагона получают коагонист глюкагона и GLP-1. Значения EC50 указывают на то, что глюкагон, Glu-DP8 и GluE16-DP8 являются эффективными агонистами рецептора глюкагона, при этом GLP-1 и GLP1-DP8 и GluE3-DP8 обладают слабой активностью в отношении рецептора глюкагона. Таким образом, конъюгаты обладают ожидаемыми видами активности.

На фиг. 13 представлена активность в отношении рецептора GLP-1 in vitro (значения EC50) GLP-1, GLP-1-DP8, GLP-1 A22-DP8, GLP-1-DP8A19, Glu-DP8 и GluE16-DP8. GLP-1A22-DP8 представляет собой конъюгат инсулина и GLP-1, где положение 22 заменяли аланином, модификация, для которой известно что она эффективно подавляет активность GLP-1. Значения EC50 указывают на то, что GLP-1, GLP1-DP8 и GLP1-DP8A19 являются эффективными агонистами рецептора GLP-1, при этом GLP-1 A22-DP8, Glu-DP8 и GluE16-DP8 обладают слабой активностью в отношении рецептора GLP-1. Таким образом, конъюгаты обладают ожидаемыми видами активности.

На фиг. 14A-14B представлен эффект in vivo перечисленных конъюгатов на уровни глюкозы в крови на мышах C57BL/6, которым вводили DP8 (фиг. 14A) или GLP1-DP8A19 (фиг. 14B) в сравнении с нативным инсулином. DP8 или GLP1-DP8A19 вводили в двух концентрациях (60 нмоль/кг или 300 нмоль/кг). DP8 эффективно снижал уровень глюкозы в крови, тогда как GLP1-DP8A19 оказался неспособным значительно снижать уровни глюкозы в крови.

На фиг. 15A-15C представлен эффект in vivo перечисленных конъюгатов на уровни глюкозы в крови на мышах C57BL/6, которым вводили Glu-DP8A19 (фиг. 15A) или GLP1A22-DP8 (фиг. 15B), или GluE3/DP8 (фиг. 15C) в сравнении с нативным инсулином. Конъюгат Glu-DP8A19 не обладает активностью инсулина, однако индуцирует снижение уровня глюкозы в крови in vivo обусловленное стимулируемой глюкагоном секрецией инсулина. GLP1A22-DP8 обладает пониженной активностью глюкагона в результате замены в положении 22, однако инсулиновый компонент конъюгата обеспечивает снижающую уровень глюкозы в крови активность, таким образом, что конъюгат обладает приблизительно одной пятнадцатой активностью инсулина. GluE3/DP8 обладает сниженной активностью глюкагона вследствие замены в положении E3, однако конъюгат обладает снижающей уровень глюкозы активностью, которая является незначительно сниженной относительно нативного инсулина.

ПОДРОБНОЕ ОПИСАНИЕ

ОПРЕДЕЛЕНИЯ

В описании и заявлении изобретения используют следующие ниже терминологию в соответствии с указанными ниже определениями.

В настоящем описании, термин "приблизительно" означает больше или меньше чем значение или диапазон значений, определяемый 10 процентами, но не предназначен обозначать какое-либо значение или диапазон значений только в рамках такого более широкого определения. Каждое значение или диапазон значений, перед которым используют термин "приблизительно", также предназначено включать вариант осуществления указываемой абсолютной величины или диапазона значений.

В настоящем описании, термин "аминокислота" включает любую молекулу, содержащую функциональные аминогруппу и карбоксильную группы, где аминогруппа и карбоксилатная группа присоединены к одному и тому же углероду (альфа-углероду). Альфа-углерод необязательно может содержать один или два дополнительных органических заместителя. Для целей настоящего изобретения обозначение аминокислоты без указания ее стереохимии предназначено включать L- или D-форму аминокислоты или рацемическую смесь. Однако в случае, когда аминокислоту обозначают ее трехбуквенным кодом и указывают номер индекса, D-форма аминокислоты обозначают введением d строчной буквой перед трехбуквенным кодом и числом в верхнем индексе (например, dLys-1), где обозначение без стройной буквы d (например, Lys-1) предназначено указывать нативную L-форму аминокислоты. В этой номенклатуре введение числа в верхнем индексе указывает на положение аминокислоты в последовательности аналога инсулина, где аминокислоты, которые располагаются в последовательности аналога инсулина, обозначают положительными числами в верхнем регистре последовательно с N-конца. Дополнительные аминокислоты, связанные с пептидом аналогом инсулина на N-конце или через боковую цепь, нумеруют, начиная с 0 и увеличивая отрицательное числовое значение по мере того, как их дополнительно удаляют из последовательности аналога инсулина.

В настоящем описании, термин "гидроксильная кислота" относится к аминокислотам, которые модифицировали с заменой аминогруппы альфа-углерода гидроксильной группой.

В настоящем описании, термин "некодируемая аминокислота" включает любую аминокислоту, которая не является L-изомером любой из следующих ниже 20 аминокислот: Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Gln, Arg, Ser, Thr, Val, Trp, Tyr.

"Биоактивный полипептид" относится к полипептидам, которые способны проявлять биологическое действие in vitro и/или in vivo.

В настоящем описании, общая ссылка на пептид предназначена включать пептиды, которые содержат модифицированные амино- и карбокси-концы. Например, аминокислотная последовательность, обозначающая стандартные аминокислоты, предназначена включать стандартные аминокислоты на N- и C-конце, а также соответствующую гидроксильную кислоту на N-конце и/или соответствующую C-концевую аминокислоту, модифицированную так, чтобы содержать амидную группу вместо концевой карбоновой кислоты.

В настоящем описании, "ацилированная" аминокислота представляет собой аминокислоту, содержащую ацильную группу, которая не является нативной для природной аминокислоты, независимо от способа, которым ее получают. Иллюстративные способы получения ацилированных аминокислот и ацилированных пептидов известны в данной области и включают ацилирование аминокислот перед введением в пептид или пептидный синтез с последующим химическим ацилированием пептида. В некоторых вариантах осуществления ацильная группа приводит к тому, что пептид обладает одним или более из (i) пролонгированного времени полувыведения из кровотока, (ii) замедленного начала действия, (iii) увеличенной продолжительностью действия, (iv) улучшенной устойчивостью к протеазам, таким как DPP-IV, и (v) повышенной активностью по отношению к рецепторам IGF и/или рецепторам инсулинового пептида.

В настоящем описании, "алкилированная" аминокислота представляет собой аминокислоту, содержащую алкильную группу, которая не является нативной для природной аминокислоты, независимо от способа, которым ее получают. Иллюстративные способы получения алкилированных аминокислот и алкилированных пептидов известны в данной области и включают алкилирование аминокислоты перед введением в пептид или пептидный синтез с последующим химическим алкилированием пептида. Не придерживаясь какой-либо конкретной теории, полагают, что алкилированием пептидов получают аналогичные, если не такие же эффекты, как ацилированием пептидов, например, пролонгированное время полувыведения из кровотока, замедленное начало действия, увеличенная продолжительность действия, улучшенная устойчивость к протеазам, таким как DPP-IV, и повышенная активность в отношении рецептора IGF и/или инсулинового рецептора.

В настоящем описании, термин "фармацевтически приемлемый носитель" включает любой из стандартных фармацевтических носителей, таких как забуференный фосфатом физиологический раствор, вода, эмульсии, такие как эмульсия типа масло/вода или вода/масло, и различные типы средств для смачивания. Термин также включает любое из средств, одобренных регулирующим органом федерального правительства США или перечисленных в фармакопее США для применения у животных, включая людей.

В настоящем описании, термин "фармацевтически приемлемая соль" относится к соли соединений, которые сохраняют биологическую активность исходного соединения, и которые не являются нежелательным с биологической точки зрения или иным образом. Многие из соединений, описываемых в настоящем описании, способны образовывать соли с кислотами и/или основаниями вследствие наличия аминогрупп и/или карбоксильных групп или аналогичных им групп.

Фармацевтически приемлемые соли присоединения с основаниями можно получать из неорганических и органических оснований. Соли, получаемые из неорганических оснований, включают, только в качестве примера, соли натрия, калия, лития, аммония, кальция и магния. Соли, получаемые из органических оснований, включают, но не ограничиваются ими, соли первичных, вторичных и третичных аминов.

Фармацевтически приемлемые соли присоединения с кислотами можно получать из неорганических и органических кислот. Соли, получаемые из неорганических кислот, включают соляную кислоту, бромистоводородную кислоту, серную кислоту, азотную кислоту, фосфорную кислоту и т.п. Соли, получаемые из органических кислот, включают уксусную кислоту, пропионовую кислоту, гликолевую кислоту, пировиноградную кислоту, щавелевую кислоту, яблочную кислоту, малоновую кислоту, янтарную кислоту, малеиновую кислоту, фумаровую кислоту, винную кислоту, лимонную кислоту, бензойную кислоту, коричную кислоту, миндальную кислоту, метансульфоновую кислоту, этансульфоновую кислоту, пара-толуолсульфоновую кислоту, салициловую кислоту и т.п.

В настоящем описании, термин "гидрофильная группа" относится к любому соединению, которое является легко водорастворимым или легко абсорбирует воду, и которые являются переносимыми in vivo видами млекопитающих без токсических эффектов (т.е. являются биосовместимыми). Примеры гидрофильных групп включают полиэтиленгликоль (PEG), полимолочную кислоту, полигликолевую кислоту, сополимер полимолочной-полигликолевой кислоты, поливиниловый спирт, поливинилпирролидон, полиметоксазолин, полиэтилоксазолин, полигидроксиэтилметакрилат, полигидроксипропилметакриламид, полиметакриламид, полидиметилакриламид и виды дериватизированной целлюлозы, такие как гидроксиметилцеллюлоза или гидроксиэтилцеллюлоза и их сополимеры, а также природные полимеры, включая, например, альбумин, гепарин и декстран.

В настоящем описании, термин "лечение" включает профилактику конкретного нарушения или состояния, или ослабление симптомов, ассоциированных с конкретным нарушением или состоянием, и/или профилактику или устранение указанных симптомов. Например, в настоящем описании, термин "лечение диабета" относится в основном к поддержанию уровней глюкозы в кровы близко к нормальным уровням и может включать повышение или снижение уровней глюкозы в крови в зависимости от данной ситуации.

В настоящем описании, "эффективное" количество или "терапевтически эффективное количество" аналога инсулина относится к нетоксичному, но достаточному количеству аналога инсулина для обеспечения желательного действия. Например, одним из желательных действий является профилактика или лечение гипергликемии. Количество, которое является "эффективным" изменяется от индивидуума к индивидууму в зависимости от возраста и общего состояния индивидуума, способа введения и т.п.

Таким образом, не всегда является возможным указывать точное "эффективное количество". Однако специалист в данной области можно определять подходящее "эффективное" количество в любом отдельном случае с использованием общепринятого экспериментирования.

Термин "парентеральный" означает не через желудочно-кишечный тракт, а некоторым другим путем, таким как интраназальный, ингаляция, подкожным, внутримышечным, интраспинальным или внутривенным.

На всем протяжении заявки все ссылки на конкретное положение аминокислот посредством буквенного и числового обозначения (например, положение A5) относятся к аминокислоте в этом положении A-цепи (например, положении A5) или B-цепи (например, положении B5) в соответствующей нативной A-цепи инсулин человека (SEQ ID NO: 1) или B-цепи (SEQ ID NO: 2), или соответствующему положению аминокислоты в любых его аналогах. Например, ссылка в настоящем описании на "положении B28" при отсутствии дополнительного уточнения означает соответствующее положение B27 B-цепи аналога инсулина, в котором удалили первую аминокислоту SEQ ID NO: 2. Аналогично, аминокислоты, добавляемые к N-концу нативной B-цепи, нумеруют, начиная с B0 с последующим указанием чисел увеличения отрицательного значения (например, B-1, B-2…), т.к. аминокислоты добавляют к N-концу. Альтернативно, любую ссылку на положение аминокислоты в связывающей группе одноцепочечного аналога приводят по отношению к нативной C-цепи IGF 1 (SEQ ID NO: 17). Например, положение 9 нативной C-цепи (или "положение C9") содержит остаток аланина.

В настоящем описании, термин "нативный инсулиновый пептид" предназначен обозначать гетеродуплекс длиной 51 аминокислота, содержащий A-цепь SEQ ID NO: 1 и B-цепь SEQ ID NO: 2, а также одноцепочечные аналоги инсулина, которые содержат SEQ ID NO: 1 и 2. В настоящем описании, термин "инсулиновый пептид" при отсутствии дополнительных описательных формулировок предназначен включать гетеродуплекс длиной 51 аминокислота, содержащий A-цепь SEQ ID NO: 1 и B-цепь SEQ ID NO: 2, а также его одноцепочечные аналоги инсулина (включая, например, такие, как описанные в опубликованной международной заявке WO96/34882 и патенте США № 6630348, описания которых включено в настоящее описание посредством ссылки), включая гетеродуплексы и одноцепочечные аналоги, которые содержат модифицированные аналоги нативной A-цепи и/или B-цепи, и их производные. Такие модифицированные аналоги содержат модификацию аминокислоты в положении A19, B16 или B25 до 4-аминофенилаланина или одну или более замен аминокислот в положениях, выбранных из A5, A8, A9, A10, A12, A14, A15, A17, A18, A21, B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 и B30, или делеции любого или всех положений B1-4 и B26-30. Как определено в настоящем описании, инсулиновые пептиды также может представлять собой аналоги, получаемые из природного инсулина вставкой или заменой непептидной группы, например, ретро-инвертированного фрагмента, или вставкой непептидных связей, таких как азапептидная связь (замена CO на NH) или псевдопептидная связь (например, NH замещенный CH2), или сложноэфирная связь (например, депсипептид, где одну или более амидных (-CONHR-) связей заменяют сложноэфирными (COOR) связями).

"Аналог инсулина A19" представляет собой инсулиновый пептид, который содержит замену 4-аминофенилаланина или 4-метоксифенилаланина нативного остатка тирозина в положении 19 A-цепи нативного инсулина.

В настоящем описании, "аналог пептида IGFB16B17" представляет собой родовой термин, который включает гетеродуплекс A-цепи и B-цепи, а также его одноцепочечные аналоги инсулина, где A-цепь содержит пептидную последовательность SEQ ID NO: 19 и B-цепь содержит последовательность SEQ ID NO: 20, а также аналоги этих последовательностей, где аналог A-цепи и/или B-цепь содержит 1-3 дополнительные замены аминокислот при условии, что B-цепь не содержит последовательность SEQ ID NO: 2 и содержит тирозин в положении B16 и лейцин в положении B17.

"Аналог IGF YL" представляет собой пептид, содержащий A-цепь IGF SEQ ID NO: 19 и B-цепь IGF SEQ ID NO: 36.

В настоящем описании, термин "одноцепочечный аналог инсулина" включает группу структурно родственных белков, где A- и B-цепи инсулина или IGF, или их аналоги или производные являются ковалентно связанными друг с другом с образованием линейной полипептидной цепи. Как описывают в настоящем описании, одноцепочечный аналог инсулина содержит ковалентную связь C-конца B-цепи с амино-концом A-цепи через связывающую группу.

В настоящем описании, термин "A-цепь инсулина" при отсутствии дополнительных описательных формулировок предназначен включать последовательность длиной 21 аминокислота SEQ ID NO: 1, а также ее функциональные аналоги и производные, включая A-цепь аналогов инсулина A19 и другие аналоги, известные специалистам в данной области, включая модификацию последовательности SEQ ID NO: 1 посредством одной или более вставок, делеций или замен аминокислот в положениях, выбранных из A4, A5, A8, A9, A10, A12, A14, A15, A17, A18, A21.

В настоящем описании, термин "B-цепь инсулина" при отсутствии дополнительных описательных формулировок предназначен включать последовательность длиной 30 аминокислот SEQ ID NO: 2, а также модифицированные функциональные аналоги нативной B-цепи, включая модификацию аминокислоты в положении B16 или B25 до 4-аминофенилаланина или одну или более вставок, делеций или замен аминокислот в положениях, выбранных из B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B25, B26, B27, B28, B29 и B30, или делеции любого или всех положений B1-4 и B26-30.

В настоящем описании, термин "идентичность" относится к сходству два или более последовательностей. Идентичность измеряют путем деления числа идентичных остатков на общее число остатков и умножением результата на 100 с получением процента. Таким образом, два копии абсолютно одинаковой последовательности обладают 100% идентичностью, тогда как две последовательности, которые содержат делеции, добавления или замены аминокислот относительно другу друга, обладают меньшей степенью идентичности. Специалистам в данной области понятно, что для определения идентичности последовательности доступными являются несколько компьютерных программ, таких как программы, в которых применяют алгоритмы, такие как BLAST (Basic Local Alignment Search Tool, Altschul et al., (1993) J. Mol. Biol., 215:403-410).

Термин "родственный глюкагону пептид" относится к таким пептидам, которые обладают биологической активностью (т.е. агонистам или антагонистам) в отношении любого одного или более рецепторов глюкагона, GLP-1, GLP-2 и GIP и содержат аминокислотную последовательность, которая обладает по меньшей мере 40% идентичностью последовательности (например, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%) по меньшей мере с одним из нативного глюкагона, нативного оксинтомодулина, нативного экзендина-4, нативного GLP-1, нативного GLP-2 или нативного GIP. Если не указано иное, любая ссылка на положение аминокислоты в родственном глюкагону пептиде (например, для связи группы пролекарства, конъюгатной группы, гидрофильного полимера, ацилирования или алкилирования) относится к положению относительно нативной аминокислотной последовательности глюкагона (SEQ ID NO: 701).

В настоящем описании, ссылка на C-концевую область родственного глюкагону пептида предназначена включать нативный C-конец пептида глюкагона или любую аминокислоту удлинения C-конца аналога глюкагона, который удлиняли добавлением одной или более аминокислот к C-концу, или концевую аминокислоту аналога глюкагона, который укорачивали делецией одной или более аминокислот, соответственно, относительно нативной последовательности глюкагона. Инсулиновый пептид, конъюгированный с C-концевой областью родственного глюкагону пептида, предназначен включать связь с боковой цепью аминокислоты C-концевой области или связь через C-концевую группу карбоновой кислоты.

Термин "агонист GLP-1" относится к соединению, которое стимулирует активность рецептора GLP-1, как измеряют по продукции цАМФ с использованием подтвержденного анализа на модели in vitro, такого как анализ, описанный в примере 13 опубликованной международной заявки № WO 2007/056362, опубликованной 18 мая 2007 года, таким образом, описание которой явно включено посредством ссылки в настоящую заявку.

В настоящем описании, термин "нативный глюкагон" относится к пептиду, состоящему из последовательности SEQ ID NO: 701, термин "нативный GIP" относится к пептиду, состоящему из последовательности SEQ ID NO: 707, и термин "нативный GLP-1" представляет собой родовой термин, который обозначает амид GLP-1(7-36) (состоящий из последовательности SEQ ID NO: 703), кислоту GLP-1(7-37) (состоящую из последовательности SEQ ID NO: 704) или смесь этих двух соединений. В настоящем описании, общая ссылка на "глюкагон" или "GIP" или "GLP-1" при отсутствии какого-либо дополнительного обозначения предназначена означать нативный глюкагон или нативный GIP или нативный GLP-1, соответственно.

В настоящем описании, термин "пептид глюкагона" представляет собой родовой термин, который обозначает природный пептид глюкагона SEQ ID NO: 701, а также модифицированные производные, содержащие одну или более модификаций аминокислот относительно нативной последовательности глюкагона, необязательно включая, но, не ограничиваясь ими, замены в положениях аминокислот 1, 2, 5, 7, 8, 10, 12, 13, 14, 16, 17, 18, 24, 28 и 29. Как правило, все ссылки на конкретное положение аминокислоты посредством числового обозначения (например, положение 28) относятся к аминокислоте в этом положении в нативном глюкагоне (SEQ ID NO: 701) или соответствующему положению аминокислоты в любых его аналогах. Например, ссылка на "положение 28" означает соответствующее положение 27 для аналога глюкагона, в котором удаляли первую аминокислоту SEQ ID NO: 701. Аналогично, ссылка на "положение 28" означает соответствующее положение 29 для аналога глюкагона, в котором одну аминокислоту добавляли перед N-концом SEQ ID NO: 701.

В настоящем описании, термин "GLP-1 пептид" представляет собой родовой термин, который означает нативный GLP-1, а также модифицированные производные, содержащие одну или более модификаций аминокислот относительно нативной последовательности GLP-1.

В настоящем описании, термин "производное" предназначен включать химическую модификацию соединения (например, аминокислоты), включая химическую модификацию in vitro, например, введением группы в боковую цепь в одном или более положений полипептида, например, нитрогруппы в остаток тирозина или йод в остаток тирозина, или преобразованием свободной карбоксильной группы в сложноэфирную группу или в амидную группу или преобразованием аминогруппы в амид ацилированием, или ацилированием гидроксигруппы, получая сложный эфир, или алкилированием первичного амина, получая вторичный амин, или связь гидрофильной группы с боковой цепью аминокислоты. Другие производные получают окислением или восстановлением боковых цепей аминокислотных остатков в полипептиде.

В настоящем описании, термин A-цепь IGF при отсутствии дополнительных описательных формулировок предназначен включать последовательность длиной 21 аминокислота нативного IGF 1 или IGF 2 (SEQ ID NО: 5 и 7 соответственно), а также их функциональные аналоги, известные специалистам в данной области, включая модификацию последовательности SEQ ID NO: 5 и 7 одной или более замен аминокислот в положениях, выбранных из A5, A8, A9, A10, A12, A14, A15, A17, A18, A21.

В настоящем описании, термин "B-цепь IGF YL" при отсутствии дополнительных описательных формулировок предназначен включать аминокислотную последовательность, содержащую SEQ ID NO: 20, а также аналоги B-цепи IGF YL и ее производные, включая модификацию аминокислоты в положении B16 или B25 до 4-аминофенилаланина или одну или более замен аминокислот в положениях, выбранных из B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 и B30 или делеции любого или всех положений B1-4 и B26-30.

В настоящем описании, термин "селективность" молекулы к первому рецептору относительно второго рецептора относится к следующему отношению: EC50 молекулы для второго рецептора, деленной на EC50 молекулы для первого рецептора. Например, молекула, которая обладает EC50 1 нМ для первого рецептора и EC50 100 нМ для второго рецептора, обладает селективностью в 100 раз большей для первого рецептора относительно второго рецептора.

В настоящем описании, "модификация" аминокислоты относится к замене аминокислоты или дериватизации аминокислоты добавлением и/или удалением химических группы к/из аминокислоты и включает замену на любую из 20 аминокислот, общепринято встречающихся в белках человека, а также нетипичных или неприродных аминокислот. Коммерческие источники нетипичных аминокислот включают Sigma-Aldrich (Milwaukee, WI), ChemPep Inc. (Miami, FL) и Genzyme Pharmaceuticals (Cambridge, MA). Нетипичные аминокислоты можно приобретать от коммерческих поставщиков, синтезировать de novo или химически модифицировать или дериватизировать из природных аминокислот.

В настоящем описании, "замена" аминокислоты относится к замене одного аминокислотного остатка другим аминокислотным остатком.

В настоящем описании, термин "консервативная аминокислотная замена" определяют в настоящее описание как замены в пределах одной из следующих пяти групп:

I. Небольшие алифатические, неполярные или слабополярные полярные остатки:

Ala, Ser, Thr, Pro, Gly;

II. Полярные, отрицательно заряженные остатки и их амиды:

Asp, Asn, Glu, Gln, цистеиновая кислота и гомоцистеиновая кислота;

III. Полярные, положительно заряженные остатки:

His, Arg, Lys; орнитин (Orn)

IV. Большие, алифатические, неполярные остатки:

Met, Leu, Ile, Val, Cys, норлейцин (Nle), гомоцистеин

V. Большие, ароматические остатки:

Phe, Tyr, Trp, ацетилфенилаланин

В настоящем описании, общий термин "цепь полиэтиленгликоля" или "цепь PEG" относится к смеси конденсационных полимеров этиленоксида и воды в разветвленной или неразветвленной цепи, представленных общей формулой H(OCH2CH2)nOH, где n равно по меньшей мере 2. "Цепь полиэтиленгликоля" или "цепь PEG " используют в комбинации с численным суффиксом для обозначения их приблизительной средней молекулярной массы. Например, PEG-5000 относится к цепи полиэтиленгликоля с общей молекулярной массой в среднем приблизительно 5000 Дальтон.

В настоящем описании, термин "пегилированный" и подобные термины относятся к соединению, нативное состояния которого модифицировали путем присоединения цепи полиэтиленгликоля к соединению. "Пегилированный полипептид" представляет собой полипептид, который содержит цепь PEG, ковалентно связанную с полипептидом.

В настоящем описании, "линкер" представляет собой связь, молекулу или группу молекул, которые связывают два отдельных соединения друг с другом. Линкеры могут обеспечивать оптимальное пространственное разделение двух соединений или могут дополнительно обеспечивать лабильную связь, которая позволяет двум соединениям находиться раздельно друг от друга. Лабильные связи включают фоторазрушаемые группы, кислотолабильные группы, щелочно-лабильные группы и расщепляемые ферментом группы.

В настоящем описании, "димер" представляет собой комплекс, содержащий две субъединицы, ковалентно связанные друг с другом через линкер. Термин «димер» при использовании без каких-либо уточняющих формулировок включает гомодимеры и гетеродимеры. Гомодимер содержит две идентичные субъединицы, тогда как гетеродимер содержит две субъединицы, которые отличаются, хотя две субъединицы являются по существу подобным друг другу.

В настоящем описании, термин "C1-Cnалкил", где n может составлять от 1 до 6, означает разветвленную или линейную алкильную группу, содержащую от одного до указанного числа атомов углерода. Характерные C1-C6алкильные группы включают, но не ограничиваются ими, метил, этил, н-пропил, изопропил, бутил, изобутил, сек-бутил, трет-бутил, пентил, гексил и т.п.

В настоящем описании, термин "C2-Cnалкенил", где n может составлять от 2 до 6, означает олефиновую ненасыщенную разветвленную или линейную группу, содержащую от 2 до указанного числа атомов углерода и по меньшей мере одну двойную связь. Примеры таких групп включают, но не ограничиваются ими, 1-пропенил, 2-пропенил (-CH2-CH=CH2), 1,3-бутадиенил, (-CH=CHCH=CH2), 1-бутенил(-CH=CHCH2CH3), гексенил, пентенил и т.п.

Термин "C2-Cnалкинил", где n может составлять от 2 до 6, относится к ненасыщенной разветвленной или линейной группе, содержащей от 2 до n атомов углерода и по меньшей мере одну тройную связь. Примеры таких групп включают, но не ограничиваются ими, 1-пропинил, 2-пропинил, 1-бутинил, 2-бутинил, 1-пентинил и т.п.

В настоящем описании, термин "арил" относится к моно- или бициклической карбоциклической системе, содержащей одно или два ароматических кольца, включая, но, не ограничиваясь ими, фенил, нафтил, тетрагидронафтил, инданил, инденил и т.п. Размер арильного кольца и наличие заместителей или связывающих групп указывают путем обозначения числа содержащихся атомов углерода. Например, термин "(C1-C3алкил)(C6-C10арил)" относится к 5-10-членному арилу, который присоединен к исходной группе через алкильную цепь с количеством звеньев от одного до трех.

В настоящем описании, термин "гетероарил" относится к моно- или бициклической системе, содержащей один или два ароматических кольца и содержащей по меньшей мере один атом азота, кислорода или серы в ароматическом кольце. Размер гетероарильного кольца и наличие заместителей или связывающих групп указывают путем обозначения числа содержащихся атомов углерода. Например, термин "(C1-Cnалкил)(C5-C6гетероарил)" относится к 5- или 6-членному гетероарилу, который присоединен к исходной группе через алкильную цепь с количеством звеньев от одного "n".

В настоящем описании, термин "гало" относится к одному или более представителям группы, состоящей из фтора, хлора, брома и йода.

В настоящем описании, термин "пациент" без дополнительного обозначения предназначен включать любое теплокровное позвоночное домашнее животное (включая, но, не ограничиваясь ими, домашний скот, лошадей, кошек, собак и других домашних животных) и людей.

В настоящем описании, термин "выделенный" означает удаленный из своего природного окружения. В некоторых вариантах осуществления аналог получают рекомбинантными способами, и аналог выделяют из клетки-хозяина.

В настоящем описании, термин "очищенный" относится к выделению молекулы или соединения в форме, которая по существу не содержит загрязняющих примесей, как правило, связанных с молекулой или соединением в нативной или природной среде, и означает обладающий повышенной чистотой в результате отделения от других компонентов исходной композиции. Термин "очищенный полипептид" используют в настоящее описание для описания полипептида, который отделяли от других соединений, включая, но, не ограничиваясь ими, молекулы нуклеиновой кислоты, липиды и углеводы.

"Пептидомиметик" относится к химическому соединению, обладающему структурой, которая отличается от общей структуры существующего пептида, но который функционирует аналогично существующему пептиду, например, путем имитирования биологической активности такого пептида. Пептидомиметики, как правило, содержат природные аминокислоты и/или неприродные аминокислоты, а также могут содержать модификации пептидного остова. Например, пептидомиметик может содержать последовательность природных аминокислот со вставками или заменами непептидной группы, например, ретро-инвертированного фрагмента, или вставкой непептидных связей, таких как азапептидная связь (CO замещенная NH) или псевдопептидная связь (например, NH замещенная CH2), или сложноэфирная связь (например, депсипептиды, где одну или более амидных связей (-CONHR-) заменяют сложноэфирными связями (COOR)). Альтернативно, пептидомиметик может не содержать любые природные аминокислоты.

В настоящем описании, термин "заряженная аминокислота" или "заряженный остаток" относится к аминокислоте, которая содержит боковую цепь, которая является отрицательно заряженной (т.е. депротонированной) или положительно заряженной (т.е. протонированной) в водном растворе при физиологическом pH. Например, отрицательно заряженные аминокислоты включают аспарагиновую кислоту, глутаминовую кислоту, цистеиновую кислоту, гомоцистеиновую кислоту и гомоглутаминовую кислоту, тогда как положительно заряженные аминокислоты включают аргинин, лизин и гистидин. Заряженные аминокислоты включают заряженные аминокислоты из числа 20 аминокислот, общепринято встречающихся в белках человека, а также нетипичные или неприродные аминокислоты.

В настоящем описании, термин "кислая аминокислота" относится к аминокислоте, которая содержит вторую кислую группу (отличную от альфа-карбоновой кислоты аминокислоты), включая, например, боковую цепь карбоновой кислоты или группу сульфоновой кислоты.

В настоящем описании, термин "пациент" без дополнительного обозначения предназначен включать любое теплокровное позвоночное домашнее животное (включая, но, не ограничиваясь ими, домашний скот, лошадей, кошек, собак и других домашних животных), млекопитающие и людей.

СОКРАЩЕННЫЕ ОБОЗНАЧЕНИЯ

Аналоги инсулина сокращенно обозначают так, как указано ниже.

A- и B-цепи инсулина обозначают заглавной буквой A для A-цепь и заглавной буквой B для B-цепи, где верхний индекс 0 (например, A0 или B0) обозначает, что последовательность оснований представляет собой последовательность инсулина (A-цепь: SEQ ID NO: 1, B-цепь SEQ ID NO: 2), и верхний индекс 1 (например, A1 или B1) обозначает, что последовательность оснований представляет собой последовательность IGF-1 (A-цепь: SEQ ID NO: 5, B-цепь SEQ ID NO: 6). Модификации, которые отличаются от нативного инсулина и последовательности IGF, указывают в скобках после обозначения A- или B-цепи (например, [B1(H5,H10,Y16,L17): A1(H8,N18,N21)]) с однобуквенным сокращенным обозначением аминокислоты, указывающим замену, и числом, указывающим положение замены в соответствующей A- или B-цепи, с использованием нумерации нативного инсулина. Двоеточие между A- и B-цепью означает две цепи инсулина, тогда как прочерк означает ковалентную связь и, таким образом, одноцепочечный аналог. В одноцепочечных аналогах связывающую группу указывают между A- и B-цепями, и обозначение C1 относится к нативному C-пептиду IGF1, SEQ ID NO: 17. Обозначение "положения C8" по отношению к связывающей группе означает аминокислоту, располагающуюся в положении, соответствующем восьмой аминокислоте SEQ ID NO: 17.

ВАРИАНТЫ ОСУЩЕСТВЛЕНИЯ

В настоящем описании раскрыты конъюгаты инсулинового пептида и родственного глюкагону пептида. В одном из вариантов осуществления конъюгат содержит ковалентную связь либо прямую, либо через линкер инсулинового пептида и родственного глюкагону пептида. В одном из вариантов осуществления родственный глюкагону пептид является ковалентно связанным с амино- или карбокси-концом A-цепи или B-цепи инсулина. В другом варианте осуществления C-концевая область одного или двух родственных глюкагону пептидов ковалентно связана с инсулиновым пептидом через положение, независимо выбранное из боковой цепи аминокислоты в положении, выбранном из группы, состоящей из A9, A14 и A15 A-цепи, положениях B1, B2, B10, B22, B28 или B29 B-цепи, в N-концевом альфа-амине A- или B-цепи, на C-конце B-цепи или в боковой цепи аминокислоты в любом положении связывающей группы, которая связывает A-цепь и B-цепь в одноцепочечном аналоге инсулина, включая, например, в положении C8. В другом варианте осуществления N-конец или C-конец инсулинового пептида является ковалентно связанным с боковой цепью аминокислоты родственного глюкагону пептида в положении, выбранном из 10, 20, 24, 28 и 29.

В другом варианте осуществления один или два родственных глюкагону пептида являются ковалентно связанными с инсулиновым пептидом через положение, независимо выбранной из N-концевого альфа-амина B-цепи, C-конца B-цепи, или в любом положении связывающей группы, которая связывает A-цепь и B-цепь одноцепочечного аналога инсулина, включая, например, в положении C8. В одном из вариантов осуществления карбокси-концевая область родственного глюкагону пептида ковалентно связана с N-концевым альфа-амином B-цепи одноцепочечный аналога инсулинового пептида. В одном из вариантов осуществления C-конец родственного глюкагону пептида является ковалентно связанным с N-концевым альфа-амином B-цепи двухцепочечного или одноцепочечного аналога инсулинового пептида.

В соответствии с одним из вариантов осуществления инсулиновый пептид представляет собой двухцепочечный инсулин, где A-цепь и B-цепь связаны друг с другом через межцепочечные дисульфидные связи. В одном из вариантов осуществления конъюгат содержит двухцепочечный инсулиновый пептид, где карбокси-концевая область родственного глюкагону пептида ковалентно связана с амино-концом A-цепи инсулинового пептида. В одном из вариантов осуществления конъюгат содержит двухцепочечный инсулиновый пептид, где карбокси-конец A-цепи или B-цепь инсулинового пептида является ковалентно связанным с амино-концом родственного глюкагону пептида. В одном из вариантов осуществления конъюгат содержит двухцепочечный инсулиновый пептид, где карбокси-конец родственного глюкагону пептида является ковалентно связанным с амино-концом B-цепи инсулинового пептида. В одном из вариантов осуществления конъюгат содержит двухцепочечный инсулиновый пептид, где карбокси-конец B-цепи инсулинового пептида является ковалентно связанным с амино-концом родственного глюкагону пептида.

В другом варианте осуществления конъюгат содержит двухцепочечный аналог инсулина и первый и второй родственный глюкагону пептид, где каждый родственный глюкагону пептид независимо является ковалентно связанным с инсулиновым пептидом в положении, выбранном из группы, состоящей из амино-конца B-цепи, карбокси-конца A-цепи и карбокси-конца B-цепи. В одном из вариантов осуществления конъюгат содержит двухцепочечный инсулиновый пептид, где карбокси-концевая область первого родственного глюкагону пептида ковалентно связана с амино-концом B-цепи инсулинового пептида, и карбокси-конец B-цепи инсулинового пептида является ковалентно связанным к амино-концом второго родственного глюкагону пептида. В одном из вариантов осуществления первый и второй родственные глюкагону пептиды являются различными и обладают активностью по отношению к двум различным рецепторам, выбранным из группы, состоящей из рецепторов глюкагона, GLP-1 и GIP. В одном из вариантов осуществления первый родственный глюкагону пептид обладает активностью по отношению к рецептору глюкагона, и второй родственный глюкагону пептид обладает активностью по отношению к рецептору GLP-1. В одном из вариантов осуществления первый и/или второй родственный глюкагону пептид представляет собой коагонист, обладающий активностью в отношении двух рецепторов, выбранных из группы, состоящей из рецепторов глюкагона, GLP-1 и GIP.

В одном из вариантов осуществления конъюгат представляет собой слитый белок, где карбокси-концевая область родственного глюкагону пептида является связанной с амино-концом B-цепи инсулинового пептида непосредственно или через пептидный линкер. В одном из вариантов осуществления конъюгат содержит одноцепочечный аналог инсулина, где карбокси-концевая область родственного глюкагону пептида ковалентно связана с амино-концом одноцепочечного аналога инсулина. В одном из вариантов осуществления конъюгат содержит одноцепочечный аналог инсулина, где карбокси-конец одноцепочечного инсулинового пептида является ковалентно связанным с амино-концом родственного глюкагону пептида.

В некоторых или любых вариантах осуществления инсулиновый пептид конъюгата по настоящему изобретению представляет собой нативный инсулин, содержащий A-цепь SEQ ID NO: 1 и B-цепь SEQ ID NO: 2, или аналог нативного инсулина, включая, например, одноцепочечный аналог инсулина, содержащий SEQ ID NO: 1 и 2. В одном из вариантов осуществления инсулиновый пептид представляет собой пептид-аналог IGFB16B17. В соответствии с настоящим изобретением аналоги инсулина включают полипептиды, содержащие A-цепь и B-цепь, где аналоги инсулина отличаются от нативного инсулина на одну или более замен аминокислот в положениях, выбранных из A5, A8, A9, A10, A12, A14, A15, A17, A18, A21, B1, B2, B3, B4, B5, B9, B10, B13, B14, B17, B20, B21, B22, B23, B26, B27, B28, B29 и B30, или делеций любого или всех положений B1-4 и B26-30.

В одном из вариантов осуществления компонент родственного глюкагону пептида конъюгата представляет собой пептид, выбранный из группы, состоящей из нативного глюкагона (SEQ ID NO: 701), нативного GLP-1 (SEQ ID NO: 703) и нативного (SEQ ID NO: 707). В одном из вариантов осуществления родственный глюкагону пептид представляет собой пептид глюкагона или пептид GLP-1. В некоторых вариантах осуществления родственный глюкагону пептид конъюгата по настоящему изобретению представляет собой аналог нативного глюкагона человека (SEQ ID NO: 701), содержащего аминокислотную последовательность, основанную на аминокислотной последовательности SEQ ID NO: 701, но отличающуюся от SEQ ID NO: 701 тем, что аминокислотная последовательность аналога глюкагона содержит одну или более (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 и в некоторых случаях 16 или более (например, 17, 18, 19, 20, 21, 22, 23, 24, 25 и т.д.) конкретных или необязательных модификаций аминокислот. В некоторых или любых вариантах осуществления пептид по настоящему изобретению содержит всего 1, до 2, до 3, до 4, до 5, до 6, до 7, до 8, до 9 или до 10 дополнительных модификаций аминокислот (например, в дополнение к конкретным модификациям аминокислот) относительно нативной последовательности глюкагона человека (SEQ ID NO: 701). Например, в одном из вариантов осуществления аналог глюкагона (SEQ ID NO: 701) содержит (a) аминокислоту, содержащую имидазольную боковую цепь в положении 1, (b) защитную аминокислоту по отношению к DPP-IV в положении 2, (c) ацилированную аминокислоту или алкилированную аминокислоту в положениях 9, 10, 12, 16, 20 или 37-43, (d) стабилизирующую альфа-спираль аминокислоту в одном или более положениях 16, 17, 18, 19, 20 и 21, и (e) до десяти дополнительных модификаций аминокислот относительно SEQ ID NO: 701. В одном из вариантов осуществления настоящее изобретение относится к аналогу глюкагона, содержащему (a)-(d) с до 10 дополнительных модификаций аминокислот в дополнение к модификациям аминокислот, указанных в (a)-(d). В некоторых или любых вариантах осуществления модификации представляют собой любые из модификаций, описываемых в настоящем описании, например, ацилирование, алкилирование, пегилирование, усечение по C-концу, замена аминокислот в одном или более положениях 1, 2, 3, 7, 10, 12, 15, 16, 17, 18, 19, 20, 21, 23, 24, 27, 28 и 29.

Инсулиновые пептиды

Инсулиновый пептидный компонент конъюгатов по настоящему изобретению может содержать нативные последовательности B- и A-цепи инсулина человека (SEQ ID NO: 1 и 2, соответственно) или любой из его известных аналогов или производных, которые обладают активностью агониста инсулина при связывании друг с другом в гетеродуплекс. Такие аналоги, например, белки, содержащие A-цепь и B-цепь, которые отличаются от A-цепи и B-цепи инсулина человека наличием одной или более делеций аминокислот, одной или более замен аминокислот и/или одной или более вставок аминокислот, которые не нарушают инсулиновую активность аналога инсулина.

В одном из вариантов осуществления инсулиновый пептид представляет собой аналог инсулина, где:

(a) аминокислотный остаток в положении B28 заменяют Asp, Lys, Leu, Val или Ala, и аминоацильный остаток в положении B29 представляет собой Lys или Pro;

(b) аминокислотные остатки в положениях B27, B28, B29 и B30 удаляют или заменяют ненативной аминокислотой. Один из вариантов осуществления относится к аналогу инсулина, содержащему Asp, замещенный в положении B28, или Lys, замещенный в положении 28, и пролин, замещенный в положении B29. Дополнительные аналоги инсулина описаны в Chance, et al., патент США № 5514646; Chance, et al., патентная заявка США с серийным № 08/255297; Brems et al., Protein Engineering, 5:527-533 (1992); Brange et al., публикации EPO № 214,826 (опубликованной 18 марта 1987 года) и Brange et al., Current Opinion in Structural Biology, 1:934-940 (1991), описания которых явным образом включены посредством ссылки в настоящее описание.

Аналоги инсулина также могут содержать замены амидированных аминокислот кислыми формами. Например, Asn можно заменять Asp или Glu. Аналогично, Gln можно заменять Asp или Glu. В частности, Asn(A18), Asn(A21) или Asp(B3), или любую комбинацию этих остатков можно заменять Asp или Glu. Также Gln(A15) или Gln(B4), или оба можно заменять Asp или Glu.

Как описано в настоящем описании, предоставлены одноцепочечные агонисты инсулина, содержащие B-цепь и A-цепь инсулина человека или их аналоги или производное, где C-конец B-цепи связан с амино-концом A-цепи через связывающую группу.

В одном из вариантов осуществления A-цепь представляет собой аминокислотную последовательность, выбранную из группы, состоящей из GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 1), GIVDECCFRSCDLRRLEMYCA (SEQ ID NO: 5) или GIVEECCFRSCDLALLETYCA (SEQ ID NO: 7), и B-цепь содержит последовательность FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2), GPETFCGAEFVDAFYFVCGDRGFYFNKPT (SEQ ID NO: 6) или AYRPSETLCGGEFVDTFYFVCGDRGFYFSRPA (SEQ ID NO: 8), или ее укороченную с карбокси-конца последовательность с удаленными от одной до пяти аминокислот, соответствующих B26, B27, B28, B29 и B30, и аналоги таких последовательностей, где каждую последовательность модифицируют так, чтобы она содержала от одной до пятя замен аминокислот в положениях, соответствующих положениям нативного инсулина (см. выравнивание пептидов, представленное на фиг. 5), выбранных из A5, A8, A9, A10, A14, A15, A17, A18, A21, B1, B2, B3, B4, B5, B9, B10, B13, B14, B20, B22, B23, B26, B27, B28, B29 и B30. В одном из вариантов осуществления замены аминокислот представляют собой консервативные аминокислотные замены. Подходящие замены аминокислот в этих положениях, которые не оказывают неблагоприятного влияния на желаемые виды активности инсулина, известны специалистам в данной области, как продемонстрировано, например, у Mayer et al., Insulin Structure and Function, Biopolymers. 2007;88(5):687-713, описание которой включено посредством ссылки в настоящее описание.

Дополнительные аминокислотные последовательности можно добавлять к амино-концу B-цепи или к карбокси-концу A-цепи одноцепочечных агонистов инсулина по настоящему изобретению. Например, ряд отрицательно заряженных аминокислоты можно добавлять к амино-конец B-цепи, включая, например, пептид длиной от 1 до 12, от 1 до 10, от 1 до 8 или от 1 до 6 аминокислот, и содержащий одну или более отрицательно заряженных аминокислот, включая, например, глутаминовую кислоту и аспарагиновую кислоту. В одном из вариантов осуществления B-цепь удлинения амино-конца содержит от 1 до 6 заряженных аминокислот. В одном из вариантов осуществления B-цепь удлинения амино-конца содержит последовательность GX61X62X63X64X65K (SEQ ID NO: 26) или X61X62X63X64X65RK (SEQ ID NO: 27), где X61, X62, X63 X64, и X65 независимо представляют собой глутаминовую кислоту или аспарагиновую кислоту. В одном из вариантов осуществления B-цепь содержит последовательность GEEEEEKGPEHLCGAHLVDALYLVCGDX42GFY (SEQ ID NO: 28), где X42 выбран из группы, состоящей из аланина, лизина, орнитина и аргинина. В соответствии с одним из вариантов осуществления конъюгаты родственный глюкагону пептид-инсулин, описываемые в настоящем описании, содержат C-концевой амид или сложный эфир вместо C-концевого карбоксилата на A-цепи.

Высокую активность конъюгатов родственный глюкагону пептид-инсулин также можно получать на основании использования модифицированной последовательности IGF I и IGF II, описанной в опубликованной международной заявке № WO 2010/080607, описание которой явным образом включено посредством ссылки в настоящее описание, в качестве компонента инсулинового пептида. Более конкретно, аналоги IGF I и IGF II, которые содержат замену дипептида тирозин-лейцин для нативных аминокислот IGF в положениях, соответствующих B16 и B17 нативного инсулина, обладают в десять раз большей активностью в отношении инсулинового рецептора.

В соответствии с одним из вариантов осуществления инсулиновый пептид для применения в настоящем изобретении содержит последовательность B-цепи R22-X25LCGX29X30LVX33X34LYLVCGX41X42GFX45 (SEQ ID NO: 20) и последовательность GIVX4X5CCX8X9X10CX12LX14X15LX17X18X19CX21-R13 A-цепи (SEQ ID NO: 29), где

X4 представляет собой глутаминовую кислоту или аспарагиновую кислоту;

X5 представляет собой глутамин или глутаминовую кислоту;

X8 представляет собой гистидин, треонин или фенилаланин;

X9 представляет собой серин, аргинин, лизин, орнитин или аланин;

X10 представляет собой изолейцин или серин;

X12 представляет собой серин или аспарагиновую кислоту;

X14 представляет собой тирозин, аргинин, лизин, орнитин или аланин;

X15 представляет собой глутамин, глутаминовую кислоту, аргинин, аланин, лизин, орнитин или лейцин;

X17 представляет собой глутамин, глутаминовую кислоту, аргинин, аспарагиновую кислоту или лизин, орнитин;

X18 представляет собой метионин, аспарагин, глутамин, аспарагинов кислота, глутаминовую кислоту или треонин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 выбран из группы, состоящей из аланина, глицина, серина, валина, треонина, изолейцина, лейцина, глутамина, глутаминовой кислоты, аспарагина, аспарагиновой кислоты, гистидина, триптофана, тирозина и метионина;

X25 представляет собой гистидин или треонин;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислоты, глутамина и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X41 выбран из группы, состоящей из глутаминовой кислоты, аспарагиновой кислоты или аспарагина;

X42 выбран из группы, состоящей из аланина, лизина, орнитина и аргинина;

X45 представляет собой тирозин, гистидин, аспарагин или фенилаланин;

R22 выбран из группы, состоящей из AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), трипептида глицин-пролин-глутаминовая кислота, трипептида валин-аспарагин-глутамин, дипептида пролин-глутаминовая кислота, дипептида аспарагин-глутамин, глутамин, глутаминовой кислоты и связи; и R13 представляет собой COOH или CONH2. В одном из вариантов осуществления A-цепь и B-цепь являются связанными друг с другом межцепочечными дисульфидными связями, включая связи, которые образуются между A- и B-цепями нативного инсулина. В альтернативном варианте осуществления A- и B-цепи являются связанными друг с другом в виде линейного одноцепочечного инсулинового пептида.

В одном из вариантов осуществления конъюгаты содержат инсулиновый пептид, где A-цепь содержит последовательность GIVEQCCX1SICSLYQLENX2CX3 (SEQ ID NO: 30), и указанная последовательность B-цепи содержит последовательность X4LCGX5X6LVEALYLVCGERGFF (SEQ ID NO: 31), где

X1 выбран из группы, состоящей из треонина и гистидина;

X2 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X3 выбран из группы, состоящей из аспарагина и глицина;

X4 выбран из группы, состоящей из гистидина и треонина;

X5 выбран из группы, состоящей из аланина, глицина и серина;

X6 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты.

Один из вариантов осуществления относится к аналогу инсулина, где A-цепь инсулинового пептида содержит последовательность GIVEQCCX8X9ICSLYQLENYCX21-R13 (SEQ ID NO: 73) или GIVEQCCX8SICSLYQLX17NX19CX21 (SEQ ID NO: 32) и B-цепь, содержащую последовательность R22-X25LCGX29X30LVX33X34LYLVCGX41X42GFX45YT-Z1-B1 (SEQ ID NO: 142), где

X8 выбран из группы, состоящей из треонина и гистидина;

X9 представляет собой валин или тирозин;

X17 представляет собой глутамин или глутаминовую кислоту;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аспарагин или глицин;

X25 представляет собой гистидин или треонин;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислоты и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X41 выбран из группы, состоящей из глутаминовой кислоты, аспарагиновой кислоты или аспарагина;

X42 выбран из группы, состоящей из аланина, орнитина, лизина и аргинина;

X45 представляет собой тирозин или фенилаланин;

R22 выбран из группы, состоящей из FVNQ (SEQ ID NO: 12), трипептида валин-аспарагин-глутамин, дипептида аспарагин-глутамин, глутамина и N-концевого амина;

Z1 представляет собой дипептид, выбранный из группы, состоящей из аспартата-лизина, лизина-пролина и пролина-лизина; и

B1 выбран из группы, состоящей из треонина, аланина или трипептида треонин-аргинин-аргинин.

Один из вариантов осуществления относится к аналогу инсулина, где A-цепь инсулинового пептида содержит последовательность GIVEQCCX8SICSLYQLX17NX19CX21 (SEQ ID NO: 32) и B-цепь, содержащую последовательность X25LCGX29X30LVEALYLVCGERGFF (SEQ ID NO: 33), где

X8 выбран из группы, состоящей из треонина и гистидина;

X17 представляет собой глутаминовую кислоту или глутамин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аспарагин или глицин;

X25 выбран из группы, состоящей из гистидина и треонина;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты. В дополнительном варианте осуществления B-цепь содержит последовательность X22VNQX25LCGX29X30LVEALYLVCGERGFFYT-Z1-B1 (SEQ ID NO: 34), где

X22 выбран из группы, состоящей из фенилаланина и дезаминофенилаланина;

X25 выбран из группы, состоящей из гистидина и треонина;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

Z1 представляет собой дипептид, выбранный из группы, состоящей из аспартат-лизина, лизин-пролина и пролин-лизина; и

B1 выбран из группы, состоящей из треонина, аланина или трипептида треонин-аргинин-аргинин.

В соответствии с некоторыми вариантами осуществления A-цепь содержит последовательность GIVEQCCX8SICSLYQLX17NX19CX23 (SEQ ID NO: 32) или GIVDECCX8X9SCDLX14X15LX17X18X19CX21-R13 (SEQ ID NO: 35), и B-цепь содержит последовательность X25LCGX29X30LVX33X34LYLVCGDX42GFX45 (SEQ ID NO: 36), где

X8 представляет собой гистидин или фенилаланин;

X9 и X14 независимо выбраны из аргинина, лизина, орнитина или аланина;

X15 представляет собой аргинин, лизин, орнитин или лейцин;

X17 представляет собой глутаминовую кислоту или глутамин;

X18 представляет собой метионин, аспарагин или треонин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аланин, глицин или аспарагин;

X23 представляет собой аспарагин или глицин;

X25 выбран из группы, состоящей из гистидина и треонина;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислоты и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X42 выбран из группы, состоящей из аланина, лизина, орнитина и аргинина;

X45 представляет собой тирозин, и

R13 представляет собой COOH или CONH2.

В дополнительном варианте осуществления A-цепь содержит последовательность GIVDECCX8X9SCDLX14X15LX17X18X19CX21-R13 (SEQ ID NO: 35), и B-цепь содержит последовательность X25LCGX29X30LVX33X34LYLVCGDX42GFX45 (SEQ ID NO: 36), где

X8 представляет собой гистидин;

X9 и X14 независимо выбраны из аргинина, лизина, орнитина или аланина;

X15 представляет собой аргинин, лизин, орнитин или лейцин;

X17 представляет собой глутаминовую кислоту, аспарагиновую кислоту, аспарагин, лизин, орнитин или глутамин;

X18 представляет собой метионин, аспарагин или треонин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аланин, глицин или аспарагин;

X23 представляет собой аспарагин или глицин;

X25 выбран из группы, состоящей из гистидина и треонина;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислоты и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X42 выбран из группы, состоящей из аланина, лизина, орнитина и аргинина;

X45 представляет собой тирозин или фенилаланин, и

R13 представляет собой COOH или CONH2.

В дополнительном варианте осуществления A-цепь содержит последовательность GIVDECCHX9SCDLX14X15LX17MX19CX21-R13 (SEQ ID NO: 37), и B-цепь содержит последовательность X25LCGAX30LVDALYLVCGDX42GFX45 (SEQ ID NO: 38), где

X9, X14 и X15 независимо представляют собой орнитин, лизин или аргинин;

X17 представляет собой глутаминовую кислоту или глутамин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аланин, глицин или аспарагин;

X25 выбран из группы, состоящей из гистидина и треонина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты и глутаминовой кислоты;

X42 выбран из группы, состоящей из аланина, лизина, орнитина и аргинина;

X45 представляет собой тирозин или фенилаланин, и

R13 представляет собой COOH или CONH2.

В одном из вариантов осуществления B-цепь выбрана из группы, состоящей из HLCGAELVDALYLVCGDX42GFY (SEQ ID NO: 39), GPEHLCGAELVDALYLVCGDX42GFY (SEQ ID NO: 40), GPEHLCGAELVDALYLVCGDX42GFYFNPKT (SEQ ID NO: 41) и GPEHLCGAELVDALYLVCGDX42GFYFNKPT (SEQ ID NO: 42), где X42 выбран из группы, состоящей из орнитина, лизина и аргинина. В дополнительном варианте осуществления A-цепь содержит последовательность GIVDECCHX9SCDLX14X15LQMYCN-R13 (SEQ ID NO: 43), где X9, X14 и X15 независимо представляют собой орнитин, лизин или аргинин.

В другом варианте осуществления A-цепь содержит последовательность GIVDECCX8RSCDLYQLENX19CN-R13 (SEQ ID NO: 44), и B-цепь содержит последовательность R22-X25LCGSHLVDALYLVCGDX42GFX45 (SEQ ID NO: 45),

где

X8 представляет собой треонин, гистидин или фенилаланин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X25 представляет собой гистидин или треонин;

X42 представляет собой аланин, орнитин или аргинин;

X45 представляет собой тирозин гистидин, аспарагин или фенилаланин;

R22 выбран из группы, состоящей из AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), трипептида глицин-пролин-глутаминовая кислота, трипептида валин-аспарагин-глутамин, дипептида пролин-глутаминовая кислота, дипептида аспарагин-глутамин, глутамина, глутаминовой кислоты и связи; и R13 представляет собой COOH или CONH2,

и

R13 представляет собой COOH или CONH2.

В другом варианте осуществления A-цепь содержит последовательность GIVEQCCHSICSLYQLENX19CX21-R13 (SEQ ID NO: 46) или GIVDECCHRSCDLRRLEMX19CX21-R13 (SEQ ID NO: 47), и B-цепь содержит последовательность FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2) или GPETLCGAELVDALYLVCGDRGFYFNPKT (SEQ ID NO: 48),

X19 представляет собой тирозин, 4-метокси фенилаланин или 4-аминофенилаланин;

X21 представляет собой аланин, глицин или аспарагин

каждый из X26 и X27 представляет собой аланин, и

X42 представляет собой аргинин.

Одноцепочечные агонисты инсулинового пептида

Как описано в настоящем описании, связывающие группы можно использовать для связывания A- и B-цепей инсулина человека или их аналогов или производных, где карбокси-конец аминокислоты B25 B-цепи непосредственно связывают с первым концом связывающей группы, где второй конец связывающей группы непосредственно связывают с амино-концом аминокислоты A1 A-цепи через промежуточную связывающую группу.

В соответствии с одним из вариантов осуществления инсулиновый пептид представляет собой одноцепочечный агонист инсулина, который содержит общую структуру B-LM-A, где B представляет собой B-цепь инсулина, A представляет собой A-цепь инсулина, и LM представляет собой связывающую группу, связывающую карбокси-конец B-цепи с амино-концом A-цепи. Подходящие связывающие группы для соединения B-цепи с A-цепью описаны в настоящем описании под заголовком "Связывающие группы для одноцепочечных аналогов инсулина" и соответствующими подзаголовками "Пептидные линкеры" и "Непептидные линкеры". В одном из вариантов осуществления связывающая группа содержит связывающий пептид и более конкретно, в одном из вариантов осуществления пептид представляет собой аналог C-пептид IGF-1. Дополнительные иллюстративные пептидные линкеры включают, но не ограничиваются ими, последовательность X51X52GSSSX57X58 (SEQ ID NO: 49) или X51X52GSSSX57X58APQT (SEQ ID NO: 50), где X51 выбран из группы, состоящей из глицина, аланина, валина, лейцина, изолейцина и пролина, X52 представляет собой аланин, валин, лейцин, изолейцин или пролин, и X57 или X58 независимо представляют собой аргинин, лизин, цистеин, гомоцистеин, ацетилфенилаланин или орнитин необязательно с гидрофильной группой, связанной с боковой цепью аминокислоты в положении 7 или 8 связывающей группы (т.е. в положении X57 или X58). Положения аминокислот связывающей группы обозначают в зависимости от соответствующего положения в нативной C-цепи IGF 1 (SEQ ID NO: 17). В другом варианте осуществления пептидная связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, обладающую более чем 70%, 80%, 90% идентичностью последовательности с SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68), где X50 и X51 независимо выбраны из аргинина и лизина. В одном из вариантов осуществления связывающая группа представляет собой непептидный линкер, содержащий относительно короткий бифункциональный непептидный полимерный линкер, которого приблизительно соответствует аминокислотной последовательности длиной 8-16 аминокислот. В одном из вариантов осуществления непептидный линкер обладает структурой: ; где m представляет собой целое число в диапазоне от 10 до 14, и связывающая группа является непосредственно связанной с аминокислотой B25 B-цепи. В соответствии с одним из вариантов осуществления непептидная связывающая группа представляет собой линкер на основе полиэтиленгликоля приблизительно от 4 до 20, от 8 до 18, от 8 до 16, от 8 до 14, от 8 до 12, от 10 до 14, от 10 до 12 или от 11 до 13 мономеров.

Один из вариантов осуществления относится к конъюгату родственный глюкагону пептид-инсулин, который содержит инсулиновый пептид, имеющий структуру: IB-LM-IA, где IB содержит последовательность R22-X25LCGX29X30LVX33X34LYLVCGX41X42GFX45 (SEQ ID NO: 20), EM представляет собой связывающую группу, как описано в настоящем описании, которая ковалентно связывает IB с IA, и IA содержит последовательность GIVX4X5CCX8X9X10CX12FX14X15FX17X18X19CX21-R13 (SEQ ID NO: 29),

где

X4 представляет собой глутаминовую кислоту или аспарагиновую кислоту;

X5 представляет собой глутамин или глутаминовую кислоту;

X8 представляет собой гистидин или фенилаланин;

X9 и X14 независимо выбраны из аргинину, лизину, орнитину или аланину;

X10 представляет собой изолейцин или серин;

X12 представляет собой серин или аспарагиновую кислоту;

X14 представляет собой тирозин, аргинин, лизин, орнитин или аланин;

X15 представляет собой аргинин, лизин, орнитин или лейцин;

X17 представляет собой глутаминовую кислоту или глутамин;

X18 представляет собой метионин, аспарагин или треонин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аланин, глицин или аспарагин;

X25 выбран из группы, состоящей из гистидина и треонина;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислота и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X41 выбран из группы, состоящей из глутаминовой кислоты, аспарагиновой кислоты или аспарагина;

X42 выбран из группы, состоящей из аланина, лизина, орнитина и аргинина;

R22 выбран из группы, состоящей из AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), трипептида глицин-пролин-глутаминовая кислота, трипептида валин-аспарагин-глутамин, дипептида пролин-глутаминовая кислота, дипептида аспарагин-глутамин, глутамина, глутаминовой кислоты и N-концевого амина, и

R13 представляет собой COOH или CONH2, кроме того, где аминокислота с обозначением X45 непосредственно связана со связывающей группой LM (т.е. в настоящем описании обозначение IB-LM-IA предназначено отражать, что карбокси-конец B-цепи и амино-конец A-цепи являются непосредственно связанными со связывающей группой LM без каких-либо дополнительных промежуточных аминокислот).

В одном из вариантов осуществления связывающая группа (LM) содержит аминокислотную последовательность длиной не более 17 аминокислот. В одном из вариантов осуществления связывающая группа содержит последовательность X51X52GSSSX57X58 (SEQ ID NO: 49) или X51X52GSSSX57X58APQT (SEQ ID NO: 50), где X51 выбран из группы, состоящей из глицина, аланина, валина, лейцина, изолейцина и пролина, X52 представляет собой аланин, валин, лейцин, изолейцин или пролин, и X57 или X58 независимо представляют собой аргинин, лизин, цистеин, гомоцистеин, ацетилфенилаланин или орнитин необязательно с гидрофильной группой, связанной с боковой цепью аминокислоты в положении 7 или 8 связывающей группы (т.е. в положении X57 или X58). Положения аминокислот связывающей группы обозначают в зависимости от соответствующего положения в нативной C-цепи IGF 1 (SEQ ID NO: 17).

В другом варианте осуществления связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, непосредственно связанную с карбокси-концевой аминокислотой B-цепи, где указанная непрерывная аминокислотная последовательность длиной 29 аминокислот обладает более чем 70%, 80%, 90% идентичностью последовательности с SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68), где X50 и X51 независимо выбраны из аргинина и лизина. В одном из вариантов осуществления связывающий пептид содержит всего от 29 до 158 или от 29 до 58 аминокислот и содержит последовательность SEQ ID NO: 68. В другом варианте осуществления связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, непосредственно связанную с карбокси-концевой аминокислотой B-цепи, где указанная непрерывная аминокислотная последовательность длиной 29 аминокислот обладает более чем 90% идентичностью последовательности с SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68), где X50 и X51 независимо выбраны из аргинина и лизина. В одном из вариантов осуществления связывающая группа содержит последовательность SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51) или SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) необязательно с одной или двумя заменами аминокислот.

Один из вариантов осуществления относится к полипептиду одноцепочечного агониста инсулина, содержащему B-цепь и A-цепь инсулина человека, или его аналогам или производному, где последние пять карбокси-концевых аминокислот нативной B-цепи удаляют (т.е. B26-B30), и аминокислота B25 является связанной с аминокислотой A1 A-цепи через промежуточную связывающую группу. В одном из вариантов осуществления связывающая группа содержит структуру: ; где m представляет собой целое число в диапазоне от 10 до 14, и связывающая группа является непосредственно связанной с аминокислотой B25 B-цепи.

Один из вариантов осуществления относится к конъюгату родственный глюкагону пептид-инсулин, содержащему инсулиновый пептид с общей формулой IB-LM-IA, где IB содержит последовательность GPEHLCGAX30LVDALYLVCGDX42GFYFNX48X49 (SEQ ID NO: 40); LM содержит последовательность SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52), GYGSSSRR (SEQ ID NO: 18) или GAGSSSRR (SEQ ID NO: 22); и IA содержит последовательность GIVDECCX8X9SCDLX14X15LX17X18X19CX21-R13 (SEQ ID NO: 35), где

X8 представляет собой гистидин или фенилаланин;

X9 представляет собой аргинин, орнитин или аланин;

X14 и X15 представляют собой аргинин;

X17 представляет собой глутаминовую кислоту;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аланин или аспарагин;

X25 представляет собой гистидин или треонин;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X42 выбран из группы, состоящей из аланина, орнитина и аргинина;

R13 представляет собой COOH.

Связывающие группы для одноцепочечных аналогов инсулина

Пептидные линкеры

В соответствии с одним из вариантов осуществления связывающая группа представляет собой пептид или пептидомиметик из 6-18, 8-18, 8-17, 8-12, 8-10, 13-17 или 13-15 аминокислот (или аналогов аминокислот или их производных). В одном из вариантов осуществления связывающая группа представляет собой пептид или пептидомиметик из 6-18, 8-18, 8-17, 8-12, 8-10, 13-17 или 13-15 аминокислот, где пептидная связывающая группа содержит два или более смежных основных аминокислотных остатка. В соответствии с одним из вариантов осуществления связывающая группа представляет собой ненативную аминокислотную последовательность длиной от 8 до 17 аминокислот, содержащую последовательность X51X52X53X54X55X56X57X58 (SEQ ID NO: 9), где X51, X52, X53, X54, X55 и X56 независимо представляют собой любую аминокислоту или аналог аминокислоты или ее производное, и X57 и X58 представляют собой основные аминокислоты. В одном из вариантов осуществления связывающая группа представляет собой ненативный полипептид длиной от 8 до 17 аминокислот, и содержащий последовательность X51X52X53X54X55X56RR (SEQ ID NO: 10), где X52 представляет собой неароматическую аминокислоту, включая, например, аланин. В одном из вариантов осуществления длина связывающей группы составляет от 8 до 17 аминокислот, и она содержит последовательность X51X52GSSSRR (SEQ ID NO: 53), где X51 выбран из группы, состоящей из глицина, аланина, валина, лейцина, изолейцина, пролина и метионина, и X52 представляет собой неароматическую аминокислоту, включая, например, аланин. В одном из вариантов осуществления длина связывающей группы составляет от 8 до 17 аминокислот, и она содержит последовательность, которая отличается от X51X52GSSSRR (SEQ ID NO: 53) одной заменой аминокислоты, где замена аминокислоты представляет собой аминокислота, которая является пегилированной по своей боковой цепи, кроме того, где X51 выбран из группы, состоящей из глицина, аланина, валина, лейцина, изолейцина, пролина и метионина, и X52 представляет собой неароматическую аминокислоту, включая, например, аланин.

В соответствии с одним из вариантов осуществления связывающая группа представляет собой производное последовательности C-цепи IGF 1 (GYGSSSRRAPQT; SEQ ID NO: 17). В одном из вариантов осуществления производное представляет собой пептид, который отличается от SEQ ID NO: 17 одной заменой аминокислоты остатка лизина, цистеина, орнитина, гомоцистеина или ацетилфенилаланина, и в дополнительном варианте осуществления аминокислота лизин, цистеин орнитин, гомоцистеин или ацетилфенилаланин является пегилированной. В одном из дополнительных вариантов осуществления связывающая группа представляет собой пептид, который отличается от SEQ ID NO: 17 одной заменой лизина. В одном из конкретных вариантов осуществления замену проводят в положении 8 SEQ ID NO: 17. Заявители открыли, что использование последовательности C-цепи IGF 1 и ее аналогов в качестве связывающей группы приводит к образованию одноцепочечного полипептида инсулина, который обладает активностью близкой к активности инсулина дикого типа. Кроме того, в аналоге использование последовательности C-цепи IGF 1 в качестве связывающей группы, где модифицируют положение 2 последовательности C-цепи IGF 1 или удаляют карбокси-концевые четыре аминокислоты из последовательности C-цепи IGF 1, приводит к получению одноцепочечного полипептида инсулина, который является селективным для инсулина (т.е. обладает более высоким связыванием и/или активностью в отношении инсулинового рецептора по сравнению с рецептором IGF-1). В одном из вариантов осуществления одноцепочечный полипептид инсулина обладает в 5x, 10x, 20x, 30x, 40x или 50x более высокой аффинностью или активностью в отношении инсулинового рецептора относительно рецептора IGF-1.

В соответствии с одним из вариантов осуществления связывающая группа представляет собой производное последовательности C-цепи IGF 1 (GYGSSSRRAPQT; SEQ ID NO: 17) и содержит ненативную последовательность, которая отличается от GYGSSSRR (SEQ ID NO: 18) или GAGSSSRRAPQT (SEQ ID NO: 23) от 1 до 3 замен аминокислот или от 1 до 2 замен аминокислот. В одном из вариантов осуществления по меньшей мере одна из замен аминокислот представляет собой замену лизина или цистеина, и в одном из вариантов осуществления замены аминокислот представляют собой консервативные аминокислотные замены. В одном из вариантов осуществления связывающая группа представляет собой пептид (или пептидомиметик) длиной от 8 до 17 аминокислот, содержащий ненативную аминокислотную последовательность, которая отличается от GYGSSSRR (SEQ ID NO: 18) или GAGSSSRRAPQT (SEQ ID NO: 23) 1 заменой аминокислоты, включая, например, замену лизином или цистеином. В одном из вариантов осуществления связывающая группа содержит последовательность GYGSSSRR (SEQ ID NO: 18) или GAGSSSRRAPQT (SEQ ID NO: 23). В одном из вариантов осуществления связывающая группа содержит последовательность GAGSSSRX58APQT (SEQ ID NO: 54), GYGSSSX57X58APQT (SEQ ID NO: 69) или аминокислоту, которая отличается от SEQ ID NO: 54 одной заменой аминокислоты, где X57 представляет собой аргинин, и X58 представляет собой аргинин, орнитин или лизин, и в дополнительном варианте осуществления цепь полиэтиленгликоля является связанной с боковой цепью аминокислоту в положении 8 указанной связывающей группы. В другом варианте осуществления связывающая группа содержит последовательность GX52GSSSRX58APQT (SEQ ID NO: 55), где X52 представляет собой любую неароматическую аминокислоту, включая, например, аланин, валин, лейцин, изолейцин или пролин, и X58 представляет собой аминокислоту, которая содержит цепь полиэтиленовая, ковалентно связанную с ее боковой цепью. В одном из вариантов осуществления X58 представляет собой пегилированный лизин.

В другом варианте осуществления связывающая группа представляет собой аминокислотную последовательность длиной от 8 до 17 аминокислот, содержащую последовательность GX52GSSSRR (SEQ ID NO: 56), где X52 представляет собой любую аминокислоту, пептидомиметик SEQ ID NO: 31 или ее аналог, который отличается от SEQ ID NO: 31 одной заменой аминокислоты в положениях 1, 3, 4, 5, 6, 7 или 8 SEQ ID NO: 31 при условии, что, когда длина связывающего пептида составляет более 8 аминокислот, X52 является отличным от тирозина. В соответствии с одним из вариантов осуществления связывающая группа содержит аминокислотную последовательность длиной 8-17 аминокислот, выбранную из группы, состоящей из GYGSSSRR (SEQ ID NO: 18), GAGSSSRR (SEQ ID NO: 22), GAGSSSRRA (SEQ ID NO: 57), GAGSSSRRAP (SEQ ID NO: 58), GAGSSSRRAPQ (SEQ ID NO: 59), GAGSSSRRAPQT (SEQ ID NO: 23), PYGSSSRR (SEQ ID NO: 61), PAGSSSRR (SEQ ID NO: 62), PAGSSSRRA (SEQ ID NO: 63), PAGSSSRRAP (SEQ ID NO: 64), PAGSSSRRAPQ (SEQ ID NO: 65), PAGSSSRRAPQT (SEQ ID NO: 66). В соответствии с одним из вариантов осуществления связывающая группа содержит аминокислотную последовательность, которая отличается от GYGSSSRR (SEQ ID NO: 18), GAGSSSRR (SEQ ID NO: 22), GAGSSSRRA (SEQ ID NO: 57), GAGSSSRRAP (SEQ ID NO: 58), GAGSSSRRAPQ (SEQ ID NO: 59), GAGSSSRRAPQT (SEQ ID NO: 23), PYGSSSRR (SEQ ID NO: 61), PAGSSSRR (SEQ ID NO: 62), PAGSSSRRA (SEQ ID NO: 63), PAGSSSRRAP (SEQ ID NO: 64), PAGSSSRRAPQ (SEQ ID NO: 65), PAGSSSRRAPQT (SEQ ID NO: 66) одной пегилированной аминокислотой, включая, например, аминокислотную замену пегилированным лизином или пегилированным цистеином. В одном из вариантов осуществления пегилированная аминокислота находится в положении 8 связывающей группы.

В одном из вариантов осуществления в качестве линкерного пептида можно использовать пептидную последовательность, называемую C-концевым пептидом (CTP: SSSSKAPPPSLPSPSRLPGPSDTPILPQR; SEQ ID NO: 52), которая подвергается O-связанному гипергликозилированию, когда белок экспрессируется в экспрессирующей системе на основе эукариотических клеток. Неожиданно, заявители обнаружили, что пептид CTP можно использовать для соединения B- и A-цепей инсулина с образованием одноцепочечного аналога инсулина, при этом все еще сохраняющего высокую активность in vitro до той степени, которую нативный C-пептид проинсулина не может сохранять. В одном из вариантов осуществления получают конъюгат родственный глюкагону пептид-инсулин, содержащий инсулиновый пептид с C-концом B-цепи, связанным с амино-концом A-цепи через пептид CTP. В другом варианте осуществления аналог инсулина предоставлен в виде двухцепочечной конструкции с CTP, ковалентно связанным с C-концом B-цепи и/или амино-концом B-цепи. Характеристика in vitro и in vivo выявляет, что модифицированные CTP аналоги инсулина обладают высокой активностью при отсутствии гликозилирования, таким образом, обеспечивая механизм увеличения действия инсулина, который основан на гликозилировании, природном подходе для белков длительного действия.

Заявители открыли, что первичная последовательность пептида CTP, по-видимому, не является критической. Таким образом, в одном из вариантов осуществления связывающая группа содержит пептид, имеющий длину по меньшей мере 18 аминокислот, который обладает сходным содержанием аминокислот.

В одном из вариантов осуществления связывающая группа содержит аналог (SEQ ID NO: 68), где указанный аналог отличается от (SEQ ID NO: 68) 1, 2, 3, 4, 5 или 6 заменами аминокислот. В одном из вариантов осуществления связывающий пептид содержит пептид CTP, где замены аминокислот проводят в одном или более положений, выбранных из положений 1, 2, 3, 4, 10, 13, 15 и 21 (SEQ ID NO: 68). В одном из вариантов осуществления связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, непосредственно связанную с карбокси-концевой аминокислотой B-цепи, где указанная непрерывная аминокислотная последовательность длиной 29 аминокислот обладает более чем 60, 80 или 90% идентичностью последовательности с SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68) при условии, что последовательность не содержит аминокислотную последовательность длиной 15 аминокислот, идентичную аминокислотной последовательности длиной 15 аминокислот, конъюгированной с SEQ ID NO 53. В другом варианте осуществления связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, непосредственно связанную с карбокси-терминальной аминокислотой B-цепи, где по меньшей мере 58% аминокислот, содержащих непрерывную аминокислотную последовательность длиной 29 аминокислот, выбраны из группы, состоящей из серина и пролина.

В другом варианте осуществления связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, непосредственно связанную с карбокси-концевой аминокислотой B-цепи, где указанная непрерывная аминокислотная последовательность длиной 29 аминокислот, обладает более чем 70%, 80%, 90% идентичностью последовательности с SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68), где X50 и X51 независимо выбраны из аргинина и лизина, при условии, что последовательность не содержит 15 аминокислотную последовательность длиной 15 аминокислот, идентичную аминокислотной последовательности длиной 15 аминокислот, содержащейся в SEQ ID NO 53. В другом варианте осуществления связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, непосредственно связанную с карбокси-концевой аминокислотой B-цепи, где указанная непрерывная аминокислотная последовательность диной 29 аминокислот, представляет собой аналог (SEQ ID NO: 52), где указанный аналог отличается (SEQ ID NO: 52) только 1, 2, 3, 4, 5 или 6 модификациями аминокислот, и в дополнительном варианте осуществления модификации аминокислот представляют собой консервативные аминокислотные замены. В другом варианте осуществления связывающая группа содержит непрерывную аминокислотную последовательность длиной 29 аминокислот, непосредственно связанную с карбокси-концевой аминокислотой B-цепи, где указанная непрерывная аминокислотная последовательность длиной 29 аминокислот представляет собой аналог (SEQ ID NO: 52), где указанный аналог отличается от (SEQ ID NO: 52) только 1, 2 или 3 заменами аминокислот.

Заявители также обнаружили, что многочисленные копии пептида CTP можно использовать в качестве связывающего пептида в одноцепочечных аналогах и/или связывать с амино-концом B-цепи в одноцепочечных или двухцепочечных аналогах инсулина. Многочисленные копии пептида CTP могут быть идентичными или могут отличаться последовательностью, и могут находиться в ориентации "голова к хвосту" или "голова к голове". Один из вариантов осуществления относится к аналогу инсулина, содержащему пептид CTP с последовательностью (SSSSX50APPPSLPSPSRLPGPSDTPILPQX51)n (SEQ ID NO: 68), где n представляет собой целое число, выбранное из группы, состоящей из 1, 2, 3 и 4, и X50 и X51 независимо выбраны из аргинина и лизина.

В одном из вариантов осуществления пептид CTP содержит последовательность SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68), где X50 и X51 независимо выбраны из аргинина и лизина. В другом варианте осуществления пептид CTP содержит последовательность, выбранную из группы, состоящей из SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) или SSSSRAPPPSLPSPSRLPGPSDTPILPQ (SEQ ID NO: 67), и в дополнительном варианте осуществления пептид CTP содержит последовательность SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 53).

Гликозилирование

В момент продукции in vivo белка аналоги инсулина, содержащие участки гликозилирования, могут претерпевать дополнительную обработку, известную как посттрансляционная модификация, где остатки сахара (гликозил) могут добавляться ферментативно в процессе, известном как гликозилирование. Получаемые белки, несущие ковалентно связанные олигосахаридные боковые цепи, известны как гликозилированные белки или гликопротеины. Таким образом, белок, который несет участок гликозилирования, не обязательно является гликозилированным. Один из вариантов осуществления относится к аналогам агонистов инсулина, которые модифицировали, чтобы они содержали пептидную последовательность, которая может подвергаться гипергликозилированию, при экспрессии в эукариотической экспрессирующей системе.

Ненативные и нативные последовательности гликозилирования известны специалистам в данной области и включают N-связанные участки гликозилирования, и O-связанные участки гликозилирования. N-связанные участки гликозилирования представляют собой пептидные последовательности, которые служат в качестве участков распознавания для ферментативного присоединения углеводной группы к боковой цепи остатка аспарагина. Трипептидные O-связанные последовательности гликозилирования включают аспарагин-X-серин и аспарагин-X-треонин, где X представляет собой любую аминокислоту за исключением пролина. Таким образом, наличие любой из этих трипептидных последовательностей в полипептиде создает потенциальный участок гликозилирования. O-связанное гликозилирование представляет собой пептидные последовательности, которые служат в качестве участков распознавания для ферментативного присоединения углеводной группы к боковой цепи гидроксиаминокислоты, как правило, серина или треонина, хотя также можно использовать 5-гидроксипролин или 5-гидроксилизин. В одном из вариантов осуществления сахар O-связанного гликозилирования представляет собой N-ацеилгалактозамин, галактозу или ксилозу. Ряд участков O-связанного гликозилирования хорошо известен в данной области и описан в литературе. См., например, Ten Hagen et al., (11029) J. Biol. Chem., 274(39): 27867-74; Hanisch et al., (2001) Glycobiology 11:731-740; и Ten Hagen et al., (2003) Glycobiology, 13:1R-16R.

Одним из вариантов осуществления относится к способу получения гипергликозилированного аналога инсулина. Способ включает предоставление эукариотической клетки-хозяина, которая содержит ген, кодирующий аналог инсулина, который модифицировали, чтобы он содержал ненативный участок гликозилирования (например, последовательность пептида CTP), и культивирование клетки в условиях, которые обеспечивают экспрессию гена аналога инсулина. В одном из вариантов осуществления клетка-хозяин экспрессирует ферменты гликозилирования человека, таким образом, что гликозилированные белки (гликопротеины), продуцируемые в клетке-хозяине, обладают профилем гликозилирования белка, идентичным профилю гликирования клеток человека (см. публикации патентных заявок США № 2004/0018590 и 2002/0137134, описания которых включено в настоящее описание посредством ссылки). В соответствии с одним из вариантов осуществления эукариотическую клетку-хозяина выбирают из дрожжей (например, Pichiapastoris) или клеток млекопитающего (CHO или HEK293).

Один из вариантов осуществления относится к аналогу инсулина, где в инсулиновый пептид вводили участок гликозилирования. Один из вариантов осуществления относится к аналогу инсулина, двухцепочечном или одноцепочечному аналогу, где пептид, содержащий участок гликозилирования, связывали с C-концом B-цепи инсулина. Один из вариантов осуществления относится к одноцепочечному аналогу инсулина, содержащему связывающую группу, которая ковалентно связывает карбокси-конец B-цепи инсулина с амино-концом A-цепи инсулина, где связывающая группа содержит аминокислотную последовательность длиной более 18 остатков и содержит один или более участков гликозилирования. Дополнительный вариант осуществления относится к аналогу инсулина, содержащему две пептидные последовательности, каждая из которых содержит по меньшей мере один участок гликозилирования (такой же или отличный). В одном из вариантов осуществления первая пептидная последовательность, содержащая участок гликозилирования, является связанной с N-концом B-цепи, и вторая пептидная последовательность, содержащая участок гликозилирования, является связанной с C-концом A- или B-цепи. В одном из вариантов осуществления аналог инсулина представляет собой одноцепочечный аналог, где связывающая группа, соединенная с B- и A-цепями, содержит вторую пептидную последовательность.

В одном из вариантов осуществления участок гликозилирования вводят путем добавления аминокислотных последовательностей к основному аналогу инсулина. Более конкретно, заявители открыли, что пептидную последовательность, называемую C-концевым пептидом (CTP: SSSSKAPPPSLPSPSRLPGPSDTPILPQR; SEQ ID NO: 52), которая может подвергаться O-связанному гипергликозилированию, когда белок экспрессируется в экспрессирующей системе на основе эукариотических клеток, можно ковалентно связывать с аналогом инсулина, не нарушая собственную активность in vitro аналога инсулина.

Один из вариантов осуществления относится к аналогу инсулина, содержащему A-цепь и B-цепь, и пептид CTP, где пептид CTP представляет собой пептид, обладающий по меньшей мере 60, 70, 80, 85, 90 или 95% идентичностью последовательности с (SEQ ID NO: 52). В одном из вариантов осуществления пептид CTP представляет собой пептид, содержащий последовательность длиной от 18 до 29 аминокислот, которая обладает по меньшей мере 80, 82, 84, 86, 88, 90, 92, 94, 96 или 98% идентичностью последовательности с областью от 18 до 29 аминокислот (SEQ ID NO: 52). В одном из вариантов осуществления пептид CTP содержит аналог (SEQ ID NO: 52), где указанный аналог отличается от (SEQ ID NO: 52) на 1, от 1 до 2, от 3 до 4, от 4 до 6 или до 8 замен аминокислот. В одном из вариантов осуществления замена аминокислоты находится в одном или более положений, выбранных из 1-4, 7-15, 18, 20, 21, 24 и 27 (SEQ ID NO: 52). В одном из вариантов осуществления замена аминокислоты находится в одном или более положений, выбранных из 1, 2, 3, 4, 10, 13, 15 и 21 (SEQ ID NO: 52). В одном из вариантов осуществления замена аминокислоты находится в одном или более положений, выбранных из 7, 8, 9, 12, 14, 18, 20, 24 и 27 (SEQ ID NO: 52). В одном из вариантов осуществления пептид CTP содержит последовательность длиной 29 аминокислот, которая отличается от SEQ ID NO: 68 на 1-2 замены аминокислот. В дополнительном варианте осуществления пептид CTP содержит фрагмент SEQ ID NO: 52, где фрагмент представляет собой непрерывную аминокислотную последовательность от 18 до 28 аминокислот, идентичную аминокислотной последовательности, содержащейся в SEQ ID NO: 52. В одном из вариантов осуществления пептид CTP состоит из SEQ ID NO: 68, SEQ ID NO: 52 или SEQ ID NO: 51.

В соответствии с одним из вариантов осуществления пептид CTP содержит пептидные последовательности SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68), где X50 и X51 независимо представляют собой аргинин или лизин, или пептид, который отличается от SSSSX50APPPSLPSPSRLPGPSDTPILPQX51 (SEQ ID NO: 68) на одну или две модификации аминокислот. В одном из вариантов осуществления пептид CTP представляет собой аминокислотную последовательность длиной 29 аминокислот, содержащую последовательность, выбранную из группы, состоящей из SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52) и SSSSRAPPPSLPSPSRLPGPSDTPILPQ (SEQ ID NO: 67). В одном из вариантов осуществления пептид CTP содержит последовательность (SSSSX50APPPSLPSPSRLPGPSDTPILPQX51)n (SEQ ID NO: 68), где n представляет собой целое число, выбранное из группы, состоящей из 1, 2, 3 и 4, и в дополнительном варианте осуществления n представляет собой 1 или 2. В дополнительном варианте осуществления первый пептид CTP связан с N-концом B-цепи, и второй CTP пептид связан с C-концом B-цепи, где первый и второй пептиды CTP содержат последовательности, независимо выбранные из группы, состоящей из SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 68 и SEQ ID NO: 67.

Непептидные линкеры

В одном из вариантов осуществления связывающая группа представляет собой относительно короткий бифункциональный непептидный полимерный линкер, длина которого приблизительно составляет длину аминокислотной последовательности из 8-16 аминокислот. В соответствии с одним из вариантов осуществления непептидная связывающая группа представляет собой линкер на основе полиэтиленгликоля приблизительно от 4 до 20, от 8 до 18, от 8 до 16, от 8 до 14, от 10 до 14, от 10 до 12 или от 11 до 13 мономеров. Один из вариантов осуществления относится к одноцепочечному агонисту инсулина, где удаляют последние пять карбокси-концевых аминокислот нативной B-цепи, и аминокислоту B25 непосредственно связывают со связывающей группой ковалентной связью. Второй конец связывающей группы является ковалентно связанными с аминокислотой A1 A-цепи, таким образом, связывая B- и A-цепь через связывающую группу. В одном из вариантов осуществления связывающая группа представляет собой линейную связывающая группа на основе полиэтиленгликоля, содержащую по меньшей мере 10, но не более 16 мономерных единиц, и в другом варианте осуществления связывающая группа на основе полиэтиленгликоля содержит по меньшей мере 12, но не более 16 мономерных единиц, и в дополнительном варианте осуществления связывающая группа на основе полиэтиленгликоля содержит по меньшей мере 10, но не более 14 мономерных единиц.

В соответствии с одним из вариантов осуществления полиэтиленгликоль связывающая группа содержит структуру:

,

где m представляет собой целое число в диапазоне от 6 до 18, от 8 до 16, от 10 до 14 или от 11 до 13. В одном из вариантов осуществления m представляет собой целое число, выбранное из 10, 11, 12, 13 или 14. В одном из вариантов осуществления m равно 12.

Один из вариантов осуществления относится к одноцепочечному агонисту инсулина, где удаляют последние пять карбокси-терминальных аминокислот нативной B-цепи и аминокислоту B25 связывают с аминокислотой A1 A-цепи через связывающую группу, содержащую полиэтиленгликоль по меньшей мере 8, но не более 16 мономерных единиц, и аминокислотную последовательность от одной до четырех аминокислот. В соответствии с одним из вариантов осуществления связывающая группа содержит аминокислотную последовательность длиной 1-4 аминокислот и линейный полиэтиленгликоль длиной по меньшей мере 8, но менее 14 мономерных единиц, ковалентно связанный с указанной аминокислотной последовательностью длиной 1-4 аминокислоты при условии, что аминокислотная последовательность не является YTPK (SEQ ID NO: 70) или FNKP (SEQ ID NO: 71). Другой вариант осуществления относится к одноцепочечному агонисту инсулина, где удаляют последние пять карбокси-концевые аминокислоты нативной B-цепи и аминокислоту 25 связывают с аминокислотой A1 A-цепи через связывающую группу, содержащую полиэтиленгликоль длиной по меньшей мере 8, но менее 14 мономерных единиц и аминокислотную последовательность длиной 2-5 аминокислот. Аминокислотная последовательность длиной 2-5 аминокислот может располагаться между B-цепью и цепью полиэтиленгликоля или между A-цепью и цепь полиэтиленгликоля. Однако когда 2-5 аминокислотная последовательность располагается между B-цепью и цепью полиэтиленгликоля, аминокислотная последовательность не является YTPKT (SEQ ID NO: 16) или FNKPT (SEQ ID NO: 76).

В одном из вариантов осуществления связывающая группа содержит общая структура: W1-Z1-Y1, где

W1 и Y1 независимо представляют собой связь, X46,X46X47,X46X47X48,X46X47X48X49 (SEQ ID NO: 24) или X46X47X48X49X50 (SEQ ID NO: 13), при условии, что W1 не является YTPK (SEQ ID NO: 70) или FNKP (SEQ ID NO: 71), и Z1 представляет собой полиэтиленгликоль общей структуры

,

где m представляет собой целое число в диапазоне от 6-14, и каждый из X46, X47, X48, X49 и X50 независимо представляют собой любую аминокислоту. В одном из вариантов осуществления X46, X47, X48, X49 и X50 независимо представляют собой любую ненативную аминокислоту относительно положений B26-B30 инсулина или IGF-1. В одном из вариантов осуществления X46, X47, X48 и X50 независимо выбраны из группы, состоящей из глицина, аланина, валина, лейцина, изолейцина, серина, треонина и пролина, и в дополнительном варианте осуществления X46, X47, X48, X49 и X50 независимо выбраны из группы, состоящей из глицина, аланина, валина, лейцина и изолейцина. В одном из вариантов осуществления W1 представляет собой связь, и Y1 представляет собой X46, X46X47 или X46X47X48 (SEQ ID NO: 15), где каждый X46, X47 и X48 представляет собой аланин, и Z представляет собой полиэтиленгликоль длиной 4-14 мономерных единиц. В одном из вариантов осуществления Y1 представляет собой связь, и W1 представляет собой X46, X46X47 или X46X47X48 (SEQ ID NO: 15), где каждый из X46, X47 и X48 представляет собой аланин, и Z представляет собой полиэтиленгликоль длиной 4-14 мономерных единиц.

Один из вариантов осуществления относится к одноцепочечному аналогу инсулина, содержащему A-цепь и усеченную с C-конца B-цепь, в которой удалены аминокислоты B26-B30 (относительно нативной последовательности инсулина), где указанная A-цепь и B-цепь представляют собой последовательности инсулина человека или их аналоги или производные, кроме того, где C-конец аминокислоты B25 B-цепи является непосредственно связанным с первым концом связывающей группы, и второй конец связывающей группы является непосредственно связанным с амино-концом аминокислоты A1 A-цепи. В одном из вариантов осуществления усеченная B-цепь содержит последовательность SEQ ID NO: 20, где аминокислота B25 является непосредственно связанной с N-концом связывающего пептида. В этом варианте осуществления связывающая группа содержит любой из:

a) полиэтиленгликоля длиной 6-16 мономерных единиц;

b) ненативной аминокислотной последовательности длиной по меньшей мере 8 аминокислот и не более 17 аминокислота, или

c) комбинации указанного полиэтиленгликоля и ненативной аминокислотной последовательности от 1 до 4 аминокислот;

Пегилирование инсулиновых пептидов

Заявители открыли, что ковалентная связь гидрофильной группы с одноцепочечными аналогами инсулина, описываемыми в настоящем описании, обеспечивает аналоги с более медленным началом действия, увеличенной продолжительностью действия, и проявляет исходный профиль активности. В одном из вариантов осуществления инсулиновые пептиды, описываемые в настоящем описании, дополнительно модифицируют, чтобы они содержали гидрофильную группу, ковалентно связанную с боковой цепью аминокислоты в положении, выбранном из группы, состоящей из A9, A14 и A15 A-цепи, или в N-концевом альфа-амине B-цепи (например, в положении B1 для B-цепи на основе инсулина или положении B2 для B-цепи на основе IGF-1) или с боковой цепи аминокислоты в положении B1, B2, B10, B22, B28 или B29 B-цепи или любом положении связывающей группы, которая связывает A-цепь и B-цепь. В иллюстративных вариантах осуществления такая гидрофильная группа ковалентно связана с остатком Lys, Cys, Orn, гомоцистеина или ацетилфенилаланина а любом из этих положений. В одном из вариантов осуществления гидрофильная группа ковалентно связана с боковой цепью связывающей группы аминокислоты.

Иллюстративные гидрофильные группы включают полиэтиленгликоль (PEG), например, молекулярной массы приблизительно от 1000 Дальтон приблизительно до 40000 Дальтон или приблизительно от 20000 Дальтон приблизительно до 40000 Дальтон. Дополнительные подходящие гидрофильные группы включают полипропиленгликоль, полиоксиэтилированные полиолы (например, POG), полиоксиэтилированные сорбит, полиоксиэтилированную глюкозу, полиоксиэтилированный глицерин (POG), полиоксиалкилены, полиэтиленгликольпропиональдегид, сополимеры этиленгликолья/пропиленгликоля, монометоксиполиэтиленгликоль, моно(C1-C10)алкоксиполиэтиленгликоль или арилоксиполиэтиленгликоль, карбоксиметилцеллюлозу, полиацетали, поливиниловый спирт (PVA), поливинилпирролидон, поли-1,3-диоксолан, поли-1,3,6-триоксан, сополимер этилена/малеинового ангидрида, поли(бета-аминокислоты) (гомополимеры или статистические сополимеры), поли(н-винилпирролидон)полиэтиленгликоль, гомополимеры пропропиленгликоля (PPG) и другие полиалкиленоксиды, сополимеры полипропиленоксида/этиленоксида, кишечные кислоты или другие полисахаридные полимеры, фиколл или декстран и их смеси.

В соответствии с некоторыми вариантами осуществления гидрофильная группа, например, цепь полиэтиленгликоля имеют молекулярную массу, выбранную из диапазона приблизительно от 500 приблизительно до 40000 Дальтон. В одном из вариантов осуществления гидрофильная группа, например, PEG, имеет молекулярную массу, выбранную из диапазона приблизительно от 500 приблизительно до 5000 Дальтон или приблизительно от 1000 приблизительно до 5000 Дальтон. В другом варианте осуществления гидрофильная группа, например, PEG, имеет молекулярную массу приблизительно от 10000 приблизительно до 20000 Дальтон. В еще одном другом иллюстративном варианте осуществления гидрофильная группа, например, PEG, имеет молекулярную массу приблизительно от 20000 приблизительно до 40000 Дальтон. В одном из вариантов осуществления гидрофильная группа, например, PEG, имеет молекулярную массу приблизительно 20000 Дальтон. Один из вариантов осуществления относится к инсулиновому пептиду, где одна или более аминокислот аналога являются пегилированными, и общая молекулярная масса ковалентно связанных цепей PEG составляет приблизительно 20000 Дальтон.

В одном из вариантов осуществления в качестве гидрофильной группы используют декстраны. Декстраны представляют собой полисахаридные полимеры субъединиц глюкозы, преимущественно связанных α1-6-связями. Декстран является доступным во многих диапазонах молекулярных масс, например, приблизительно от 1 кДа приблизительно до 100 кДа или приблизительно от 5, 10, 15 или 20 кДа приблизительно до 20, 30, 40, 50, 60, 70, 80 или 90 кДа.

Предусматривают линейные или разветвленные полимеры. Получаемые препараты конъюгатов могут по существу являться монодисперсными или полидисперсными и могут содержать приблизительно 0,5, 0,7, 1, 1,2, 1,5 или 2 полимерные группы на пептид.

В одном из вариантов осуществления гидрофильная группа представляет собой цепь полиэтиленгликоля (PEG), необязательно связанную с боковой цепью аминокислоты в положении, выбранном из группы, состоящей из A9, A14 и A15 A-цепи, положениях B1, B2, B10, B22, B28 или B29 B-цепи, в N-концевом альфа-амине B-цепи, или в любом положении связывающей группы одноцепочечного аналога инсулина, которая связывает A-цепь и B-цепь, включая, например, в положении C8. В одном из вариантов осуществления одноцепочечный аналог инсулина содержит пептидную связывающую группу от 8 до 12 аминокислот, где одна из аминокислот связывающей группы содержит полиэтиленовую цепь, ковалентно связанную с ее боковой цепью. В одном из вариантов осуществления одноцепочечный аналог инсулина содержит пептидную связывающую группу от 8 до 12 аминокислот, где аминокислота связывающей группы является пегилированной, и одна или более аминокислот в положении, выбранном из группы, состоящей из A9, A14 и A15 A-цепи, положениях B1, B2, B10, B22, B28 или B29 B-цепи также являются пегилированными. В одном из вариантов осуществления общая молекулярная масса ковалентно связанной цепи(ей) PEG составляет приблизительно 20000 Дальтон.

В одном из вариантов осуществления одноцепочечный аналог инсулина содержит связывающую группу от 8 до 12 аминокислот, где одна из аминокислот связывающей группы содержит полиэтиленовая цепь 20000 Дальтон, ковалентно связанную с ее боковой цепью. В другом варианте осуществления аналог инсулина содержит пептидную связывающую группу от 8 до 12 аминокислот, где одна из аминокислот связывающей группы содержит полиэтиленовая цепь, ковалентно связанную с ее боковой цепью, и вторая цепь PEG является связанной с N-концевым альфа-амином B-цепи (например, в положении B1 для B-цепи на основе инсулина или положении B2 для B-цепи на основе IGF-1) или с боковой цепью аминокислоты в положении B1, B2 и B29 B-цепи. В одном из вариантов осуществления, когда две цепи PEG являются связанными с инсулиновым пептидом, каждая цепь PEG имеет молекулярную массу приблизительно 10000 Дальтон. В одном из вариантов осуществления, когда цепь PEG является связанной со связывающей группой от 8 до 12 аминокислот, цепь PEG связывают в положении C7 или C8 связывающей группы, и в одном из вариантов осуществления цепь PEG связывают в положении C8 связывающей группы. В одном из вариантов осуществления, две цепи PEG связывают с одноцепочечным аналогом инсулина, где одна цепь PEG является связанной в положении C8, и вторая PEG является связанной в A9, A14, A15, B1, B2, B10, B22, B28 или B29.

Гидрофильные группы, такие как полиэтиленгликоль можно присоединять к конъюгату родственный глюкагону пептид-инсулин в любых подходящих условиях, используемых для взаимодействия белка с активированной молекулой полимера. Можно использовать любые средства, известные в данной области, включая посредством ацилирования, восстановительного алкилирования, реакцию присоединения Михаэля, алкилирование тиолов или другие способы хемоселективной конъюгации/лигирования через реакционноспособную группу на молекуле PEG (например, альдегидной, амино-, сложноэфирной, тиольной, α-галоацетильной, малеимидо- или гидразиногруппе) с реакционноспособной группой на целевом соединении (например, альдегидной, амино-, сложноэфирной, тиольной, α-галоацетильной, малеимидо- или гидразиногруппой). Активирующие группы, которые можно использовать для связывания водорастворимого полимера с одним или более белками, включают без ограничения сульфон, малеинимид, сульфгидрил, тиол, трифлат, трезилат, азадирин, оксиран и 5-пиридил. В случае присоединения к пептиду восстановительным алкилирование выбранный полимер должен содержать один реактивный альдегид, таким образом, что можно регулировать степень полимеризации. См., например, Kinstler et al., Adv. Drug. Delivery Rev., 54: 477-485 (2002); Roberts et al., Adv. Drug Delivery Rev., 54: 459-476 (2002); и Zalipsky et al., Adv. Drug Delivery Rev., 16: 157-182 (1995).

Ацилирование

В некоторых вариантах осуществления аналог инсулина модифицируют, чтобы он содержал ацильную группу. Ацильную группу можно ковалентно связывать непосредственно с аминокислотой конъюгата родственный глюкагону пептид-инсулин или непосредственно с аминокислотой конъюгата родственный глюкагону пептид-инсулин через спейсер, где спейсер располагается между аминокислотой конъюгата родственный глюкагону пептид-инсулин и ацильной группой. Конъюгат родственный глюкагону пептид-инсулин можно подвергать ацилированию в определенном положении аминокислоты, где связана гидрофильная группа, или в другом положении аминокислоты. Например, ацилирование можно проводить в любом положении, включая любые аминокислоты A- или B-цепи, а также положении в связывающей группе при условии, что после ацилирования сохраняется активность, проявляемая неацилированным конъюгатом родственный глюкагону пептид-инсулин. Неограничивающие примеры включают ацилирование в положениях A14 и A15 A-цепи, положении B1 для B-цепи на основе инсулина или положении B2 для B-цепи на основе IGF-1, или положениях B10, B22, B28 или B29 B-цепи, или в любом положении связывающей группы.

В одном из конкретных аспектов изобретения аналог инсулина модифицируют, чтобы он содержал ацильную группу, прямым ацилированием амина, гидроксила или тиола боковой цепи аминокислоты конъюгата родственный глюкагону пептид-инсулин. В некоторых вариантах осуществления аналог инсулина непосредственно ацилируют через амин, гидроксил или тиол боковой цепи аминокислоты. В некоторых вариантах осуществления ацилирование проводят в положении B28 или B29 (в соответствии с нумерацией аминокислот нативного инсулина последовательностей A- и B-цепи). В отношении этого можно предоставлять аналог инсулина, который модифицировали одной или более заменами аминокислот в последовательности A- или B-цепи, включая, например, в положениях A14, A15, B1, B2, B10, B22, B28 или B29 (в соответствии с нумерацией аминокислот нативного инсулина последовательностей A- и B-цепи) или в любом положении связывающей группы с аминокислотой, содержащей амин, гидроксил или тиол боковой цепи. В некоторых конкретных вариантах осуществления изобретения прямое ацилирование инсулинового пептида проводят через амин, гидроксил или тиол боковой цепи аминокислоты в положении B28 или B29 (в соответствии с нумерацией аминокислот нативного инсулина последовательностей A- и B-цепи).

В соответствии с одним из вариантов осуществления ацилированные аналоги инсулина содержат спейсер между пептидом и ацильной группой. В некоторых вариантах осуществления конъюгат родственный глюкагону пептид-инсулин ковалентно связывают со спейсером, который является ковалентно связанным с ацильной группой. В некоторых иллюстративных вариантах осуществления инсулиновый пептид модифицируют, чтобы он содержал ацильную группу, ацилированием амина, гидроксила или тиола спейсера, где спейсер присоединяют к боковой цепи аминокислоты в положении B28 или B29 (в соответствии с нумерацией аминокислот A- или B-цепи нативного инсулина) или в любом положении спейсерной группы. Аминокислота конъюгата родственный глюкагону пептид-инсулин, к которой присоединяют спейсер, может представлять собой любую аминокислоту, содержащую группу, которая обеспечивает связывание со спейсером. Например, подходящей является аминокислота, содержащая боковую цепь -NH2, -OH, или -COOH (например, Lys, Orn, Ser, Asp или Glu).

В некоторых вариантах осуществления спейсер между конъюгатом родственный глюкагону пептид-инсулин и ацильной группой представляет собой аминокислоту, содержащую амин, гидроксил или тиол боковой цепи (или дипептид или трипептид, содержащий аминокислоту, содержащую амин, гидроксил или тиол боковой цепи). В некоторых вариантах осуществления спейсер содержит гидрофильный бифункциональный спейсер. В конкретном варианте осуществления спейсер содержит аминополи(алкилокси)карбоксилат. В связи с этим, спейсер может содержать, например, NH2(CH2CH2O)n(CH2)mCOOH, где m представляет собой любое целое число от 1 до 6, и n представляет собой целое число от 2 до 12, такую как, например, 8-амино-3,6-диоксаоктановая кислота, которая является коммерчески доступной от Peptides International, Inc. (Louisville, KY). В одном из вариантов осуществления гидрофильный бифункциональный спейсер содержит два или более реакционноспособные группы, например, амино-, гидроксильную, тиоловую и карбоксильную группу или любые их комбинации. В определенных вариантах осуществления гидрофильный бифункциональный спейсер содержит гидроксильную группу и карбоксилат. В других вариантах осуществления гидрофильный бифункциональный спейсер содержит аминогруппу и карбоксилат. В других вариантах осуществления гидрофильный бифункциональный спейсер содержит тиоловую группу и карбоксилат.

В некоторых вариантах осуществления спейсер между пептидным конъюгатом родственный глюкагону пептид-инсулин и ацильной группой представляет собой гидрофобный бифункциональный спейсер. Гидрофобные бифункциональные спейсеры известны в данной области. См., например, Bioconjugate Techniques, G.T. Hermanson (Academic Press, San Diego, CA, 1996), которая полностью включена посредством ссылки. В соответствии с определенными вариантами осуществления бифункциональный спейсер может представлять собой синтетическую или природную аминокислоту, содержащую аминокислотный остов, длина которого составляет от 3 до 10 атомов (например, 6-аминогексановую кислоту, 5-аминовалериановую кислоту, 7-аминогептановую кислоту и 8-аминооктановую кислоту). Альтернативно, спейсер может представлять собой дипептидный или трипептидный спейсер, содержащий пептидный остов, длина которого составляет от 3 до 10 атомов (например, от 6 до 10 атомов). Каждую аминокислоту дипептидного или трипептидного спейсера, присоединенную к конъюгату родственный глюкагону пептид-инсулин, можно независимо выбирать из группы, состоящей из: природных и/или неприродных аминокислот, включая, например, любой из D- или L-изомеров природных аминокислот (Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Arg, Ser, Thr, Val, Trp, Tyr), или любые D- или L-изомеры неприродных аминокислот, выбранных из группы, состоящей из: β-аланина (β-Ala), N-α-метилаланина (Me-Ala), аминомасляной кислоты (Abu), α-аминомасляной кислоты (γ-Abu), аминогексановой кислоты (ε-Ahx), аминоизомасляной кислоты (Aib), аминометилпирролкарбоновой кислоты, аминопиперидинкарбоновой кислоты, аминосерина (Ams), аминотетрагидропиран-4-карбоновой кислоты, аргинин-N-метокси-N-метиламида, β-аспарагиновой кислоты (β-Asp), азетидинкарбоновой кислоты, 3-(2-бензотиазолил)аланина, α-трет-бутилглицин, 2-амино-5-уреидо-н-валериановой кислоты (цитруллина, Cit), β-циклогексилаланина (Cha), ацетамидометилцистеина, диаминомасляной кислоты (Dab), диаминопропионовой кислоты (Dpr), дигидроксифенилаланина (DOPA), диметилтиазолидина (DMTA), γ-глутаминовой кислоты (γ-Glu), гомосерина (Hse), гидроксипролина (Hyp), N-метокси-N-метиламида изолейцина, метилизолейцина (MeIle), изонипекотиновой кислоты (Isn), метиллейцина (MeLeu), метиллизина, диметиллизина, триметиллизина, метанопролина, метионинсульфоксида (Met(O)), метионинсульфона (Met(O2)), норлейцина (Nle), метилнорлейцина (Me-Nle), норвалина (Nva), орнитина (Orn), парааминобензойной кислоты (PABA), пеницилламина (Pen), метилфенилаланина (MePhe), 4-хлорфенилаланина (Phe(4-Cl)), 4-фторфенилаланина (Phe(4-F)), 4-нитрофенилаланина (Phe(4-NO2)), 4-цианофенилаланина ((Phe(4-CN)), фенилглицина (Phg), пиперидинилаланина, пиперидинилглицина, 3,4-дегидропролина, пирролидинилаланина, саркозина (Sar), селеноцистеина (Sec), U-бензилфосфосерина, 4-амино-3-гидрокси-6-метилгептановой кислоты (Sta), 4-амино-5-циклогексил-3-гидроксипентановой кислоты (ACHPA), 4-амино-3-гидрокси-5-фенилпентановой кислоты (AHPPA), 1,2,3,4-тетрагидроизохинолин-3-карбоновой кислоты (Tic), тетрагидропиранглицина, тиенилаланина (Thi), U-бензилфосфотирозина, O-фосфотирозина, метокситирозина, этокситирозина, O-(бис-диметиламинофосфоно)тирозина, тирозинсульфата тетрабутиламина, метилвалина (MeVal), 1-амино-1-циклогексанкарбоновой кислоты (Acx), аминовалериановой кислоты, бета-циклопропилаланина (Cpa), пропаргилглицина (Prg), аллилглицина (Alg), 2-амино-2-циклогексилпропановой кислоты (2-Cha), трет-бутилглицина (Tbg), винилглицина (Vg), 1-амино-1-циклопропанкарбоновой кислоты (Acp), 1-амино-1-циклопентанкарбоновой кислоты (Acpe) и алкилированной 3-меркаптопропионовой кислоты, 1-амино-1-циклобутанкарбоновой кислоты (Acb). В некоторых вариантах осуществления дипептидный спейсер выбран из группы, состоящей из: Ala-Ala, β-Ala-β-Ala, Leu-Leu, Pro-Pro, γ-аминомасляной кислоты-γ-аминомасляной кислоты и γ-Glu-γ-Glu.

Пептидный конъюгат родственный глюкагону пептид-инсулин можно модифицировать, чтобы он содержал ацильную группу, ацилированием длинноцепочечного алкана любого размера, и он может содержать углеродную цепь любой длины. Длинноцепочечный алкан может быть линейным или разветвленным. В определенных аспектах длинноцепочечный алкан представляет собой C4-C30алкан. Например, длинноцепочечный алкан может представлять собой любой из C4алкана, C6алкана, C8алкана, C10алкана, C12алкана, C14алкана, C16алкана, C18алкана, C20алкана, C22алкана, C24алкана, C26алкана, C28алкана или C30алкана. В некоторых вариантах осуществления длинноцепочечный алкан содержит C8-C20алкан, например, C14алкан, C16алкан или C18алкан.

В некоторых вариантах осуществления амино-, гидроксильную или тиоловую группу конъюгата родственный глюкагону пептид-инсулин подвергают ацилированию холестериновой кислотой. В конкретном варианте осуществления пептид связывают с холестериновой кислотой чрез алкилированный дезамино-Cys-спейсер, т.е. спейсер на основе алкилированной 3-меркаптопропионовой кислоты. Подходящие способы пептидного ацилирования через амины, гидроксилы и тиолы известны в данной области. См., например, Miller, Biochem. Biophys. Res. Commun., 218: 377-382 (1996); Shimohigashi and Stammer, Int. J. Pept. Protein Res., 19: 54-62 (1982) и Previero et al., Biochim. Biophys Acta 263: 7-13 (1972) (касательно способов ацилирования через гидроксил); и San and Silvius, J. Pept. Res., 66: 169-180 (2005) (касательно способов ацилирования через тиол); Bioconjugate Chem. "Chemical Modifications of Proteins: History and Applications" pages 1, 2-12 (1990); Hashimoto et al., Pharmacuetical Res. "Synthesis of Palmitoyl Derivatives of Insulin and their Biological Activity" Vol. 6, No: 2 pp.171-176 (1989).

Ацильная группа ацетилированного пептида конъюгат родственный глюкагону пептид-инсулин может быть любого размера, например, с любой длиной углеродной цепи и может быть линейной или разветвленной. В некоторых конкретных вариантах осуществления изобретения ацильная группа представляет собой C4-C30жирную кислоту. Например, ацильная группа может представлять собой любую из C4жирной кислоты, C6жирной кислоты, C8жирной кислоты, C10жирной кислоты, C12жирной кислоты, C14жирной кислоты, C16жирной кислоты, C18жирной кислоты, C20жирной кислоты, C22жирной кислоты, C24жирной кислоты, C26жирной кислоты, C28жирной кислоты или C30жирной кислоты. В некоторых вариантах осуществления ацильная группа представляет собой C8-C20жирную кислоту, например, C14жирную кислоту или C16жирную кислоту.

В альтернативном варианте осуществления ацильная группа представляет собой желчную кислоту. Желчная кислота может представлять собой любую из подходящих желчных кислот, включая, но, не ограничиваясь ими, холевую кислоту, хенодезоксихолевую кислоту, дезоксихолевую кислоту, литохолевую кислоту, таурохолевую кислоту, глюкохолевую кислоту и холестериновую кислоту.

Алкилирование

В некоторых вариантах осуществления конъюгат родственный глюкагону пептид-инсулин модифицируют, чтобы он содержал алкильную группу. Алкильную группу можно ковалентно связывать непосредственно с аминокислотой аналога инсулина или опосредовано с аминокислотой конъюгата родственный глюкагону пептид-инсулин через спейсер, где спейсер располагается между аминокислотой конъюгата родственный глюкагону пептид-инсулин и алкильной группы. Алкильную группу можно присоединять к конъюгату родственный глюкагону пептид-инсулин через простую эфирную, тиоэфирную или амидную связь. Например, конъюгат родственный глюкагону пептид-инсулин можно алкилировать по тому же положению аминокислоты, по которому связана гидрофильная группа, или по другому положению аминокислоты. Алкилирование можно проводить в любом положении в конъюгате родственный глюкагону пептид-инсулин, включая, например, по C-концевой области B-цепи или по положению в связывающей группе, при условии, что сохраняется активность инсулина. В конкретном аспекте по изобретению конъюгат родственный глюкагону пептид-инсулин модифицируют, чтобы он содержат алкильную группу, прямым алкилированием амина, гидроксила или тиола боковой цепи аминокислоты конъюгата родственный глюкагону пептид-инсулин. В некоторых вариантах осуществления конъюгат родственный глюкагону пептид-инсулин непосредственно алкилируют через амин, гидроксил, или тиол боковой цепи аминокислоты. В некоторых конкретных вариантах осуществления изобретения прямое алкилирование конъюгата родственный глюкагону пептид-инсулин проводят через амин, гидроксил или тиол боковой цепи аминокислоты в положении A14, A15, B1 (для B-цепей на основе инсулина), B2 (для B-цепей на основе IGF-1), B10, B22, B28 или B29 (в соответствии с нумерацией аминокислот A- и B-цепи нативного инсулина).

В некоторых вариантах осуществления изобретения конъюгат родственный глюкагону пептид-инсулин содержит спейсер между пептидом и алкильной группой. В некоторых вариантах осуществления конъюгат родственный глюкагону пептид-инсулин является ковалентно связанным со спейсером, который является ковалентно связанным с алкильной группой. В некоторых иллюстративных вариантах осуществления конъюгат родственный глюкагону пептид-инсулин модифицируют, чтобы он содержал алкильную группа, алкилированием амина, гидроксила или тиола спейсера, где спейсер присоединяют к боковой цепи аминокислоты в положении A14, A15, B1 (для B-цепей на основе инсулина), B2 (для B-цепей на основе IGF-1), B10, B22, B28 или B29 (в соответствии с нумерацией аминокислот A- и B-цепей нативного инсулина). Аминокислота конъюгата родственный глюкагону пептид-инсулин, к которой присоедини спейсер, может представлять собой любую аминокислоту (например, однократно α-замещенную аминокислоту или α,α-двузамещенную аминокислоту), содержащую группа, которая обеспечивает связывание со спейсером. Подходящей является аминокислота конъюгата родственный глюкагону пептид-инсулин, содержащая боковую цепь -NH2, -OH, или -COOH (например, Lys, Orn, Ser, Asp, или Glu). В некоторых вариантах осуществления спейсер между пептидом конъюгат родственный глюкагону пептид-инсулин и алкильной группой представляет собой аминокислоту, содержащую амин, гидроксил или тиол боковой цепи, или дипептид или трипептид, содержащий аминокислоту, содержащую амин, гидроксил или тиол боковой цепи.

В случае, когда алкилирование проводят по альфа-амину, спейсерная аминокислота может представлять собой любую аминокислоту. Например, спейсерная аминокислота может представлять собой гидрофобную аминокислоту, например, Gly, Ala, Val, Leu, Ile, Trp, Met, Phe, Tyr. Альтернативно, спейсерная аминокислота может представлять собой кислый остаток, например, Asp и Glu. В иллюстративных вариантах осуществления спейсерная аминокислота может представлять собой гидрофобную аминокислоту, например, Gly, Ala, Val, Leu, Ile, Trp, Met, Phe, Tyr, 6-аминогексановую кислоту, 5-аминовалериановую кислоту, 7-аминогептановую кислоту, 8-аминооктановую кислоту. Альтернативно, спейсерная аминокислота может представлять собой кислый остаток, например, Asp и Glu, при условии, что алкилирование проводят по альфа-амину кислого остатка. В случае, когда алкирование проводят по амин боковой цепи спейсерной аминокислоты, спейсерная аминокислота представляет собой аминокислоту, содержащую амин боковой цепи, например, аминокислоту формулы I (например, Lys или Orn). В этом случае можно проводить алкилирование по альфа-амину и амину боковой цепи спейсерной аминокислоты, таким образом, что пептид является диалкилированным. Варианты осуществления изобретения включают такие диалкилированные молекулы.

В некоторых вариантах осуществления спейсер содержит гидрофильный бифункциональный спейсер. В конкретном варианте осуществления спейсер содержит аминополи(алкилокси)карбоксилат. В отношении этого, спейсер может содержать, например, NH2(CH2CH2O)n(CH2)mCOOH, где m представляет собой любое целое число от 1 до 6, и n представляет собой любое целое число от 2 до 12, такую как, например, 8-амино-3,6-диоксаоктановую кислоту, которая является коммерчески доступной от Peptides International, Inc. (Louisville, KY). В некоторых вариантах осуществления спейсер между пептидом конъюгатом родственный глюкагону пептид-инсулин и алкильной группой представляет собой гидрофильный бифункциональный спейсер. В определенных вариантах осуществления гидрофильный бифункциональный спейсер содержит две или более реакционноспособные группы, например, амино-, гидроксильную, тиольную и карбоксильную группу или любые их комбинации. В определенных вариантах осуществления гидрофильный бифункциональный спейсер содержит гидроксильную группу и карбоксилат. В других вариантах осуществления гидрофильный бифункциональный спейсер содержит аминогруппу и карбоксилат. В других вариантах осуществления гидрофильный бифункциональный спейсер содержит тиольную группу и карбоксилат.

Длина спейсера (например, аминокислоты, дипептида, трипептида, гидрофильного бифункционального спейсера или гидрофобного бифункционального спейсера) составляет от 3 до 10 атомов (например, от 6 до 10 атомов, (например, 6, 7, 8, 9 или 10 атомов)). В некоторых конкретных вариантах осуществления длина спейсера составляет приблизительно от 3 до 10 атомов (например, от 6 до 10 атомов), и алкил представляет собой C12-C18алкильную группу, например, C14алкильную группу, C16алкильную группу, таким образом, что общая длина спейсера и алкильной группы составляет от 14 до 28 атомов, например, приблизительно 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 или 28 атомов. В некоторых вариантах осуществления длина спейсера и алкила составляет от 17 до 28 (например, 19 до 26, 19 до 21) атомов.

В соответствии с одним из вариантов осуществления бифункциональный спейсер представляет собой синтетическую или неприродную аминокислоту, содержащую аминокислотный остов, длина которого составляет от 3 до 10 атомов (например, 6-аминогексановую кислоту, 5-аминовалериановую кислоту, 7-аминогептановую кислоту и 8-аминооктановую кислоту). Альтернативно, спейсер может представлять собой дипептидный или трипептидный спейсер, содержащий пептидный остов, длина которого составляет от 3 до 10 атомов (например, от 6 до 10 атомов). Дипептидный или трипептидный спейсер, присоединенный к конъюгату родственный глюкагону пептид-инсулин, может состоять из природных и/или неприродных аминокислот, включая, например, любую из аминокислот, указанную в настоящем описании. В некоторых вариантах осуществления спейсер имеет общий отрицательный заряд, например, содержит одну или две отрицательно заряженные аминокислоты. В некоторых вариантах осуществления дипептидный спейсер выбран из группы, состоящей из: Ala-Ala, β-Ala-β-Ala, Leu-Leu, Pro-Pro, γ-аминомасляную кислоту-γ-аминомасляную кислоту и γ-Glu-γ-Glu. В одном из вариантов осуществления дипептидный спейсер представляет собой γ-Glu-γ-Glu.

Подходящие способы алкилирования пептидов по аминам, гидроксилам и тиолам известны в данной области. Например, можно использовать простой эфирный синтез Вильямсона для образования простой эфирной связи между инсулиновым пептидом и алкильной группой. Также реакция нуклеофильного замещения пептида с алкилгалогенидом может приводить к образованию любой из эфирной, тиоэфирной или амидной связи.

Алкильная группа алкилированного пептида конъюгата родственный глюкагону пептид-инсулин может быть любого размера, например, с любой длиной углеродной цепи, и может являться неразветвленной или разветвленной. В некоторых вариантах осуществления изобретения алкильная группа представляет собой C4-C30алкил. Например, алкильная группа может представлять собой любую из: C4алкила, C6алкила, C8алкила, C10алкила, C12алкила, C14алкила, C16алкила, C18алкила, C20алкила, C22алкила, C24алкила, C26алкила, C28алкила или C30алкила. В некоторых вариантах осуществления алкильная группа представляет собой C8-C20алкил, например, C14алкил или C16алкил.

В некоторых конкретных вариантах осуществления алкильная группа содержит стероидную желчной кислоты, например, холевой кислоты, хенодезоксихолевой кислоты, дезоксихолевой кислоты, литохолевой кислоты, таурохолевой кислоты, глюкохолевой кислоты и холестериновой кислоты.

Когда длинноцепочечный алкан подвергают алкилированию посредством конъюгата родственный глюкагону пептид-инсулин или спейсера, длинноцепочечный алкан может быть любого размера и может содержать углеродную цепь любой длины. Длинноцепочечный алкан может являться линейным или разветвленным. В определенных аспектах длинноцепочечный алкан представляет собой C4-C30алкан. Например, длинноцепочечный алкан может представлять собой любой из C4алкана, C6алкана, C8алкана, C10алкана, C12алкана, C14алкана, C16алкана, C18алкана, C20алкана, C22алкана, C24алкана, C26алкана, C28алкана или C30алкана. В некоторых вариантах осуществления длинноцепочечный алкан содержит C8-C20алкан, например, C14алкан, C16алкана или C18алкан.

Также в некоторых вариантах осуществления алкилирование можно проводить между аналогом инсулина и холестериновой группой. Например, гидроксильная группа холестерина может замещать уходящую группу на длинноцепочечном алкане с образованием продукта холестерин-инсулиновый пептид.

Составы с контролируемым высвобождением

Альтернативно, конъюгаты инсулина/инкретина, описываемые в настоящем описании, можно модифицировать в форму депо, таким образом, что способ, которым конъюгат по настоящему изобретению высвобождается в организме, в который его вводят, является контролируемым по времени и локализации в организме (см., например, патент США № 4450150). Формы депо конъюгатов по настоящему изобретению могут представлять собой, например, имплантируемую композицию, содержащую конъюгат по настоящему изобретению и пористое или непористое вещество, такое как полимер, где конъюгат по настоящему изобретению инкапсулируют в веществе или распыляют во всем объеме вещества и/или путем разрушения непористого вещества. Затем депо имплантируют в желаемое участок в организме, и конъюгат по настоящему изобретению высвобождается из имплантата с предопределенной скоростью.

Альтернативно, большой полимер депо можно связывать с саморасщепляющимся дипептидным элементом, который ковалентно связывают с конъюгатом, как описано в настоящем описании. В этом варианте осуществления полимер депо эффективно изолирует конъюгат родственный глюкагону пептид-инсулин в его участке введения пока, затем он не отщепляется от одноцепочечного аналога путем неферментативной реакции при предопределенной скорости. Составы депо аналогов инсулина с использованием саморасщепляющегося дипептида были описаны в опубликованной международной заявке № WO 2010/080607, описание которой включено в настоящее описание. Один из вариантов осуществления относится к конъюгату родственный глюкагону пептид-инсулин, содержащему дипептидный элемент пролекарства, где дипептидный элемент пролекарства связан с большим полимером, таким как PEG или декстран. В одном из вариантов осуществления саморасщепляющийся дипептидный элемент, содержащий большой полимер депо (включая, например, PEG), связан с боковой цепью аминокислоты связывающей группы, включая, например, аминокислоту в положении C8 связывающей группы.

Можно получать фармацевтические композиции, которые содержат одноцепочечные аналоги инсулина, и их формулируют, чтобы они обладали желаемым профилем высвобождения in vivo. В некоторых аспектах фармацевтическая композиция представляет собой состав с немедленным высвобождением, контролируемым высвобождением, длительным высвобождением, продленным высвобождением, отсроченным высвобождением или с двухфазным высвобождением. Способы формулирования пептидов или конъюгатов для контролируемого высвобождения известны в данной области. См., например, J. Pharm. 374: 46-52 (2009) и Публикации международной патентной заявки № WO 2008/130158, WO2004/033036, WO2000/032218 и WO 1999/040942. Композиции с немедленным высвобождением могут дополнительно содержать, например, мицеллы или липосомы, или определенную другую инкапсулированную форму, или их можно вводить в форме с продленным высвобождением для обеспечения длительного хранения и/или эффекта доставки. Раскрываемые фармацевтические составы можно вводить в соответствии с любой схемой, включая, например, ежесуточно (1 раз в сутки, 2 раза в сутки, 3 раза в сутки, 4 раза в сутки, 5 раз в сутки, 6 раз в сутки), каждые двое суток, каждые трое суток, каждые четверо суток, каждые пять суток, каждые шесть суток, еженедельно, два раза в неделю, каждые три недели, ежемесячно или два раза в месяц.

В соответствии с одним из вариантов осуществления полимер депо выбирают из биосовместимых полимеров, известных специалистам в данной области. Полимеры депо, как правило, имеют размер, выбранный из диапазона приблизительно от 20000 до 120000 Дальтон. В одном из вариантов осуществления размер полимера депо выбран из диапазона приблизительно от 40000 до 100000 или приблизительно от 40000 до 80000 Дальтон. В одном из вариантов осуществления размер полимера депо составляет приблизительно 40000, 50000, 60000, 70000 или 80000 Дальтон. Подходящие полимеры депо включают, но не ограничиваются ими, декстраны, полилактиды, полигликолиды, полимеры на основе капролактона, поли(капролактон), полиангидриды, полиамины, сложные полиэфирамиды, полиортоэфиры, полидиоксаноны, полиацетали, поликетали, поликарбонаты, полифосфоэфиры, сложные полиэфиры, полибутилентерефталат, полиортокарбонаты, полифосфазены, сукцинаты, поли(яблочную кислоту), поли(аминокислоты), поливинилпирролидон, полиэтиленгликоль, полигидроксицеллюлозу, полисахариды, хитин, хитозан, гиалуроновую кислоту и сополимеры, терполимеры и их смеси, и биоразрушаемые полимеры и их сополимеры, включая полимеры на основе капролактона, поликапролактоны и сополимеры, которые содержит полибутилентерефталат. В одном из вариантов осуществления полимер депо выбран из группы, состоящей из полиэтиленгликоля, декстрана, полимолочной кислоты, полигликолевой кислоты и сополимера молочной кислоты и гликолевой кислоты, и в одном из конкретных вариантов осуществления полимер депо представляет собой полиэтиленгликоль. В одном из вариантов осуществления полимер депо представляет собой полиэтиленгликоль, и суммарная молекулярная масса полимера(ов) депо, связанного с дипептидным элементом, составляет приблизительно от 40000 до 80000 Дальтон.

Один из вариантов осуществления относится к саморасщепляющемуся дипептидному элементу, содержащему структуру U-J, где U представляет собой аминокислоту или гидроксильную кислоту и J представляет собой N-алкилированную аминокислоту. В одном из вариантов осуществления один или более дипептидных элементов являются связанными с конъюгатом родственный глюкагону пептид-инсулин через амидную связь, образуемую через одну или более аминогрупп, выбранных из N-концевой аминогруппы B-цепи инсулинового компонента, N-конца компонента родственного глюкагону пептида или боковой цепи аминогруппы аминокислоты, содержащейся в конъюгате. В соответствии с одним из вариантов осуществления один или более дипептидных элементов являются связанными с конъюгатом родственный глюкагону пептид-инсулин по аминогруппе, выбранной из N-концевой аминогруппы конъюгата, или боковой цепи аминогруппы ароматического амина остатка 4-аминофенилаланина, содержащегося в положении, соответствующем положению A19, B16 или B25 нативного инсулина, или боковой цепи аминокислоты связывающей группы одноцепочечного аналога инсулина, или компонентов N-конца родственного глюкагону пептида или инсулинового пептида конъюгата.

В одном из вариантов осуществления дипептидный элемент пролекарство содержит общую структуру формулы X:

,

где

R1, R2, R4 и R8 независимо выбраны из группы, состоящей из H, C1-C18алкил, C2-C18алкенил, (C1-C18алкил)OH, (C1-C18 алкил)SH, (C2-C3алкил)SCH3, (C1-C4алкил)CONH2, (C1-C4алкил)COOH, (C1-C4алкил)NH2, (C1-C4алкил)NHC(NH2+)NH2, (C0-C4алкил)(C3-C6циклоалкил), (C0-C4алкил)(C2-C5гетероциклический), (C0-C4алкил)(C6-C10арил)R7, (C1-C4алкил)(C3-C9гетероарил) и C1-C12алкил(W)C1-C12алкил, где W представляет собой гетероатом, выбранный из группы, состоящей из N, S и O, или R1 и R2 совместно с атомами, к которым они присоединены, образуют C3-C12циклоалкил или арил; или R4 и R8 совместно с атомами, к которым они присоединены, образуют C3-C6циклоалкил;

R3 выбран из группы, состоящей из C1-C18алкила, (C1-C18алкил)OH, (C1-C18алкил)NH2, (C1-C18алкил)SH, (C0-C4алкил)(C3-C6)циклоалкила, (C0-C4алкил)(C2-C5гетероциклического), (C0-C4алкил)(C6-C10арила)R7 и (C1-C4алкил)(C3-C9гетероарила), или R4 и R3 совместно с атомами, к которым они присоединены, образуют 4-, 5- или 6-членное гетероциклическое кольцо;

R5 представляет собой NHR6 или OH;

R6 представляет собой H, C1-C8алкил, или R6 и R2 совместно с атомами, к которым они присоединены, образуют 4-, 5- или 6-членное гетероциклическое кольцо, и

R7 выбран из группы, состоящей из H и OH. В одном из вариантов осуществления, когда элемент пролекарства связан N-концевым амином конъюгата родственный глюкагону пептид-инсулин, и R4 и R3 совместно с атомами, к которым они присоединены, образуют 4-, 5- или 6-членное гетероциклическое кольцо, по меньшей мере один из R1 и R2 являются отличными от H.

Родственные глюкагону пептиды

Заявители открыли аналоги глюкагона, которые обладают измененными видами активности в отношении рецепторов глюкагона, GLP1 и GIP. Любой из этих аналогов можно использовать в качестве родственного глюкагону пептида в конъюгатах, описываемых в настоящем описании. Более конкретно родственный глюкагону пептид может представлять собой любой из пептидов глюкагона 1 класса, 2 класса или 3 класса, описываемых в настоящем описании.

Родственные глюкагону пептиды 1 класса

В определенных вариантах осуществления родственный глюкагону пептид представляет собой родственный глюкагону пептид 1 класса, который описан в настоящем описании и в международной патентной заявке № PCT US2009/47437 (зарегистрированной 16 июня 2009 года) и публикации международной патентной заявки № WO 2008/086086, опубликованной 17 июля 2008 года, содержание которых полностью включено посредством ссылки.

Биологические последовательности, указанные в следующем ниже разделе (SEQ ID NO: 801-915), относящемся к родственным глюкагону пептидам 1 класса, соответствуют SEQ ID NO: 1-115 в международной патентной заявке № PCT US2009/47437.

Активность

Родственные глюкагону пептиды 1 класса сохраняют активность рецептора глюкагона относительно нативного пептида глюкагона (SEQ ID NO: 801). Например, родственный глюкагону пептид может сохранять по меньшей мере 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75% активность, 80% активность, 85% активность или 90% активность нативного глюкагона (рассчитываемую как обратное отношение EC50 для родственного глюкагону пептида в сравнении с глюкагоном, например, как измеряют по продукции цАМФ с использованием анализа, в основном описанного в примере 7). В некоторых вариантах осуществления родственные глюкагону пептиды 1 класса обладают такой же или большей активностью (используют как синонимы термина "активность" в настоящее описание) по сравнению с глюкагоном. В некоторых вариантах осуществления родственные глюкагону пептиды, описываемые в настоящем описании, обладают не более приблизительно 100%, 1000%, 10000%, 100000% или 1000000% активностью нативного пептида глюкагона.

Улучшенная растворимость

Нативный глюкагон обладает слабой растворимостью в водном растворе, в частности при физиологическом pH, как правило, образует агрегаты и выпадает в осадок через некоторое количество времени. В противоположность этому, родственные глюкагону пептиды 1 класса в некоторых вариантах осуществления обладают по меньшей мере в 2 раза, 5 раз или даже большей растворимостью по сравнению с нативным глюкагоном при pH от 6 до 8, или от 6 до 9, например, при pH 7 через 24 часа при 25°C.

Таким образом, в некоторых вариантах осуществления родственный глюкагону пептид 1 класса модифицировали относительно пептида дикого типа His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr (SEQ ID NO: 801) для улучшения растворимости пептида в водных растворах, в частности при pH в диапазоне приблизительно от 5,5 приблизительно до 8,0, при сохранении биологической активности нативного пептида.

Например, растворимость любого из родственных глюкагону пептидов 1 класса, описываемых в настоящем описании, можно дополнительно улучшать путем присоединения гидрофильной группы к пептиду.

Введение таких групп также увеличивает продолжительность действия, например, как измеряют по пролонгированному периоду полувыведения из кровотока. Гидрофильные группы дополнительно описаны в настоящем описании.

Модификация с заряженными остатками

В некоторых вариантах осуществления растворимость улучшают добавлением заряда к родственному глюкагону пептиду 1 класса заменой нативных незаряженных аминокислот заряженными аминокислотами, выбранными из группы, состоящей из лизина, аргинина, гистидина, аспарагиновой кислота и глутаминовой кислоты, или добавлением заряженных аминокислот к амино- или карбокси-концу пептида.

В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид 1 класса обладает улучшенной растворимостью вследствие того, что пептид модифицируют заменой аминокислот и/или добавлениями, которые вводят заряженную аминокислоту в C-концевой участок пептид, и в некоторых вариантах осуществления в положении C-конца до положения 27 SEQ ID NO: 801. Необязательно одну, два или три заряженные аминокислоты можно вводить в C-концевой участок, и в некоторых вариантах осуществления от C-конца до положения 27. В соответствии с некоторыми вариантами осуществления нативная аминокислота(ы) в положениях 28 и/или 29 заменяют заряженными аминокислотам, и/или от одной до трех заряженным аминокислот добавляют к C-концу пептида, например, после положения 27, 28 или 29. В иллюстративных вариантах осуществления одна, две, три или все заряженные аминокислоты являются отрицательно заряженными. В других вариантах осуществления одна, две, три или все заряженные аминокислоты являются положительно заряженными.

В конкретных предпочтительных вариантах осуществления родственный глюкагону пептид 1 класса может содержать любую одну или две следующих ниже модификаций: замену N28 на E; замену N28 на D; замену на T29 на D; замену T29 на E; вставку E после положения 27, 28 или 29; вставку D после положения 27, 28 или 29. Например, D28E29, E28E29, E29E30, E28E30, D28E30.

В соответствии с одним из иллюстративных вариантов осуществления родственный глюкагону пептид 1 класса содержит аминокислотную последовательность SEQ ID NO: 811 или ее аналог, который содержит от 1 до 3 дополнительных аминокислотных модификаций (описываемых в настоящем описании по отношению к агонистам глюкагона) относительно нативного глюкагона или его аналога агониста глюкагона. SEQ ID NO: 811 представляет собой модифицированный родственный глюкагону пептид 1 класса, где остаток аспарагина в положении 28 нативного белка заменяли аспарагиновой кислотой. В другом иллюстративном варианте осуществления родственный глюкагону пептид 1 класса содержит аминокислотную последовательность SEQ ID NO: 838, где остаток аспарагина в положении 28 нативного белка заменяли глутаминовой кислотой. Другие иллюстративные варианты осуществления включают родственные глюкагону пептиды 1 класса SEQ ID NO: 824, 825, 826, 833, 835, 836 и 837.

Улучшенная стабильность

Любой из родственных глюкагону пептидов 1 класса может дополнительно обладать улучшенной стабильностью и/или сниженной деградацией, например, сохраняя по меньшей мере 95% от исходного пептида через 24 часа при 25°C. Родственные глюкагону пептиды 1 класса могут содержать дополнительные модификации, которые изменяют его фармацевтические свойства, например, повышенная активность, пролонгированный период полувыведения из кровотока, увеличенный срок хранения, сниженное осаждение или агрегация, и/или сниженная деградация, например, сниженная частота расщепления или химической модификации после хранения.

В еще одном дополнительном иллюстративном варианте осуществления любой из указанных выше родственных глюкагону пептидов 1 класса можно дополнительно модифицировать для улучшения стабильности путем модификации аминокислоты в положении 15 SEQ ID NO: 801 для уменьшения деградации пептида в течение длительного времени, в частности в кислых или щелочных буферах. В иллюстративных вариантах осуществления Asp в положении 15 заменяют Glu, гомо-Glu, цистеиновой кислотой или гомоцистеиновой кислотой.

Альтернативно, любой из родственных глюкагону пептидов 1 класса, описываемых в настоящем описании, можно дополнительно модифицировать для улучшения стабильности модификацией аминокислоты в положении 16 SEQ ID NO: 801. В иллюстративных вариантах осуществления Ser в положении 16 заменяют Thr или AIB, или любыми заменами аминокислот, описываемыми в настоящем описании касательно родственных глюкагону пептидов 1 класса, которые повышают активность в отношении рецептора глюкагона. Такие модификации уменьшают расщепление пептидной связи между Asp15-Ser16.

В некоторых вариантах осуществления любой из родственных глюкагону пептидов 1 класса, описываемых в настоящем описании, можно дополнительно модифицировать для снижения деградации по различным положениям аминокислот модификацией любой одной, двумя, тремя или всеми четырьмя положениями 20, 21, 24 или 27. Иллюстративные варианты осуществления включают замену Gln в положении 20 на Ser, Thr, Ala или AIB, замену Asp в положении 21 на Glu, замену Gln в положении 24 на Ala или AIB, замену Met в положении 27 на Leu или Nle. Удаление или замена метионина снижает деградацию вследствие окисления метионина. Удаление или замена Gln или Asn снижает деградацию вследствие дезамидирования Gln или Asn. Удаление или замена Asp снижает деградацию, которая возникает в результате дегидратации Asp с образованием циклического сукцинимидного промежуточного соединения с последующей изомеризацией до изоаспартата.

Повышенная активность

Другой вариант осуществления относится к родственным глюкагону пептидам 1 класса, которые обладают повышенной активностью в отношении рецептора глюкагона, где пептиды содержат модификацию аминокислоты в положении 16 нативного глюкагона (SEQ ID NO: 801). В качестве неограничивающего примера, такую повышенную активность можно обеспечивать заменой природного серина в положении 16 глутаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь длиной 4 атома, или, альтернативно, любой из глутамина, гомоглутаминовой кислоты или гомоцистеиновой кислоты, или заряженной аминокислотой, содержащей боковую цепь, содержащую по меньшей мере один гетероатом, (например, N, O, S, P), и с боковую цепь длиной приблизительно 4 (или 3-5) атома. Замена серина в положении 16 глутаминовой кислотой повышает активность глюкагона по меньшей мере в 2 раза, 4 раза, 5 раз и до 10 раз больше в отношении рецептора глюкагона. В некоторых вариантах осуществления родственный глюкагону пептид 1 класса сохраняет селективность к рецептору глюкагона относительно рецепторов GLP-1, например, по меньшей мере в 5 раз, 10 раз или 15 раз большую селективность.

Устойчивость к DPP-IV

В некоторых вариантах осуществления родственные глюкагону пептиды 1 класса, описываемые в настоящем описании, дополнительно модифицируют в положении 1 или 2 для снижения чувствительности к расщеплению дипептидилпептидазой IV. Более конкретно, в некоторых вариантах осуществления положение 1 и/или положение 2 родственного глюкагону пептида 1 класса заменяют устойчивой к DPP-IV аминокислотой(ами), описываемой в настоящем описании. В некоторых вариантах осуществления положение 2 аналога пептид заменяют аминоизомасляной кислотой. В некоторых вариантах осуществления положение 2 аналога пептида заменяют аминокислотой, выбранной из группы, состоящей из D-серина, D-аланина, глицина, N-метилсерина и ε-аминомасляной кислоты. В другом варианте осуществления положение 2 родственного глюкагону пептида 1 класса заменяют аминокислотой, выбранной из группы, состоящей из D-серина, глицина и аминоизомасляной кислоты. В некоторых вариантах осуществления аминокислота в положении 2 не является D-серином.

Снижение активности глюкагона при модификации аминокислот в положении 1 и/или положении 2 родственного глюкагону пептида можно восстанавливать стабилизацией структуры альфа-спирали в C-концевом положении родственного глюкагону пептида (около аминокислот 12-29). Структуру альфа-спирали можно стабилизировать, например, путем образования ковалентного или нековалентного внутримолекулярного мостика (например, лактамового мостика между боковыми цепями аминокислот в положениях "i" и "i+4", где i представляет собой целое число от 12 до 25), замены и/или вставки аминокислот около положений 12-29 стабилизирующей альфа-спираль аминокислоты (например, α,α-двузамещенной аминокислоты), как дополнительно описывают в настоящем описании.

Модификации в положении 3

Активность рецептора глюкагона можно снижать модификацией аминокислоты в положении 3 (в соответствии с нумерацией аминокислот глюкагона дикого типа), например, заменой природного глутамина в положении 3 кислой, основной или гидрофобной аминокислотой. Например, замена в положении 3 глутаминовой кислотой, орнитином или норлейцином по существу снижает или подавляет активность рецептора глюкагона.

Сохраненную или повышенную активность по отношению к рецептору глюкагона можно получать модификацией Gln в положении 3 аналогом глутамина, как описано в настоящем описании. Например, агонисты глюкагона могут содержать аминокислотную последовательность SEQ ID NO: 863, SEQ ID NO: 869, SEQ ID NO: 870, SEQ ID NO: 871, SEQ ID NO: 872, SEQ ID NO: 873 и SEQ ID NO: 874.

Повышение активности GLP-1 C-концевыми амидами и сложными эфирами

Повышенную активность по отношению к рецептору GLP-1 обеспечивают заменой карбоновой кислоты C-концевой аминокислоты электрически нейтральной группой, такой как амид или сложный эфир. В противоположность этому, сохранение нативной карбоновой кислоты на C-конце пептида поддерживает относительно большую селективность родственного глюкагону пептида 1 класса к рецептору глюкагона по сравнению с рецептором GLP-1 (например, больше чем приблизительно в 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20 раз).

Дополнительные модификации и комбинации

Можно проводить дополнительные модификации родственного глюкагону пептида 1 класса, которые могут дополнительно увеличивать растворимость и/или стабильность, и/или активность глюкагона. Родственный глюкагону пептид 1 класса может альтернативно содержать другие модификации, которые по существу не влияют на растворимость или стабильность и по существу не снижают активность глюкагона. В иллюстративных вариантах осуществления родственный глюкагону пептид 1 класса может содержать в целом до 11, или до 12, или до 13, или до 14 модификаций аминокислот относительно нативной последовательности глюкагона. Например, консервативные или неконсервативные замены, добавления или делеции можно проводить в положениях 2, 5, 7, 10, 11, 12, 13, 14, 17, 18, 19, 20, 21, 24, 27, 28 или 29.

Иллюстративные модификации родственного глюкагону пептида 1 класса включают, но не ограничиваются ими:

(a) неконсервативные замены, консервативные замены, добавления или делеции при сохранении по меньшей мере частичной активности агониста глюкагона, например, консервативные замены в одном или более положений 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27, 28 или 29, замена Tyr в положении 10 на Val или Phe, замена Lys в положении 12 на Arg, замена одного или более этих положений на Ala;

(b) делецию аминокислот в положениях 29 и/или 28 и необязательно положении 27 при сохранении по меньшей мере частичной активности агониста глюкагона;

(c) модификацию аспарагиновой кислоты в положении 15, например, заменой глутаминовой кислоты, гомоглутаминовой кислоты, цистеиновой кислоты или гомоцистеиновой кислоты, которая может уменьшать деградацию; или модификацию серина в положении 16, например, заменой треонина, AIB, глутаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь длиной 4 атомов, или альтернативно любой из глутамина, гомоглутаминовой кислоты или гомоцистеиновой кислоты, которая также уменьшает деградацию, обусловленную расщеплением связи Asp15-Ser16;

(d) добавление гидрофильной группы, такой как водорастворимый полимерного полиэтиленгликоля, как описано в настоящем описании, например, в положении 16, 17, 20, 21, 24, 29, 40 или к C-концевой аминокислоте, которая может увеличивать растворимость и/или время полужизни;

(e) модификацию метионина в положении 27, например, заменой лейцином или норлейцином для снижения окислительной деградации;

(f) модификацию Gln в положении 20 или 24, например, заменой Ser, Thr, Ala или AIB для уменьшения деградации, которая происходит путем дезамидирования Gln;

(g) модификацию Asp в положении 21, например, заменой Glu, для уменьшения деградации, которая происходит путем дегидратации Asp с образованием циклического сукцинимидного промежуточного соединения с последующей изомеризацией до изоаспартата;

(h) модификацию в положении 1 или 2, как описано в настоящем описании, которая улучшает устойчивость к расщеплению DPP-IV, необязательно в комбинации с внутримолекулярным мостиком, таким как лактамовый мостик, между положениями "i" и "i+4", где i представляет собой целое число от 12 до 25, например, 12, 16, 20, 24;

(i) ацилирование или алкилирование родственного глюкагону пептида, как описано в настоящем описании, которое может повышать активность в отношении рецептора глюкагона и/или рецептора GLP-1, увеличивает время полувыведения из кровотока и/или увеличивает продолжительность действия, и/или замедляет начало действия, необязательно в сочетании с добавлением гидрофильной группы, дополнительно или альтернативно, необязательно в сочетании с модификацией, которая избирательно снижает активность пептида GLP-1, например, модификацией Thr в положении 7, такой как замена Thr в положении 7 аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile; удалением аминокислот C-конца до аминокислоты в положении 27 (например, удалением одной или обеих аминокислот в положениях 28 и 29, с получением пептида длиной 27 или 28 аминокислот);

(j) C-концевые удлинения, как описано в настоящем описании;

(k) гомодимеризацию или гетеродимеризацию, как описано в настоящем описании, и комбинации (a)-(k).

В некоторых вариантах осуществления иллюстративные модификации родственного глюкагону пептида 1 класса включают по меньшей мере одну модификацию аминокислоты, выбранную из группы A, и одну или более модификаций аминокислот, выбранных из группы B и/или группы C, где группа A представляет собой:

замену Asn в положении 28 заряженной аминокислотой;

замену Asn в положении 28 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замену в положении 28 на Asn, Asp или Glu;

замену в положении 28 на Asp;

замену в положении 28 на Glu;

замену Thr в положении 29 заряженной аминокислотой;

замену Thr в положении 29 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замену в положении 29 на Asp, Glu или Lys;

замену в положении 29 на Glu;

вставку 1-3 заряженных аминокислот после положения 29;

вставку после положения 29 Glu или Lys;

вставку после положения 29 Gly-Lys или Lys-Lys;

или их комбинации;

где группа B представляет собой:

замену Asp в положении 15 Glu;

замену Ser в положении 16 Thr или AIB;

и где группа C представляет собой:

замену His в положении 1 ненативной аминокислотой, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

замену Ser в положении 2 ненативной аминокислотой, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

замену Lys в положении 12 Arg;

замену Gln в положении 20 Ser, Thr, Ala или AIB;

замену Asp в положении 21 Glu;

замену Gln в положении 24 Ser, Thr, Ala или AIB;

замену Met в положении 27 Leu или Nle;

делецию аминокислоты в положениях 27-29;

делецию аминокислоты в положениях 28-29;

делецию аминокислоты в положениях 29;

или их комбинации.

В иллюстративных вариантах осуществления Lys в положении 12 заменяют Arg. В других иллюстративных вариантах осуществления удаляют аминокислоты в положениях 29 и/или 28, и необязательно в положении 27.

В некоторых конкретных вариантах осуществления родственный глюкагону пептид содержит (a) модификацию аминокислоты в положении 1 и/или 2, которая придает устойчивость к DPP-IV, например, замену на DMIA в положении 1 или AIB в положении 2, (b) внутримолекулярный мостик в положениях 12-29, например, в положениях 16 и 20, или одну или более замен аминокислот в положениях 16, 20, 21 и 24 α,α-двузамещенной аминокислотой, необязательно (c) связанной с гидрофильной группой, такой как PEG, например, через Cys в положении 24, 29 или в C-концевой аминокислоте, необязательно (d) модификацию аминокислоты в положении 27, которая заменяет Met, например, Nle, необязательно (e) модификации аминокислот в положениях 20, 21 и 24, которые уменьшают деградацию, и необязательно (f) связанные с SEQ ID NO: 820. В случае, когда родственный глюкагону пептид связан с SEQ ID NO: 820, аминокислота в положении 29 в определенных вариантах осуществления представляет собой Thr или Gly. В других конкретных вариантах осуществления родственный глюкагону пептид содержит (a) Asp28Glu29 или Glu28Glu29, или Glu29Glu30, или Glu28Glu30, или Asp28Glu30, и необязательно (b) модификацию аминокислоты в положении 16, которая заменяет Ser, например, Thr или AIB, и необязательно (c) модификацию аминокислоты в положении 27, которая заменяет Met, например, Nle, и необязательно (d) модификации аминокислот в положениях 20, 21 и 24, которые уменьшают деградацию. В конкретном варианте осуществления родственный глюкагону пептид представляет собой T16, A20, E21, A24, Nle27, D28, E29.

В некоторых вариантах осуществления родственный глюкагону пептид 1 класса содержит аминокислотную последовательность:

X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z (SEQ ID NO: 839) с модификациями от 1 до 3 аминокислот в ней,

где X1 и/или X2 является ненативной аминокислотой, которая снижает чувствительность (или повышает устойчивость) родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV), где Z выбран из группы, состоящей из -COOH (природного C-концевого карбоксилата), -Asn-COOH, Asn-Thr-COOH и Y-COOH, где Y представляет собой от 1 до 2 аминокислот, и где внутримолекулярный мостик, предпочтительно ковалентная связь, соединяет боковые цепи аминокислоты в положении i и аминокислоты в положении i+4, где i равно 12, 16, 20 или 24.

В некоторых вариантах осуществления внутримолекулярный мостик представляет собой лактамовый мостик. В некоторых вариантах осуществления аминокислоты в положениях i и i+4 SEQ ID NO: 839 представляют собой Lys и Glu, например, Glul6 и Lys20. В некоторых вариантах осуществления X1 выбран из группы, состоящей из: D-His, N-метил-His, альфа-метил-His, имидазолуксусной кислоты, дезамино-His, гидроксил-His, ацетил-His, гомо-His и альфа,альфа-диметилимидазолуксусной кислоты (DMIA). В других вариантах осуществления X2 выбран из группы, состоящей из: D-Ser, D-Ala, Gly, N-метил-Ser, Val и альфа-аминоизомасляной кислоты (AIB). В некоторых вариантах осуществления родственный глюкагону пептид является ковалентно связанным с гидрофильной группой в любом из положений аминокислот 16, 17, 20, 21, 24, 29, 40 с C-концевым удлинением или с C-концевой аминокислотой. В иллюстративных вариантах осуществления такая гидрофильная группа ковалентно связана с остаток Lys, Cys, Orn, гомоцистеина или ацетилфенилаланина в любом из этих положений. Иллюстративные гидрофильные группы включают полиэтиленгликоль (PEG), например, молекулярной массы приблизительно от 1000 Дальтон приблизительно до 40000 Дальтон, или приблизительно от 20000 Дальтон приблизительно до 40000 Дальтон.

В других вариантах осуществления родственный глюкагону пептид I класса содержит аминокислотную последовательность: X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z (SEQ ID NO: 839), где X1 и/или X2 является ненативной аминокислотой, которая снижает чувствительность (или повышает устойчивость) родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV), где одно, два, три, четыре или более положений 16, 20, 21 и 24 родственного глюкагону пептида являются замещенными α,α-двузамещенной аминокислотой, и где Z выбран из группы, состоящей из -COOH (природного C-концевого карбоксилата), -Asn-COOH, Asn-Thr-COOH и Y-COOH, где Y представляет собой от 1 до 2 аминокислот.

Иллюстративные дополнительные модификации аминокислот в указанных выше родственных глюкагону пептидах 1 класса или аналогах включают замену Thr в положении 7 аминокислотой, не содержащей гидроксильной группы, например, аминомасляной кислотой (Abu), Ile, необязательно в комбинации с заменой или добавлением аминокислоты, содержащей боковую цепь, ковалентно присоединенную (необязательно через спейсер) к ацильной или алкильной группе, где ацильная или алкильная группа является ненативной для природной аминокислоты, замену Lys в положении 12 Arg; замену Asp в положении 15 Glu; замену Ser в положении 16 Thr или AIB; замену Gln в положении 20 Ser, Thr, Ala или AIB; замену Asp в положении 21 Glu; замену Gln в положении 24 Ser, Thr, Ala или AIB; замену Met в положении 27 Leu или Nle; замену Asn в положении 28 заряженной аминокислотой; замену Asn в положении 28 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замену в положении 28 Asn, Asp или Glu; замену в положении 28 Asp; замену в положении 28 Glu; замену Thr в положении 29 заряженной аминокислотой; замену Thr в положении 29 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замену в положении 29 на Asp, Glu или Lys; замену в положении 29 на Glu; вставку 1-3 заряженных аминокислот после положения 29; вставку в положении 30 (т.е. после положения 29) Glu или Lys; необязательно со вставкой в положении 31 Lys; добавление SEQ ID NO: 820 к C-концу, необязательно, где аминокислота в положении 29 представляет собой Thr или Gly; замену или добавление аминокислоты, ковалентно присоединенной к гидрофильной группе, или их сочетание.

Любую из модификаций, описанных выше по отношению к агонистам глюкагона 1 класса, которые повышают активность рецептора глюкагона, сохраняют частичную активность рецептора глюкагона, улучшают растворимость, повышают стабильность или уменьшают деградацию, можно применять к родственным глюкагону пептидам 1 класса отдельно или в комбинации.

Примеры вариантов осуществления родственных глюкагону пептидов 1 класса

В соответствии с некоторыми вариантами осуществления нативный пептид глюкагона SEQ ID NO: 801 модифицируют заменой нативной аминокислоты в положении 28 и/или 29 отрицательно заряженной аминокислотой (например, аспарагиновой кислотой или глутаминовой кислотой) и необязательно добавлением отрицательно заряженной аминокислоты (например, аспарагиновой кислоты или глутаминовой кислоты) к C-концу пептида. В альтернативном варианте осуществления нативный пептид глюкагона SEQ ID NO: 801 модифицируют заменой нативной аминокислоты в положении 29 положительно заряженной аминокислотой (например, лизином, аргинином или гистидином) и необязательно добавлением одной или двух положительно заряженных аминокислот (например, лизина, аргинина или гистидина) к C-концу пептида. Некоторые варианты осуществления относятся к аналогу глюкагона с улучшенной растворимостью и стабильностью, где аналог содержит аминокислотную последовательность SEQ ID NO: 834, при условии, что по меньшей мере одна аминокислота в положении 28 или 29 является замещенной кислой аминокислотой, и/или дополнительную кислую аминокислоту добавляют к C-концу SEQ ID NO: 834. В некоторых вариантах осуществления кислые аминокислоты независимо выбраны из группы, состоящей из Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты.

Некоторые варианты осуществления относятся к агонисту глюкагона с улучшенной растворимостью и стабильностью, где агонист содержит аминокислотную последовательность SEQ ID NO: 833, где по меньшей мере одна из аминокислот в положениях 27, 28 или 29 является замещенной остатком ненативной аминокислоты (т.е. по меньшей мере одна аминокислота, находящаяся в положении 27, 28 или 29 аналога, является кислой аминокислотой, отличной от аминокислоты, находящейся в соответствующем положении в SEQ ID NO: 801). Некоторые варианты осуществления относятся к агонисту глюкагона, содержащему последовательность SEQ ID NO: 833, при условии, что когда аминокислота в положении 28 представляет собой аспарагин, и аминокислота в положении 29 представляет собой треонин, пептид дополнительно содержит от одной до двух аминокислот, независимо выбранных из группы, состоящей из Lys, Arg, His, Asp или Glu, добавляемых к C-концу родственного глюкагону пептида. В соответствии с некоторыми вариантами осуществления остаток метионина, находящийся в положении 27 нативного пептида, заменяют лейцином или норлейцином для предотвращения окислительной деградации пептида.

Некоторые варианты осуществления относятся к аналогу глюкагона SEQ ID NO: 833, где от 1 до 6 аминокислот, выбранные из положений 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 или 24 аналога, отличаются от соответствующей аминокислоты SEQ ID NO: 801. Другой вариант осуществления относится к аналогу глюкагона SEQ ID NO: 833, где от 1 до 3 аминокислот, выбранных из положений 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 или 24 аналог, отличаются от соответствующей аминокислоты SEQ ID NO: 801. Другой вариант осуществления относится к аналогу глюкагона SEQ ID NO: 807, SEQ ID NO: 808 или SEQ ID NO: 834, где от 1 до 2 аминокислот, выбранных из положений 1, 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21 или 24 аналога, отличаются от соответствующей аминокислоты SEQ ID NO: 801, и в дополнительном варианте осуществления эти одна-две отличающиеся аминокислоты представляют собой консервативные аминокислотные замены относительно аминокислоты, содержащейся в нативной последовательности (SEQ ID NO: 801). Некоторые варианты осуществления относятся к родственному глюкагону пептиду SEQ ID NO: 811 или SEQ ID NO: 813, где родственный глюкагону пептид дополнительно содержит одну, две или три замены аминокислот в положениях, выбранных из положений 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27 или 29. В некоторых вариантах осуществления замены в положениях 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 27 или 29 представляют собой консервативные аминокислотные замены.

Некоторые варианты осуществления относятся к агонисту глюкагона, содержащему пептид-аналог SEQ ID NO: 801, где аналог отличается от SEQ ID NO: 801 тем, что содержит аминокислоту, отличную от серина в положении 2, и тем, что содержит кислую аминокислоту, замещенную нативной аминокислотой в положении 28 или 29, или кислую аминокислоту, добавляемую к C-концу пептида SEQ ID NO: 801. В некоторых вариантах осуществления кислая аминокислота представляет собой аспарагиновую кислоту или глутаминовую кислоту. Некоторые варианты осуществления относятся к аналогу глюкагона SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 или SEQ ID NO: 832, где аналог отличается от исходной молекулы заменой в положении 2. Более конкретно, положение 2 аналога пептид является замещенным аминокислотой, выбранной из группы, состоящей из D-серина, аланина, D-аланина, глицина, н-метилсерина и аминоизомасляной кислоты.

Другой вариант осуществления относится к агонисту глюкагона, содержащему пептид-аналог SEQ ID NO: 801, где аналог отличается от SEQ ID NO: 801 тем, что содержит аминокислоту, отличную от гистидина в положении 1, и тем, что содержит кислую аминокислоту, замещенную нативной аминокислотой в положении 28 или 29 или кислой аминокислотой, добавляемой к C-концу пептида SEQ ID NO: 801. В некоторых вариантах осуществления кислая аминокислота представляет собой аспарагиновую кислоту или глутаминовую кислоту. Некоторые вариантов осуществления относятся к аналогу глюкагона SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 или SEQ ID NO: 832, где аналог отличается от исходной молекулы заменой в положении 1. Более конкретно, положение 1 пептида-аналога является замещенным аминокислотой, выбранной из группы, состоящей из DMIA, D-гистидина, дезаминогистидина, гидроксилгистидина, ацетилгистидина и гомогистидина.

В соответствии с некоторыми вариантами осуществления модифицированный родственный глюкагону пептид содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 и SEQ ID NO: 832. Дополнительный вариант осуществления относится к родственному глюкагону пептиду, содержащему последовательность SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 или SEQ ID NO: 832, дополнительно содержащую от одной до двух аминокислот, добавляемых к C-концу SEQ ID NO: 809, SEQ ID NO: 812, SEQ ID NO: 813 или SEQ ID NO: 832, где дополнительные аминокислоты независимо выбраны из группы, состоящей из Lys, Arg, His, Asp Glu, цистеиновой кислоты или гомоцистеиновой кислоты. В некоторых вариантах осуществления дополнительные аминокислоты, добавляемые к C-концу, выбраны из группы, состоящей из Lys, Arg, His, Asp или Glu, или в дополнительном варианте осуществления дополнительные аминокислоты представляют собой Asp или Glu.

В другом варианте осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 7 или ее аналога агониста глюкагона. В некоторых вариантах осуществления пептид, содержащий последовательность, выбран из группы, состоящей из SEQ ID NO: 808, SEQ ID NO: 810, SEQ ID NO: 811, SEQ ID NO: 812 и SEQ ID NO: 813. В другом варианте осуществления пептид, содержащий последовательность выбран из группы, состоящей из SEQ ID NO: 808, SEQ ID NO: 810 и SEQ ID NO: 811. В некоторых вариантах осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 808, SEQ ID NO: 810 и SEQ ID NO: 811, дополнительно содержащую дополнительную аминокислоту, выбранную из группы, состоящей из Asp и Glu, добавляемую у C-концу родственного глюкагону пептида. В некоторых вариантах осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 811 или SEQ ID NO: 813, и в дополнительном варианте осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 811.

Некоторые варианты осуществления относятся к агонисту глюкагона, содержащему модифицированный родственный глюкагону пептид, выбранный из группы, состоящей из:

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Xaa-Xaa-Xaa-R (SEQ ID NO: 834),

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asp-Thr-R (SEQ ID NO: 811) и

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Xaa-Tyr-Leu-Glu-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asp-Thr-R (SEQ ID NO: 813),

где Xaa в положении 15 представляет собой Asp, Glu, цистеиновую кислоту, гомоглутаминовую кислоту или гомоцистеиновую кислоту, Xaa в положении 28 представляет собой Asn или кислую аминокислоту, и Xaa в положении 29 представляет собой Thr или кислую аминокислоту, и R представляет собой кислую аминокислоту, COOH или CONH2 при условии, что остаток кислой аминокислоты находится в одном из положений 28, 29 или 30. В некоторых вариантах осуществления R представляет собой COOH, а в другом варианте осуществления R представляет собой CONH2.

Настоящее изобретение также включает слитые пептиды глюкагона, где второй пептид сливали с C-концом родственного глюкагону пептида для повышения стабильности и растворимости родственного глюкагону пептида. Более конкретно, слитый родственный глюкагону пептид может содержать аналог агониста глюкагона, содержащий родственный глюкагону пептид NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Xaa-Xaa-Xaa-R (SEQ ID NO: 834), где R представляет собой кислую аминокислоту или связь, и аминокислотную последовательность SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) или SEQ ID NO: 822 (KRNR), связанную с карбокси-концевой аминокислотой родственного глюкагону пептида. В некоторых вариантах осуществления родственный глюкагону пептид выбран из группы, состоящей из SEQ ID NO: 833, SEQ ID NO: 807 или SEQ ID NO: 808, дополнительно содержащей аминокислотную последовательность SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) или SEQ ID NO: 822 (KRNR), связанную с карбокси-концевой аминокислотой родственного глюкагону пептида. В некоторых вариантах осуществления слитый пептид глюкагона содержит SEQ ID NO: 802, SEQ ID NO: 803, SEQ ID NO: 804, SEQ ID NO: 805 и SEQ ID NO: 806 или ее аналог агониста глюкагона, дополнительно содержащий аминокислотную последовательность SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) или SEQ ID NO: 822 (KRNR), связанную с аминокислотой 29 родственного глюкагону пептида. В соответствии с некоторыми вариантами осуществления слитый пептид дополнительно содержит цепь PEG, связанную с аминокислотой в положении 16, 17, 21, 24, 29 в C-концевом удлинении или с C-концевой аминокислотой, где цепь PEG выбрана из диапазона от 500 до 40000 Дальтон. В некоторых вариантах осуществления аминокислотная последовательность SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) или SEQ ID NO: 822 (KRNR) является связанной с аминокислотой 29 родственного глюкагону пептида через пептидную связь. В некоторых вариантах осуществления часть родственного глюкагону пептида слитого пептида глюкагона содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 810, SEQ ID NO: 811 и SEQ ID NO: 813. В некоторых вариантах осуществления часть родственного глюкагону пептида слитого пептида глюкагона содержит последовательность SEQ ID NO: 811 или SEQ ID NO: 813, где цепь PEG является связанной в положении 21, 24, 29 с C-концевым удлинением или с C-концевой аминокислотой, соответственно.

В другом варианте осуществления последовательность родственного глюкагону пептида слитого пептида содержит последовательность SEQ ID NO: 811, дополнительно содержащую аминокислотную последовательность SEQ ID NO: 820 (GPSSGAPPPS), SEQ ID NO: 821 (KRNRNNIA) или SEQ ID NO: 822 (KRNR), связанную с аминокислотой 29 родственного глюкагону пептида. В некоторых вариантах осуществления слитый пептид глюкагона содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 824, SEQ ID NO: 825 и SEQ ID NO: 826. Как правило, слитый пептид по настоящему изобретению содержит C-концевую аминокислоту с группой стандартной карбоновой кислоты. Однако аналоги таких последовательностей, где C-концевая аминокислота содержит амид, замещенный карбоновой кислотой, также предусмотрены как варианты осуществления. В соответствии с некоторыми вариантами осуществления слитый родственный глюкагону пептид содержит аналог агониста глюкагона, выбранный из группы, состоящей из SEQ ID NO: 810, SEQ ID NO: 811 и SEQ ID NO: 813, дополнительно содержащей аминокислотную последовательность SEQ ID NO: 823 (GPSSGAPPPS-CONH2), связанную с аминокислотой 29 родственного глюкагону пептида.

Агонисты глюкагона по настоящему изобретению можно дополнительно модифицировать для улучшения растворимости и стабильности пептида в водных растворах при сохранении биологической активности родственного глюкагону пептида. В соответствии с некоторыми вариантами осуществления ожидают, что введение гидрофильных групп в одно или более положений, выбранных из положений 16, 17, 20, 21, 24 и 29 пептида SEQ ID NO: 811 или его аналога агониста глюкагона, улучшает растворимость и стабильность pH-стабилизированного аналога глюкагона. Более конкретно, в некоторых вариантах осуществления родственный глюкагону пептид SEQ ID NO: 810, SEQ ID NO: 811, SEQ ID NO: 813 или SEQ ID NO: 832 модифицируют, чтобы он содержал одну или более гидрофильных групп, ковалентно связанных с боковыми цепями аминокислот, содержащимися в положениях 21 и 24 родственного глюкагону пептида.

В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид SEQ ID NO: 811 модифицируют, чтобы он содержал одну или более замен аминокислот в положениях 16, 17, 20, 21, 24 и/или 29, где нативная аминокислота является замещенной аминокислотой, содержащей боковую цепь, подходящую для сшивания с гидрофильными группами, включая, например, PEG. Нативный пептид можно заменять природной аминокислотой или синтетической (неприродной) аминокислотой. Синтетические или неприродные аминокислоты относятся к аминокислотам, которые не встречаются в природе in vivo, но которые тем не менее можно встраивать в пептидные структуры, описываемые в настоящем описании.

Некоторые варианты осуществления относятся к агонисту глюкагона SEQ ID NO: 810, SEQ ID NO: 811 или SEQ ID NO: 813, где последовательность нативного пептида глюкагона модифицировали, чтобы она содержала природную или синтетическую аминокислоту по меньшей мере в одном из положений 16, 17, 21, 24, 29 с C-концевым удлинением или с C-концевой аминокислотой нативной последовательности, где заместитель аминокислоты дополнительно содержит гидрофильную группу. В некоторых вариантах осуществления замену проводят в положении 21 или 24, и в дополнительном варианте осуществления гидрофильная группа представляет собой цепь PEG. В некоторых вариантах осуществления родственный глюкагону пептид SEQ ID NO: 811 является замещенным по меньшей мере одним остатком цистеина, где боковую цепь остатка цистеина дополнительно модифицируют взаимодействующим с тиолом реагентом, включая, например, малеимидо, винилсульфон, 2-пиридилтио, галогеналкил и галоацил. Эти взаимодействующие с тиолом реагенты могут содержать карбокси-, кето-, гидроксильные и эфирные группы, а также другие гидрофильные группы, такие как звенья полиэтиленгликоля. В альтернативном варианте осуществления нативный пептид глюкагона является замещенным лизином, и боковую цепь замещающего остатка лизина дополнительно модифицируют с использованием реагентов, таких как активные сложные эфиры (сукцинимидо, ангидрид и т.д.), карбоновые кислоты или альдегиды, взаимодействующих с амином гидрофильных групп, таких как полиэтиленгликоль. В некоторых вариантах осуществления родственный глюкагону пептид выбран из группы, состоящей из SEQ ID NO: 814, SEQ ID NO: 815, SEQ ID NO: 816, SEQ ID NO: 817, SEQ ID NO: 818 и SEQ ID NO: 819.

В соответствии с некоторыми вариантами осуществления пегилированный родственный глюкагону пептид содержит две или более цепи полиэтиленгликоля, ковалентно связанные с родственным глюкагону пептидом, где общая молекулярная масса цепей глюкагона составляет приблизительно от 1000 приблизительно до 5000 Дальтон. В некоторых вариантах осуществления пегилированный агонист глюкагона содержит пептид SEQ ID NO: 806, где цепь PEG ковалентно связана с аминокислотным остатком в положении 21 и в положении 24, и где суммарная молекулярная масса двух цепей PEG составляет приблизительно от 1000 приблизительно до 5000 Дальтон. В другом варианте осуществления пегилированный агонист глюкагона содержит пептид SEQ ID NO: 806, где цепь PEG ковалентно связана с аминокислотным остатком в положении 21 и в положении 24, и где суммарная молекулярная масса двух цепей PEG составляет приблизительно от 5000 приблизительно до 20000 Дальтон.

Цепь полиэтиленгликоля моет находиться в форме неразветвленной цепи, или она может являться разветвленной. В соответствии с некоторыми вариантами осуществления средняя молекулярная масса цепи полиэтиленгликоля выбрана из диапазона приблизительно от 500 приблизительно до 40000 Дальтон. В некоторых вариантах осуществления молекулярная масса цепи полиэтиленгликоля выбрана из диапазона приблизительно от 500 приблизительно до 5000 Дальтон. В другом варианте осуществления молекулярная масса цепи полиэтиленгликоля составляет приблизительно от 20000 приблизительно до 40000 Дальтон.

Любой из родственных глюкагону пептидов, описанных выше, можно дополнительно модифицировать, чтобы они содержали ковалентный или нековалентный внутримолекулярный мостик или стабилизирующую альфа-спираль аминокислоту в C-концевом участке родственного глюкагону пептида (положения аминокислот 12-29). В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид содержит любую одну или более модификаций, описываемых выше, в дополнение к замене аминокислот в положениях 16, 20, 21 или 24 (или их комбинации) α,α-двузамещенной аминокислотой, например, AIB. В соответствии с другим вариантом осуществления родственный глюкагону пептид содержит любую одну или более модификаций, описываемых выше, в дополнение к внутримолекулярному мостику, например, лактаму, между боковыми цепями аминокислот в положениях 16 и 20 родственного глюкагону пептида.

В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид содержит аминокислотную последовательность SEQ ID NO: 877, где Xaa в положении 3 представляет собой аминокислоту, содержащую боковую цепь структуры I, II или III:

Структура I

Структура II

Структура III,

где R1 представляет собой C0-3алкил или C0-3гетероалкил; R2 представляет собой NHR4 или C1-3алкил; R3 представляет собой C1-3алкил; R4 представляет собой H или C1-3алкил; X представляет собой NH, O, или S, и Y представляет собой NHR4, SR3 или OR3. В некоторых вариантах осуществления X представляет собой NH, или Y представляет собой NHR4. В некоторых вариантах осуществления R1 представляет собой C0-2алкил или C1гетероалкил. В некоторых вариантах осуществления R2 представляет собой NHR4 или C1алкил. В некоторых вариантах осуществления R4 представляет собой H или C1алкил. Иллюстративные варианты осуществления относятся к аминокислоте, содержащей боковую цепь структуры I, где R1 представляет собой CH2-S, X представляет собой NH, и R2 представляет собой CH3 (ацетамидометилцистеин, C(Acm)); R1 представляет собой CH2, X представляет собой NH, и R2 представляет собой CH3 (ацетилдиаминобутановую кислоту, Dab(Ac)); R1 представляет собой C0алкил, X представляет собой NH, R2 представляет собой NHR4, и R4 представляет собой H (карбамоилдиаминопропионовую кислоту, Dap(мочевину)); или R1 представляет собой CH2-CH2, X представляет собой NH, и R2 представляет собой CH3 (ацетиломитин, Orn(Ac)). Иллюстративные варианты осуществления относятся к аминокислоте, содержащей боковую цепь структуры II, где R1 представляет собой CH2, Y представляет собой NHR4, и R4 представляет собой CH3 (метилглутамин, Q(Me)). Иллюстративные варианты осуществления относятся к аминокислоте, содержащей боковую цепь структуры III, где, R1 представляет собой CH2 и R4 представляет собой H (метионинсульфоксид, M(O)). В конкретных вариантах осуществления аминокислота в положении 3 является замещенной Dab(Ac). Например, агонисты глюкагона могут содержать аминокислотную последовательность SEQ ID NO: 863, SEQ ID NO: 869, SEQ ID NO: 871, SEQ ID NO: 872, SEQ ID NO: 873 и SEQ ID NO: 874.

В определенных вариантах осуществления родственный глюкагону пептид представляет собой аналог родственного глюкагону пептида SEQ ID NO: 877. В конкретных аспектах аналог содержит любую из модификаций аминокислот, описываемых в настоящем описании, включая, но, не ограничиваясь ими, замену Asn в положении 28 заряженной аминокислотой; замену Asn в положении 28 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замену в положении 28 Asn, Asp или Glu; замену в положении 28 Asp; замену в положении 28 Glu; замену Thr в положении 29 заряженной аминокислотой; замену Thr в положении 29 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты; замену в положении 29 Asp, Glu или Lys; замену в положении 29 Glu; вставку 1-3 заряженных аминокислот после положения 29; вставку после положения 29 Glu или Lys; вставку после положения 29 Gly-Lys или Lys-Lys и их сочетание.

В определенных вариантах осуществления аналог родственного глюкагону пептида SEQ ID NO: 877 содержит α,α-двузамещенную аминокислоту, такую как AIB, в одном, двух, трех или всех положениях 16, 20, 21 и 24. В определенных вариантах осуществления аналог родственного глюкагону пептида SEQ ID NO: 877 содержит одну или более из следующих ниже: замены His в положении 1 ненативной аминокислотой, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV), замены Ser в положении 2 ненативной аминокислотой, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV), замены Thr в положении 7 аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile; замены Tyr в положении 10 Phe или Val; замены Lys в положении 12 Arg; замены Asp в положении 15 Glu, замены Ser в положении 16 Thr или AIB; замены Gln в положении 20 Ala или AIB; замены Asp в положении 21 Glu; замены Gln в положении 24 Ala или AIB; замены Met в положении 27 Leu или Nle; делеции аминокислот в положениях 27-29; делеции аминокислот в положениях 28-29; делеции аминокислот в положениях 29; добавления аминокислотной последовательности SEQ ID NO: 820 к C-концу, где аминокислота в положении 29 представляет собой Thr или Gly, или их сочетание.

В соответствии с конкретными вариантами осуществления, родственный глюкагону пептид содержит аминокислотную последовательность любой из SEQ ID NO: 862-867 и 869-874. В определенных вариантах осуществления аналог родственного глюкагону пептида, содержащий SEQ ID NO: 877, содержит гидрофильную группу, например, PEG, ковалентно связанную с аминокислотой в положениях 16, 17, 20, 21, 24 и 29 или с C-концевой аминокислотой.

В определенных вариантах осуществления аналог родственного глюкагону пептида, содержащий SEQ ID NO: 877, содержит аминокислоту, содержащую боковую цепь, ковалентно соединенную, необязательно через спейсер с ацильной группой или алкильной группой, где ацильная группа или алкильная группа являются ненативными для природной аминокислоты. Ацильная группа в некоторых вариантах осуществления представляет собой ацильную группу C4-C30жирной кислоты. В других вариантах осуществления алкильная группа представляет собой C4-C30алкил. В конкретных аспектах ацильная группа или алкильная группа является ковалентно соединенной с боковой цепью аминокислоты в положении 10. В некоторых вариантах осуществления аминокислота в положении 7 представляет собой Ile или Abu.

Агонист глюкагона может представлять собой пептид, содержащий аминокислотную последовательность любой из SEQ ID NO: 801-919, необязательно с 1, 2, 3, 4 или 5 дополнительными модификациями, которые сохраняют активность агониста глюкагона. В определенных вариантах осуществления агонист глюкагона содержит аминокислоты любой из SEQ ID NO: 859-919.

Родственные глюкагону пептиды 2 класса

В определенных вариантах осуществления родственный глюкагону пептид представляет собой родственный глюкагону пептид 2 класса, который описан в настоящем описании и в международной патентной заявке № PCT US2009/47447 (зарегистрированной 16 июня 2009 года), предварительной заявке США № 61/090448 и заявке США № 61/151349, содержание которых полностью включено посредством ссылки. Биологические последовательности, указанные в следующем ниже разделе (SEQ ID NO: 1001-1262) касательно родственных глюкагону пептидов 2 класса, соответствуют SEQ ID NO: 1-262 в международной патентной заявке № PCT US2009/47447.

Активность

Нативный глюкагон не активирует рецептор GIP и, как правило, обладает приблизительно 1% активности нативного GLP-1 в отношении рецептора GLP-1. Модификациями нативной последовательности глюкагона, описываемые в настоящем описании, получают родственные глюкагону пептиды 2 класса, которые могут обладать высоким эквивалентом активности глюкагона или лучше, чем активность нативного глюкагона (SEQ ID NO: 1001), высоким эквивалентом активности GIP или лучше, чем активность нативного (SEQ ID NO: 1004), и/или высоким эквивалентом активности GLP-1 или лучше, чем активность нативного GLP-1. В связи с этим родственный глюкагону пептид 2 класса может представлять собой один коагонист глюкагона/GIP, тройной агонист глюкагона/GIP/GLP-1, коагонист GIP/GLP-1 или родственный глюкагону пептид агонист GIP, как дополнительно описано в настоящем описании.

В некоторых вариантах осуществления для родственных глюкагону пептидов 2 класса, описываемых в настоящем описании, демонстрируют EC50 для активации активности рецептора GIP приблизительно 100 нМ или менее, или приблизительно 75, 50, 25, 10, 8, 6, 5, 4, 3, 2 или 1 нМ или менее. В некоторых вариантах осуществления для родственных глюкагону пептидов 2 класса демонстрируют EC50 для активации рецептора глюкагона приблизительно 100 нМ или менее, или приблизительно 75, 50, 25, 10, 8, 6, 5, 4, 3, 2 или 1 нМ или менее. В некоторых вариантах осуществления для родственных глюкагону пептидов 2 класса демонстрируют EC50 для активации рецептора GLP-1 приблизительно 100 нМ или менее, или приблизительно 75, 50, 25, 10, 8, 6, 5, 4, 3, 2 или 1 нМ или менее. Активацию рецептора можно измерять анализами in vitro, измеряя индукцию цАМФ в клетки HEK293, сверхэкспрессирующих рецептор, например, оценивая клетки HEK293, совместно трансформированные ДНК, кодирующей рецептор, и ген люциферазы, связанный с чувствительным к цАМФ элементом, как описано в примере 7.

В некоторых вариантах осуществления родственные глюкагону пептиды 2 класса обладают активностью в отношении рецептора глюкагона и рецептор GIP ("коагонисты глюкагона/GIP"). Эти родственные глюкагону пептиды 2 класса утратили селективность нативного глюкагона к рецептору глюкагона по сравнению с рецептором GIP. В некоторых вариантах осуществления EC50 родственного глюкагону пептида 2 класса для рецептора GIP отличается менее чем приблизительно в 50 раз, 40 раз, 30 раз или 20 раз (выше или ниже) его EC50 для рецептора глюкагона. В некоторых вариантах осуществления активность GIP родственного глюкагону пептида 2 класса отличается менее чем приблизительно в 500, 450, 400, 350, 300, 250, 200, 150, 100, 75, 50, 25, 20, 15, 10, или 5 раз (выше или ниже) от его активности глюкагона. В некоторых вариантах осуществления отношение EC50 родственного глюкагону пептида 2 класса для рецептора GIP, делимое на EC50 родственного глюкагону пептида 2 класса для рецептора глюкагона составляет менее приблизительно 100, 75, 60, 50, 40, 30, 20, 15, 10 или 5. В некоторых вариантах осуществления активность GLP-1 значительно снижали или подавляли, например, модификацией аминокислоты в положении 7, делецией аминокислоты(т) C-конца до аминокислоты в положении 27 или 28 с получением пептида длиной 27 или 28 аминокислот или их сочетание.

В другом аспекте родственные глюкагону пептиды 2 класса обладают активностью в отношении рецепторов глюкагона, GIP и GLP-1 ("тройные агонисты глюкагона/GIP/GLP-1"). Эти родственные глюкагону пептиды 2 класса утратили селективность нативного глюкагона к рецептору глюкагона по сравнению с рецепторами GLP-1 и GIP. В некоторых вариантах осуществления EC50 родственного глюкагону пептида 2 класса для рецептора GIP отличается менее чем приблизительно в 50 раз, 40 раз, 30 раз или 20 раз (выше или ниже) от его соответствующих EC50 для рецепторов глюкагона и GLP-1. В некоторых вариантах осуществления активность GIP родственного глюкагону пептида 2 класса отличается менее чем приблизительно в 500, 450, 400, 350, 300, 250, 200, 150, 100, 75, 50, 25, 20, 15, 10 или 5 раз (выше или ниже) от его активности глюкагона и GLP-1. В некоторых вариантах осуществления отношение EC50 тройного агониста в отношении рецептора GIP делимое на EC50 тройного агониста в отношении рецептора GLP-1 составляет менее приблизительно 100, 75, 60, 50, 40, 30, 20, 15, 10 или 5.

В еще одном аспекте родственные глюкагону пептиды 2 класса обладают активностью в отношении рецепторов GLP-1 и GIP, но где активность глюкагон незначительно снижали или подавляли ("коагонисты GIP/GLP-1"), например, модификацией аминокислоты в положении 3. Например, замена в этом положении кислой, основной или гидрофобной аминокислотой (глутаминовой кислотой, орнитином, норлейцином) снижает активность глюкагона. В некоторых вариантах осуществления EC50 родственного глюкагону пептида в отношении рецептора GIP отличается менее чем приблизительно 50 раз, 40 раз, 30 раз или 20 раз (выше или ниже) от его EC50 для рецептора GLP-1. В некоторых вариантах осуществления активность GIP родственного глюкагону пептида 2 класса отличается менее чем приблизительно 25, 20, 15, 10 или 5 раз (выше или ниже) т его активности GLP-1. В некоторых вариантах осуществления эти родственные глюкагону пептиды 2 класса обладают приблизительно 10% или меньшей активностью нативного глюкагона в отношении рецептора глюкагона, например, приблизительно 1-10%, или приблизительно 0,1-10%, или более приблизительно 0,1%, но менее приблизительно 10%. В некоторых вариантах осуществления отношение EC50 родственного глюкагону пептида 2 класса для рецептора GIP, делимое на EC50 родственного глюкагону пептида 2 класса для рецептора GLP-1, составляет менее приблизительно 100, 75, 60, 50, 40, 30, 20, 15, 10, или 5 и не менее 1. В некоторых вариантах осуществления отношение активность GIP родственного глюкагону пептида 2 класса по сравнению с активностью GLP-1 родственного глюкагону пептида 2 класса составляет менее приблизительно 100, 75, 60, 50, 40, 30, 20, 15, 10 или 5 и не менее 1.

В дополнительном аспекте родственные глюкагону пептиды 2 класса обладают активностью в отношении рецептора GIP, где активность глюкагона и GLP-1 существенно снижают или подавляют ("пептиды агониста глюкагона GIP"), например, модификациями аминокислот в положениях 3 на Glu и 7 на Ile. В некоторых вариантах осуществления эти родственные глюкагону пептиды 2 класса обладают приблизительно 10% или менее активностью нативного глюкагона в отношении рецептора глюкагона, например, приблизительно 1-10% или приблизительно 0,1-10%, или более приблизительно 0,1%, 0,5% или 1%, но менее приблизительно 1%, 5% или 10%. В некоторых вариантах осуществления эти родственные глюкагону пептиды 2 класса также обладают приблизительно 10% или менее активностью нативного GLP-1 в отношении рецептора GLP-1, например, приблизительно 1-10% или приблизительно 0,1-10%, или более приблизительно 0,1%, 0,5% или 1%, но менее приблизительно 1%, 5% или 10%.

Модификации

Модификации, описываемые в настоящем описании по отношению к родственному глюкагону пептиду 2 класса, позволяют проводить манипуляции с глюкагоном (SEQ ID NO: 1001) для получения родственных глюкагону пептидов, которые обладают повышенной активностью GIP, активностью глюкагона и/или активностью GLP-1.

Модификации, которые влияют на активность GIP

Повышенную активность в отношении рецептора GIP обеспечивают модификацией аминокислоты в положении 1. Например, His в положении 1 заменяют большой ароматической аминокислотой, необязательно Tyr, Phe, Trp, амино-Phe, нитро-Phe, хлор-Phe, сульфо-Phe, 4-пиридил-Ala, метил-Tyr или 3-амино-Tyr. Сочетание Tyr в положении 1 со стабилизацией альфа-спирали в области, соответствующей аминокислотам 12-29, обеспечивало родственный глюкагону пептид 2 класса, который активирует рецептор GIP, а также рецептор GLP-1 и рецептор глюкагона. Структуру альфа-спирали можно стабилизировать, например, путем образования ковалентного или нековалентного внутримолекулярного мостика или заменой и/или вставкой аминокислот около положений 12-29 стабилизирующей альфа-спираль аминокислоты (например, α,α-двузамещенной аминокислоты).

Повышенную активность в отношении рецептора GIP также обеспечивают модификациями аминокислот в положениях 27 и/или 28, и необязательно в положении 29. Например, Met в положении 27 заменяют большой алифатической аминокислотой необязательно Leu, Asn в положении 28 заменяют небольшой алифатической аминокислотой необязательно Ala и Thr в положении 29 заменяют небольшой алифатической аминокислотой необязательно Gly. Замена на LAG в положениях 27-29 обеспечивает повышенную активность GIP относительно нативной последовательности MNT в этих положениях.

Повышенную активность в отношении рецептора GIP также обеспечивают модификацией аминокислоты в положении 12. Например, положение 12 замещают большой алифатической неполярной аминокислотой необязательно Ile. Повышенную активность в отношении рецептора GIP также обеспечивают модификацией аминокислоты в положениях 17 и/или 18. Например, положение 17 замещают полярным остатком необязательно Gln и положение 18 замещают небольшой алифатической аминокислотой необязательно Ala. Замена на QA в положениях 17 и 18 обеспечивает повышенную активность GIP относительно нативной последовательности RR в этих положениях.

Увеличенную активность в отношении рецептора GIP обеспечивают модификациями, которые обеспечивают образование внутримолекулярного мостика между боковыми цепями аминокислот в положениях от 12 до 29. Например, внутримолекулярный мостик может быть образован ковалентной связью между боковыми цепями двух аминокислот в положениях i и i+4 или между положениями j и j+3, или между положениями k и k+7. В иллюстративных вариантах осуществления мостик располагается между положениями 12 и 16, 16 и 20, 20 и 24, 24 и 28 или 17 и 20. В других вариантах осуществления нековалентные взаимодействия, такие как солевые мостики, могут возникать между положительно и отрицательно заряженными аминокислотами в этих положениях.

Любую из модификаций, описанных выше, которые повышают активность рецептора GIP, можно применять отдельно или в комбинации. Комбинации модификаций, которые повышают активность рецептора GIP, как правило, обеспечивают более высокую активность GIP, чем любая из таких модификаций, проводимая по отдельности.

Модификации, которые влияют на активность глюкагона

В некоторых вариантах осуществления повышенную активность глюкагона обеспечивают модификацией аминокислоты в положении 16 нативного глюкагона (SEQ ID NO: 1001). В качестве неограничивающего примера такую повышенную активность можно обеспечивать заменой природного серина в положении 16 глутаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь длиной 4 атома, или альтернативно любой аминокислотой из глутамина, гомоглутаминовой кислоты или гомоцистеиновой кислоты, или заряженной аминокислотой, содержащей боковую цепь, контактирующую по меньшей мере с одним гетероатомом (например, N, O, S, P), и с длиной боковой цепи приблизительно 4 (или 3-5) атомов. В некоторых вариантах осуществления родственный глюкагону пептид сохраняет свою исходную селективность к рецептору глюкагона относительно рецепторов GLP-1.

Активность рецептора глюкагона можно снижать модификацией аминокислоты в положении 3, например, заменой природного глутамина в положении 3 кислой, основной или гидрофобной аминокислотой. Например, замена в положении 3 глутаминовой кислотой, орнитином или норлейцином по существу снижает или подавляет активность рецептора глюкагона.

Сохраненную или повышенную активность в отношении рецептора глюкагона можно получать модификацией Gln в положении 3 аналогом глутамина, как описано в настоящем описании. Например, агонисты глюкагона могут содержать аминокислотную последовательность любой из SEQ ID NO: 1243-1248, 1250, 1251 и 1253-1256.

Восстановление активности глюкагона, которую снижали модификациями аминокислот в положениях 1 и 2, обеспечивают модификациями, которые стабилизируют структуру альфа-спирали C-концевого участка (аминокислоты 12-29) родственного глюкагону пептида или его аналога. Например, внутримолекулярный мостик может быть образован ковалентной связью между боковыми цепями двух аминокислот в положениях i и i+4 или между положениями j и j+3, или между положениями k и k+7. В других вариантах осуществления нековалентные взаимодействия, такие как солевые мостики, могут образовываться между положительно и отрицательно заряженными аминокислотами в этих положениях. В других вариантах осуществления одну или более α,α-двузамещенных аминокислот вводят или заменяют в этом C-концевом участке (аминокислоты 12-29) в положениях, которые сохраняют желаемую активность. Например, одно, два, три или все положения 16, 20, 21 или 24 замещают α,α-двузамещенной аминокислотой, например, AIB.

Модификации, которые влияют на активность GLP-1

Повышенную активность в отношении рецептора GLP-1 обеспечивают заменой карбоновой кислоты C-концевой аминокислоты нейтрально заряженной группой, такой как амидная или сложноэфирная. Повышенную активность в отношении рецептора GLP-1 также обеспечивают стабилизацией структуры альфа-спирали в C-концевом участке глюкагона (около аминокислот 12-29), например, через образование внутримолекулярного мостика между боковыми цепями двух аминокислот или заменой и/или вставкой аминокислот около положений 12-29 стабилизирующей альфа-спираль аминокислоты (например, α,α-двузамещенной аминокислоты), как дополнительно описано в настоящем описании. В иллюстративных вариантах осуществления боковые цепи пар аминокислот 12 и 16, 13 и 17, 16 и 20, 17 и 21, 20 и 24 или 24 и 28 (пары аминокислот, в которых i=12, 16, 20 или 24) связывают друг с другом и, таким образом, стабилизируют альфа-спираль глюкагона. В некоторых вариантах осуществления длина мостика или линкера составляет приблизительно 8 (или приблизительно 7-9) атомов, в частности, когда мостик располагается между положениями i и i+4. В некоторых вариантах осуществления длина мостика или линкера составляет приблизительно 6 (или приблизительно 5-7) атомов, в частности, когда мостик располагается между положениями j и j+3.

В некоторых вариантах осуществления внутримолекулярные мостики образуют (a) заменой природного серина в положении 16 глутаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь длиной 4 атома, или альтернативно любой аминокислотой из глутамина, гомоглутаминовой кислоты или гомоцистеиновой кислоты, или заряженной аминокислотой, содержащей боковую цепь, содержащую по меньшей мере один гетероатом, (например, N, O, S, P) и с длиной боковой цепи приблизительно 4 (или 3-5) атомов, и (b) заменой природного глутамина в положении 20 другой гидрофильной аминокислотой, содержащей боковую цепь, которая является заряженной или обладает способностью образовывать водородную связь, и длина которой составляет по меньшей мере приблизительно 5 (или приблизительно 4-6) атомов, например, лизином, цитруллином, аргинином или орнитином. Боковые цепи таких аминокислот в положениях 16 и 20 могут образовывать солевой мостик или могу являть ковалентно связанными. В некоторых вариантах осуществления два аминокислоты являются связанными друг с другом с образованием лактамового кольца.

В некоторых вариантах осуществления стабилизацию структуры альфа-спирали в C-концевом участке родственного глюкагону пептида получают путем образования внутримолекулярного мостика, отличного от лактамового мостика. Например, подходящие способы ковалентного связывания включают любой один или более из метатезиса олефинов, циклизации на основе лантионина, образования дисульфидного мостика или модифицированного серосодержащего мостика, использования α,ω-диаминоалкановых связей, образования мостиковых связей между атомами металла и других способов циклизации пептидов.

В других вариантах осуществления одну или более α,α-двузамещенных аминокислот вводят или замещают в таком C-концевой участке (аминокислоты 12-29) в положениях, которые сохраняют желаемую активность. Например, одно, два, три или все положения 16, 20, 21 или 24 замещают α,α-двузамещенной аминокислотой, например, AIB. Увеличенную активность в отношении рецептора GLP-1 обеспечивают модификацией аминокислоты в положении 20, как описано в настоящем описании. Увеличенную активность в отношении рецептора GLP-1 также обеспечивают добавлением GPSSGAPPPS (SEQ ID NO: 1095) или XGPSSGAPPPS (SEQ ID NO: 1096) к C-концу. Активность GLP-1 в таких аналогах можно дополнительно повышать модификацией аминокислоты в положении 18, 28 или 29, или в положении 18 и 29, как описано в настоящем описании. Дополнительное небольшое увеличение активности GLP-1 обеспечивают модификацией аминокислота в положении 10 так, чтобы она представляла собой остаток большой ароматический аминокислоты, необязательно Trp. Активность в отношении рецептора GLP-1 можно дополнительно повышать заменой аланина нативного аргинина в положении 18.

Сниженную активность в отношении рецептора GLP-1 обеспечивают, например, модификацией аминокислоты в положении 7, как описано в настоящем описании.

Любую из модификаций, описанных выше по отношению к родственному глюкагону пептиду 2 класса, которые повышают активность рецептора GLP-1, можно применять отдельно или в комбинации. Комбинации модификаций, которые повышают активность рецептора GLP-1, как правило, обеспечивают более высокую активность GLP-1 по сравнению с любой из таких модификаций, проводимых отдельно. Например, изобретение относится к родственным глюкагону пептидам, которые содержат модификации в положении 16, в положении 20 и в C-концевой группе карбоновой кислоты, необязательно с ковалентной связью между аминокислотами в положениях 16 и 20; родственным глюкагону пептидам, которые содержат модификации в положении 16 и в C-концевой группе карбоновой кислоты; родственным глюкагону пептидам, которые содержат модификации в положениях 16 и 20 необязательно с ковалентной связью между аминокислотами в положениях 16 и 20, и родственным глюкагону пептидам, которые содержат модификации в положении 20 и в C-концевой группе карбоновой кислоты.

Модификации, которые улучшают устойчивость к DPP-IV

Модификации в положении 1 и/или 2 могут повышать устойчивость пептида к расщеплению дипептидилпептидазой IV (DPP IV). Например, положение 1 и/или положение 2 можно замещать устойчивой к DPP-IV аминокислотой, как описано в настоящем описании. В некоторых вариантах осуществления аминокислоту в положении 2 заменяют N-метилаланином.

Наблюдали, что модификации в положении 2 (например, AIB в положении 2) и в некоторых случаях модификации в положении 1 (например, DMIA в положении 1) могут снижать активность глюкагона, в некоторых случая значительно; неожиданно это снижение активности глюкагона можно восстанавливать стабилизацией структуры альфа-спирали в C-концевом участке глюкагона (около аминокислот 12-29), например, путем образования ковалентной связи между боковыми цепями двух аминокислот, как описано в настоящем описании. В некоторых вариантах осуществления ковалентная связь располагается между аминокислотами в положениях "i" и "i+4" или положениях "j" и "j+3", например, между положениями 12 и 16, 16 и 20, 20 и 24, 24 и 28 или 17 и 20. В иллюстративных вариантах осуществления такая ковалентная связь представляет собой лактамовый мостик между глутаминовой кислотой в положении 16 и лизином в положении 20. В некоторых вариантах осуществления такая ковалентная связь представляет собой внутримолекулярный мостик, отличный от лактамового мостика, как описано в настоящем описании.

Модификации, которые уменьшают деградацию

В еще одном дополнительном иллюстративном варианте осуществления любой из родственных глюкагону пептидов 2 класса можно дополнительно модифицировать для улучшения стабильности модификацией аминокислоты в положении 15 и/или 16 SEQ ID NO: 1001 для уменьшения деградации пептида в течение длительного периода времени, в частности в кислотных или щелочных буферах. Такие модификации снижают расщепление пептидной связи Asp15-Ser16. В иллюстративных вариантах осуществления модификация аминокислоты в положении 15 представляет собой делецию или замену Asp глутаминовой кислотой, гомоглутаминовой кислотой, цистеиновой кислотой или гомоцистеиновой кислотой. В других иллюстративных вариантах осуществления модификация аминокислоты в положении 16 представляет собой делецию или замену Ser на Thr или AIB. В других иллюстративных вариантах осуществления Ser в положении 16 заменяют глутаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь длиной 4 атома, или альтернативно любой аминокислотой из глутамина, гомоглутаминовой кислоты или гомоцистеиновой кислоты.

В некоторых вариантах осуществления модифицируют остаток метионина, содержащийся в положении 27 нативного пептида, например, делецией или заменой. Такие модификации могут предотвращать окислительные деградации пептида. В некоторых вариантах осуществления Met в положении 27 заменяют лейцином, изолейцином или норлейцином. В некоторых конкретных вариантах осуществления Met в положении 27 заменяют лейцином или норлейцином.

В некоторых вариантах осуществления модифицируют Gln в положении 20 и/или 24, например, делецией или заменой. Такие модификации могут уменьшать деградацию, которая происходит путем дезамидирования Gln. В некоторых вариантах осуществления Gln в положении 20 и/или 24 заменяют Ser, Thr, Ala или AIB. В некоторых вариантах осуществления Gln в положении 20 и/или 24 заменяют Lys, Arg, Orn или цитруллином.

В некоторых вариантах осуществления модифицируют Asp в положении 21, например, делецией или заменой. Такие модификации могут уменьшать деградацию, которая происходит путем дегидратации Asp с образованием циклического сукцинимидного промежуточного соединения с последующей изомеризацией до изоаспартата. В некоторых вариантах осуществления положение 21 заменяют Glu, гомоглутаминовой кислотой или гомоцистеиновой кислоты. В некоторых конкретных вариантах осуществления положение 21 заменяют Glu.

Стабилизация структуры альфа-комплекса

Стабилизация структуры альфа-спирали в C-концевой части родственного глюкагону пептида 2 класса (около аминокислот 12-29) обеспечивает активность GLP-1 и/или GIP и восстанавливает активность глюкагона, которую снижали модификациями аминокислот в положениях 1 и/или 2. Структуру альфа-спирали можно стабилизировать, например, путем образования ковалентного или нековалентного внутримолекулярного мостика или заменой и/или делецией аминокислот вокруг положений 12-29 стабилизирующей альфа-спирали аминокислоты (например, α,α-двузамещенной аминокислоты). Стабилизацию структуры альфа-спирали агониста GIP можно проводить, как описано в настоящем описании.

Иллюстративные варианты осуществления

В соответствии с некоторыми вариантами осуществления изобретения аналог глюкагона (SEQ ID NO: 1001), обладающий активностью агониста GIP, содержит SEQ ID NO: 1001 с (a) модификацией аминокислоты в положении 1, которая обеспечивает активность агониста GIP, (b) модификацией, которая стабилизирует структуру альфа-спирали C-концевой части (аминокислоты 12-29) аналога, и (c) необязательно от 1 до 10 (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10) дополнительных модификаций аминокислот. В некоторых вариантах осуществления аналог обладает по меньшей мере приблизительно 1% активностью нативного GIP по отношению к рецептору GIP или любым другим уровнем активности в отношении рецептора GIP, описываемого в настоящем описании.

В определенных вариантах осуществления модификация, которая стабилизирует структуру альфа-спирали, представляет собой модификацию, которая обеспечивает или вводит внутримолекулярный мостик, включая, например, ковалентный внутримолекулярный мостик, такой как любой из мостиков, описываемых в настоящем описании. Ковалентный внутримолекулярный мостик в некоторых вариантах осуществления представляет собой лактамовый мостик. Лактамовый мостик аналога этих вариантов осуществления может представлять собой лактамовый мостик, как описано в настоящем описании. См., например, указания касательно лактамовых мостиков в разделе "Стабилизация структуры альфа-спирали". Например, лактамовый мостик может представлять собой мостик, который располагается между боковыми цепями аминокислот в положениях i и i+4 или между боковыми цепями аминокислот в положениях j и j+3, где i равно 12, 13, 16, 17, 20 или 24, и где j равно 17. В определенных вариантах осуществления лактамовый мостик может располагаться между аминокислотами в положениях 16 и 20, где одну из аминокислот в положениях 16 и 20 заменяют Glu, а другую из аминокислот в положениях 16 и 20 заменяют Lys.

В альтернативных вариантах осуществления модификация, которая стабилизирует структуру альфа-спирали, представляет собой введение одной, двух, трех или четырех α,α-двузамещенных аминокислот в положении(ях) 16, 20, 21 и 24 аналога. В некоторых вариантах осуществления α,α-двузамещенная аминокислота представляет собой AIB. В определенных аспектах α,α-двузамещенная аминокислота (например, AIB) находится в положении 20, и аминокислоту в положение 16 заменяют положительно заряженной аминокислотой, такой как, например, аминокислотой формулы IV, которая описана в настоящем описании. Аминокислота формулы IV может представлять собой гомо-Lys, Lys, Orn или 2,4-диаминомасляную кислоту (Dab).

В конкретных аспектах изобретения модификация аминокислоты в положении 1 представляет собой замену His аминокислотой, не содержащей имидазольную боковую цепь, например, большой ароматической аминокислотой (например, Tyr).

В определенных аспектах аналог глюкагона содержит модификации аминокислот в одном, двух или всех положениях 27, 28 и 29. Например, Met в положении 27 можно заменять большой алифатической аминокислотой необязательно Leu, Asn в положении 28 можно заменять небольшой алифатической аминокислотой необязательно Ala, Thr в положении 29 можно заменять небольшой алифатической аминокислотой необязательно Gly или комбинациями двух или трех из указанных выше. В конкретных вариантах осуществления аналог глюкагона содержит Leu в положении 27, Ala в положении 28 и Gly или Thr в положении 29.

В определенных вариантах осуществления аналог глюкагона содержит удлинение от 1 до 21 аминокислот от C-конца до аминокислоты в положении 29. Удлинение может содержать аминокислотную последовательность, например, SEQ ID NO: 1095 или 1096. Дополнительно или альтернативно, аналог глюкагона может содержать удлинение, где 1-6 аминокислот удлинения представляют собой положительно заряженные аминокислоты. Положительно заряженные аминокислоты могут представлять собой аминокислоты формулы IV, включая, но, не ограничиваясь ими, Lys, гомо-Lys, Orn и Dab.

Аналог глюкагона в некоторых вариантах осуществления подвергают ацилированию или алкилироавнию, как описано в настоящем описании. Например, ацильную или алкильную группу можно присоединять к аналогу глюкагона посредством спейсера или без него в положении 10 или 40 аналога, как дополнительно описано в настоящем описании. Аналог можно дополнительно или альтернативно модифицировать, чтобы он содержал гидрофильную группу, как дополнительно описано в настоящем описании. Кроме того, в некоторых вариантах осуществления аналог содержит любую одну или комбинацию следующих ниже модификаций:

(a) Ser в положении 2, замещаемого D-Ser, Ala, D-Ala, Gly, N-метил-Ser, AIB, Val или α-амино-N-масляной кислотой;

(b) Tyr в положении 10, замещаемого Trp, Lys, Orn, Glu, Phe или Val;

(c) связи ацильной группы с Lys в положении 10;

(d) Lys в положении 12, замещаемого Arg или Ile;

(e) Ser в положении 16, замещаемого Glu, Gln, гомоглутаминовой кислотой, гомоцистеиновой кислотой, Thr, Gly или AIB;

(f) Arg в положении 17, замещаемого Gln;

(g) Arg в положении 18, замещаемого Ala, Ser, Thr или Gly;

(h) Gln в положении 20, замещаемого Ser, Thr, Ala, Lys, цитруллином, Arg, Orn или AIB;

(i) Asp в положении 21, замещаемого Glu, гомоглутаминовой кислотой, гомоцистеиновой кислотой;

(j) Val в положении 23, замещаемого Ile;

(k) Gln в положении 24, замещаемого Asn, Ser, Thr, Ala или AIB;

(l) и консервативной замены в положениях 2 5, 9, 10, 11, 12. 13, 14, 15, 16, 8 19 20, 21, 24, 27, 28 и 29.

В иллюстративных вариантах осуществления аналог глюкагона (SEQ ID NO: 1001), обладающий активностью агониста GIP, содержит следующие модификации:

(a) модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP,

(b) лактамовый мостик между боковыми цепями аминокислоты в положениях i и i+4 или между боковыми цепями аминокислот в положениях j и j+3, где i равно 12, 13, 16, 17, 20 или 24, и где j равно 17,

(c) модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, например, модификации аминокислот в положении 27 и/или 28, и

(d) 1-9 или 1-6 дополнительных модификаций аминокислот, например, 1, 2, 3, 4, 5, 6, 7, 8 или 9 дополнительных модификаций аминокислот,

и EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее.

Лактамовый мостик аналога этих вариантов осуществления может представлять собой лактамовый мостик, как описано в настоящем описании. Например, лактамовый мостик может располагаться между аминокислотами в положениях 16 и 20, где одну из аминокислот в положениях 16 и 20 заменяют Glu, а другую из аминокислот в положениях 16 и 20 заменяют Lys. В соответствии с этими вариантами осуществления аналог может содержать, например, аминокислотную последовательность любой из SEQ ID NO: 1005-1094.

В других иллюстративных вариантах осуществления аналог глюкагона (SEQ ID NO: 1001), обладающий активностью агониста GIP, содержит следующие модификации:

(a) модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP,

(b) одну, две, три или все аминокислоты в положениях 16, 20, 21 и 24 аналога заменяют α,α-двузамещенной аминокислотой,

(c) модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, например, модификации аминокислот в положении 27 и/или 28, и

(d) 1-9 или 1-6 дополнительных модификаций аминокислот, например, 1, 2, 3, 4, 5, 6, 7, 8 или 9 дополнительных модификаций аминокислот,

и EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее.

α,α-Двузамещенная аминокислота аналога этих вариантов осуществления может представлять собой любую α,α-двузамещенную аминокислоту, включая, но, не ограничиваясь ими, аминоизомасляную кислоту (AIB), аминокислоту, двузамещенную одной и той же или отличной группой, выбранной из метила, этила, пропила, и н-бутила, или циклооктаном, или циклогептаном (например, 1-аминоциклооктан-1-карбоновой кислотой). В определенных вариантах осуществления α,α-двузамещенная аминокислота представляет собой AIB. В определенных вариантах осуществления аминокислота в положении 20 является замещенной α,α-двузамещенной аминокислотой, например, AIB. В соответствии с этими вариантами осуществления, аналог может содержать, например, аминокислотную последовательность любой из SEQ ID NO: 1099-1141, 1144-1164, 1166-1169 и 1173-1178.

В еще одних других иллюстративных вариантах осуществления аналог глюкагона (SEQ ID NO: 1001), обладающий активностью агониста GIP, содержит следующие модификации:

(a) модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP,

(b) замену аминокислоты Ser в положении 16 аминокислотой формулы IV:

[Формула IV],

где n равно от 1 до 16, или от 1 до 10, или от 1 до 7, или от 1 до 6, или от 2 до 6, каждый из R1 и R2 независимо выбран из группы, состоящей из H, C1-C18алкила, (C1-C18алкил)OH, (C1-C18алкил)NH2, (C1-C18алкил)SH, (C0-C4алкил)(C3-C6)циклоалкила, (C0-C4алкил)(C2-C5гетероцикла), (C0-C4алкил)(C6-C10арил)R7 и (C1-C4алкил)(C3-C9гетероарил), где R7 представляет собой H или OH, и боковая цепь аминокислоты формулы IV содержит свободную аминогруппу,

(c) замену аминокислоты Gln в положении 20 альфа,альфа-двузамещенной аминокислотой,

(d) модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, например, модификации аминокислот в положении 27 и/или 28, и

(e) 1-9 или 1-6 дополнительных модификаций аминокислот, например, 1, 2, 3, 4, 5, 6, 7, 8 или 9 дополнительных модификаций аминокислот,

и EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее.

Аминокислота формулы IV аналога этих вариантов осуществления может представлять собой любую аминокислоту, такую как, например, аминокислоту формулы IV, где n равно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 или 16. В определенных вариантах осуществления n равно 2, 3, 4 или 5, в случае чего аминокислота представляет собой Dab, Orn, Lys или гомо-Lys, соответственно.

Альфа,альфа-двузамещенная аминокислота аналога этих вариантов осуществления может представлять собой любую альфа,альфа-двузамещенную аминокислоту, включая, но, не ограничиваясь ими, аминоизомасляную кислоту (AIB), аминокислоту, двузамещенную одной и той же или другой группой, выбранной из метила, этила, пропила и н-бутила, или циклооктаном или циклогептаном (например, 1-аминоциклооктан-1-карбоновой кислотой). В определенных вариантах осуществления альфа,альфа-двузамещенная аминокислота представляет собой AIB. В соответствии с этими вариантами осуществления аналог может содержать, например, аминокислотную последовательность любой из SEQ ID NO: 1099-1165.

В еще одних других иллюстративных вариантах осуществления аналог глюкагона (SEQ ID NO: 1001), обладающий активностью агониста GIP, содержит:

(a) модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP, и

(b) удлинение приблизительно от 1 приблизительно до 21 аминокислот от C-конца до аминокислоты в положении 29, где по меньшей мере одна из аминокислот удлинения является ацилированной или алкилированной,

где EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее.

В некоторых вариантах осуществления ацилированная или алкилированная аминокислота представляет собой аминокислоту формулы I, II или III. В некоторых конкретных вариантах осуществления аминокислота формулы I представляет собой Dab, Orn, Lys или гомо-Lys. Также в некоторых вариантах осуществления удлинение приблизительно от 1 приблизительно до 21 аминокислоты содержит аминокислотную последовательность GPSSGAPPPS (SEQ ID NO: 1095) или XGPSSGAPPPS (SEQ ID NO: 1096), где X представляет собой любую аминокислоту, или GPSSGAPPPK (SEQ ID NO: 1170), или XGPSSGAPPPK (SEQ ID NO: 1171), или XGPSSGAPPPSK (SEQ ID NO: 1172), где X представляет собой Gly или небольшую алифатическую или неполярную или незначительно полярную аминокислоту. В некоторых вариантах осуществления приблизительно от 1 приблизительно до 21 аминокислоты могут содержать последовательности, содержащие одну или более консервативных замен относительно SEQ ID NO: 1095, 1096, 1170, 1171 или 1172. В некоторых вариантах осуществления ацилированная или алкилированная аминокислота находится в положении 37, 38, 39, 40, 41, 42 или 43 аналога с C-концевым удлинением. В определенных вариантах осуществления ацилированная или алкилированная аминокислота находится в положении 40 аналога с C-концевым удлинением.

В некоторых вариантах осуществления аналог, обладающий активностью агониста GIP, дополнительно содержит модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, например, модификации аминокислот в положении 27 и/или 28.

В любом из указанных выше иллюстративных вариантов осуществления модификация аминокислоты в положении 1, которая обеспечивает активность агониста GIP, может представлять собой замену His аминокислотой, не содержащей имидазольную боковую цепь. Модификация аминокислоты в положении 1 может, например, представлять собой замену His большой ароматической аминокислотой. В некоторых вариантах осуществления большая ароматическая аминокислота представляет собой любую из больших ароматических аминокислот, описываемых в настоящем описании, включая, например, Tyr.

Также касательно указанных выше иллюстративных вариантов осуществления модификации аминокислот в одном, двух или всех положениях 27, 28 и 29 могут представлять собой любую из модификаций в этих положениях, описываемую в настоящем описании. Например, Met в положении 27 можно заменять большой алифатической аминокислотой необязательно Leu, Asn в положении 28 можно заменять небольшой алифатической аминокислотой необязательно Ala и/или Thr в положении 29 можно заменять небольшой алифатической аминокислотой необязательно Gly. Альтернативно, аналог может содержать такие модификации аминокислот в положении 27 и/или 28.

Аналог указанных выше иллюстративных вариантов осуществления может дополнительно содержать 1-9 или 1-6 дополнительные модификации аминокислот, например, 1, 2, 3, 4, 5, 6, 7, 8 или 9 дополнительных модификаций аминокислот, таких как, например, любую из модификаций, описываемых в настоящем описании, которые повышают или снижают активность в отношении любого из рецепторов GIP, GLP-1 и глюкагона, улучшают растворимость, увеличивают продолжительность действия или время полувыведения из кровотока, замедляют начало действия или увеличивают стабильность. Аналог может дополнительно содержать, например, модификацию аминокислоты в положении 12, необязательно, замену Ile и/или модификации аминокислот в положениях 17 и 18, необязательно замену Q в положении 17 и A в положении 18, и/или добавление GPSSGAPPPS (SEQ ID NO: 1095) или XGPSSGAPPPS (SEQ ID NO: 1096), или последовательностей, содержащих одну или более консервативных замен относительно SEQ ID NO: 1095 или 1096 к C-концу. Аналог может содержать одну или более следующих модификаций:

(i) Ser в положении 2, замещенного D-Ser, Ala, D-Ala, Gly, N-метил-Ser, AIB, Val или α-амино-N-масляной кислотой;

(ii) Tyr в положении 10, замещенного Trp, Lys, Orn, Glu, Phe или Val;

(iii) связи ацильной группы с Lys в положении 10;

(iv) Lys в положении 12, замещенного Arg;

(v) Ser в положении 16, замещенного Glu, Gln, гомоглутаминовой кислотой, гомоцистеиновой кислотой, Thr, Gly или AIB;

(vi) Arg в положении 17, замещенного Gln;

(vii) Arg в положении 18, замещенного Ala, Ser, Thr или Gly;

(viii) Gln в положении 20, замещенного Ala, Ser, Thr, Lys, цитруллином, Arg, Orn или AIB;

(ix) Asp в положении 21, замещенного Glu, гомоглутаминовой кислотой, гомоцистеиновой кислотой;

(x) Val в положении 23, замещенного Ile;

(xi) Gln в положении 24, замещенного Asn, Ala, Ser, Thr или AIB, и

(xii) консервативную замену в положениях 2, 5, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 24, 27, 28 и 29.

Аналог в некоторых вариантах осуществления содержит комбинацию модификаций (i)-(xii). Альтернативно или дополнительно, аналог может содержать модификацию аминокислоты в положении 3 (например, замену аминокислоты Gln на Glu), где аналог обладает менее чем 1% активности глюкагона в отношении рецептора глюкагона. Альтернативно или дополнительно, аналог может содержать модификацию аминокислоты в положении 7 (например, замену аминокислоты Thr аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile), где аналог обладает менее чем приблизительно 10% активности GLP-1 в отношении рецептора GLP-1.

Касательно иллюстративных вариантов осуществления аналог может быть ковалентно связан с гидрофильной группой. В некоторых вариантах осуществления аналог является ковалентно связанным с гидрофильной группой в любом из положений аминокислот 16, 17, 20, 21, 24, 29, 40 или C-конце. В определенных вариантах осуществления аналог содержит C-концевое удлинение (например, аминокислотную последовательность SEQ ID NO: 1095) и добавление аминокислоты, содержащей гидрофильную группу, таким образом, что гидрофильная группа ковалентно связана с аналогом в положении 40.

В еще одних дополнительных иллюстративных вариантах осуществления аналог глюкагона, обладающий активностью агониста GIP, содержит аминокислотную последовательность в соответствии с любой одной из SEQ ID NO: 1227, 1228, 1229 или 1230, которая дополнительно содержит следующие модификации:

(a) необязательно модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP,

(b) удлинение приблизительно от 1 приблизительно до 21 аминокислот от C-конца до аминокислоты в положении 29, где по меньшей мере одна из аминокислот удлинения является ацилированной или алкилированной, и

(d) до 6 дополнительных модификаций аминокислот,

где EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее. В некоторых аспектах ацилированная или алкилированная аминокислота представляет собой аминокислоту формулы I, II или III. В некоторых конкретных вариантах осуществления аминокислота формулы I представляет собой Dab, Orn, Lys или гомо-Lys. Также в некоторых вариантах осуществления приблизительно от 1 приблизительно до 21 аминокислоты содержат аминокислотную последовательность GPSSGAPPPS (SEQ ID NO: 1095) или XGPSSGAPPPS (SEQ ID NO: 1096), где X представляет собой любую аминокислоту, или GPSSGAPPPK (SEQ ID NO: 1170), или XGPSSGAPPPK (SEQ ID NO: 1171), или XGPSSGAPPPSK (SEQ ID NO: 1172), где X представляет собой Gly или небольшую алифатическую или неполярную или незначительно полярную аминокислоту. В некоторых вариантах осуществления приблизительно от 1 приблизительно до 21 аминокислоты могут содержать последовательности, содержащие одну или более консервативных замен относительно SEQ ID NO: 1095, 1096, 1170, 1171 или 1172. В некоторых вариантах осуществления ацилированная или алкилированная аминокислота находится в положении 37, 38, 39, 40, 41, 42 или 43 аналога с C-концевым удлинением. В определенных вариантах осуществления ацилированная или алкилированная аминокислота находится в положении 40 аналога с C-концевым удлинением. В любом из указанных выше иллюстративных вариантов осуществления аминокислота в положении 1, которая обеспечивает активность агониста GIP, может представлять собой аминокислоту, не содержащую имидазольную боковую цепь.

Аналог указанных выше иллюстративных вариантов осуществления может дополнительно содержать 1-6 дополнительных модификаций аминокислот, таких как, например, любую из модификаций, описываемых в настоящем описании, которая повышает или снижает активность в отношении любого из рецепторов GIP, GLP-1 и глюкагона, улучшает растворимость, увеличивает продолжительность действия или время полувыведения из кровотока, замедляет начало действия или повышает стабильность.

В определенных аспектах аналоги глюкагона, описанные в указанном выше иллюстративном варианте осуществления, содержат дополнительные модификации аминокислот в одном, двух или всех положениях 27, 28 и 29. Модификации в этих положениях могут представлять собой любые из модификаций, описываемых в настоящем описании в отношении этих положений. Например, относительно SEQ ID NO: 1227, 1228, 1229 или 1230, положение 27 можно замещать большой алифатической аминокислотой (например, Leu, Ile или норлейцином) или Met, положение 28 можно замещать другой небольшой алифатической аминокислотой (например, Gly или Ala) или Asn, и/или положение 29 можно замещать другой небольшой алифатической аминокислотой (например, Ala или Gly) или Thr. Альтернативно, аналог может содержать такие модификации аминокислот в положении 27 и/или 28.

Аналог может дополнительно содержать одну или более из следующих ниже дополнительных модификаций:

(i) аминокислота в положении 2 представляет собой любую аминокислоту из D-Ser, Ala, D-Ala, Gly, N-метил-Ser, AIB, Val или α-амино-N-масляную кислоту;

(ii) аминокислота в положении 10 представляет собой Tyr, Trp, Lys, Orn, Glu, Phe или Val;

(iii) связи ацильной группы с Lys в положении 10;

(iv) аминокислота в положении 12 представляет собой Ile, Lys или Arg;

(v) аминокислота в положении 16 представляет собой любую аминокислоту из Ser, Glu, Gln, гомоглутаминовой кислоты, гомоцистеиновой кислоты, Thr, Gly или AIB;

(vi) аминокислота в положении 17 представляет собой Gln или Arg;

(vii) аминокислота в положении 18 представляет собой любую аминокислоту из Ala, Arg, Ser, Thr или Gly;

(viii) аминокислота в положении 20 любую аминокислоту из Ala, Ser, Thr, Lys, цитруллина, Arg, Orn или AIB или другую альфа,альфа-двузамещенную аминокислоту;

(ix) аминокислота в положении 21 представляет собой любую аминокислоту из Glu, Asp, гомоглутаминовой кислоты, гомоцистеиновой кислоты;

(x) аминокислота в положении 23 представляет собой Val или Ile;

(xi) аминокислота в положении 24 представляет собой любую аминокислоту из Gln, Asn, Ala, Ser, Thr или AIB, и

(xii) одну или более консервативных замен в положениях 2, 5, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 24, 27, 28 и 29.

Аналог в некоторых вариантах осуществления содержит комбинацию модификаций (i)-(xii). Альтернативно или дополнительно, аналог может содержать модификацию аминокислоты в положении 3 (например, замену аминокислоты Gln на Glu), где аналог обладает менее чем 1% активности глюкагона в отношении рецептора глюкагона. Альтернативно или дополнительно, аналог может содержать модификацию аминокислоты в положении 7 (например, замену аминокислоты Thr аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile), где аналог обладает менее чем приблизительно 10% активности GLP-1 в отношении рецептора GLP-1.

В указанных выше иллюстративных вариантах осуществления, где аналог содержит ацильную или алкильную группу, аналог можно присоединять к ацильной или алкильной группе через спейсер, как описано в настоящем описании. Спейсер, например, может составлять от 3 до 10 атомов в длину и может представлять собой, например, аминокислоту (например, 6-аминогексановую кислоту, любую аминокислоту, описываемую в настоящем описании), дипептид (например, Ala-Ala, βAla-βAla, Leu-Leu, Pro-Pro, γGlu-γGlu), трипептид или гидрофильный или гидрофобный бифункциональный спейсер. В определенных аспектах общая длина спейсера и ацильной или алкильной группы составляет приблизительно от 14 приблизительно до 28 атомов. В некоторых вариантах осуществления аминокислотный спейсер не является γ-Glu. В некоторых вариантах осуществления дипептидный спейсер не является γ-Glu-γ-Glu.

В некоторых конкретных вариантах осуществления аналог по изобретению содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 1099-1141, 1144-1164, 1166, 1192-1207, 1209-1221 и 1223 или выбранной из группы, состоящей из SEQ ID NO: 1167-1169, 1173-1178 и 1225.

В еще одних дополнительных иллюстративных вариантах осуществления аналог глюкагона, обладающий активностью агониста GIP, содержит ацильную или алкильную группу (например, ацильную или алкильную группу, которая не является нативной для природной аминокислоты), где ацильную или алкильную группу присоединяют к спейсеру, где (i) спейсер присоединяют к боковой цепи аминокислоты в положении 10 аналога; или (ii) аналог содержит удлинение ом 1 до 21 аминокислоты от C-конца до аминокислоты в положении 29, и спейсер присоединяют к боковой цепи аминокислоты, соответствующей одному из положений 37-43 относительно SEQ ID NO: 1001, где EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее.

В таких вариантах осуществления аналог может содержать аминокислотную последовательность SEQ ID NO: 1001 с (i) модификацией аминокислоты в положении 1, которая обеспечивает активность агониста GIP, (ii) модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, (iii) по меньшей мере с одним из:

(A) аналог содержит лактамовый мостик между боковыми цепями аминокислот в положениях i и i+4 или между боковыми цепями аминокислот в положениях j и j+3, где i равно 12, 13, 16, 17, 20 или 24, и где j равно 17;

(B) одна, две, три или все аминокислоты в положениях 16, 20, 21 и 24 аналога являются замещенными α,α-двузамещенной аминокислотой, или

(C) аналог содержит (i) замену аминокислоты Ser в положении 16 аминокислотой формулы IV:

[Формула IV],

где n равно 1 до 7, где каждый из R1 и R2 независимо выбран из группы, состоящей из H, C1-C18алкила, (C1-C18алкил)OH, (C1-C18алкил)NH2, (C1-C18алкил)SH, (C0-C4алкил)(C3-C6)циклоалкила, (C0-C4алкил)(C2-C5гетероцикл), (C0-C4алкил)(C6-C10арил)R7 и (C1-C4алкил)(C3-C9гетероарил), где R7 представляет собой H или OH, и боковая цепь аминокислоты формулы IV содержит свободную аминогруппу и (ii) замену аминокислоты Gln в положении 20 альфа,альфа-двузамещенной аминокислотой, и (iv) до 6 дополнительных модификаций аминокислот.

Альфа,альфа-двузамещенная аминокислота аналога этих вариантов осуществления может представлять собой любую альфа,альфа-двузамещенную аминокислоту, включая, но, не ограничиваясь ими, аминоизомасляную кислоту (AIB), аминокислоту, двузамещенную одной и той же или отличной группой, выбранной из метила, этила, пропила, и н-бутила, или циклооктаном или циклогептаном (например, 1-аминоциклооктан-1-карбоновой кислотой). В определенных вариантах осуществления альфа,альфа-двузамещенная аминокислота представляет собой AIB.

Аминокислота формулы IV аналога этих вариантов осуществления может представлять собой любую аминокислоту, такую как, например, аминокислоту формулы IV, где n равно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 или 16. В определенных вариантах осуществления n равно 2, 3, 4 или 5, в случае чего аминокислота представляет собой Dab, Orn, Lys или гомо-Lys соответственно. В любом из указанных выше иллюстративных вариантов осуществления модификация аминокислоты в положении 1, которая обеспечивает активность агониста GIP, может представлять собой замену His аминокислотой, не содержащей имидазольной боковой цепи.

Также в отношении указанных выше иллюстративных вариантов осуществления модификации аминокислот в одном, двух или всех положениях 27, 28 и 29 могут представлять собой любую из модификаций в этих положениях, описываемых в настоящем описании. Например, Met в положении 27 можно заменять большой алифатической аминокислотой необязательно Leu, Asn в положении 28 можно заменять небольшой алифатической аминокислотой необязательно Ala и/или Thr в положении 29 можно заменять небольшой алифатической аминокислотой необязательно Gly. Альтернативно, аналог может содержать такие модификации аминокислот в положении 27 и/или 28.

Аналог может дополнительно содержать, например, модификацию аминокислоты в положении 12, необязательно замену Ile и/или модификации аминокислот в положениях 17 и 18, необязательно замену Q в положении 17 и A в положении 18, и/или добавление GPSSGAPPPS (SEQ ID NO: 1095) или XGPSSGAPPPS (SEQ ID NO: 1096), или последовательностей, содержащих одну или более консервативных замен относительно SEQ ID NO: 1095 или 1096, к C-концу. Аналог может содержать одну или более следующих модификаций:

(i) Ser в положении 2, замещаемого D-Ser, Ala, D-Ala, Gly, N-метил-Ser, AIB, Val или α-амино-N-масляной кислотой;

(ii) Tyr в положении 10, замещаемого Trp, Lys, Orn, Glu, Phe или Val;

(iii) связи ацильной группы с Lys в положении 10;

(iv) Lys в положении 12, замещаемого Arg;

(v) Ser в положении 16, замещаемого Glu, Gln, гомоглутаминовой кислотой, гомоцистеиновой кислотой, Thr, Gly, Lys или AIB;

(vi) Arg в положении 17, замещаемого Gln;

(vii) Arg в положении 18, замещаемого Ala, Ser, Thr или Gly;

(viii) Gln в положении 20, замещаемого Ala, Ser, Thr, Lys, цитруллин, Arg, Orn или AIB;

(ix) Asp в положении 21, замещаемого Glu, гомоглутаминовой кислотой, гомоцистеиновой кислотой;

(x) Val в положении 23, замещаемого Ile;

(xi) Gln в положении 24, замещаемого Asn, Ala, Ser, Thr или AIB, и

(xii) консервативной замены в положениях 2, 5, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 24, 27, 28 и 29.

Аналог в некоторых вариантах осуществления содержит комбинацию модификаций (i)-(xii). Альтернативно или дополнительно, аналог может содержать модификацию аминокислоты в положении 3 (например, замену аминокислоты Gln на Glu), где аналог обладает менее чем 1% активности глюкагона в отношении рецептора глюкагона. Альтернативно или дополнительно, аналог может содержать модификацию аминокислоты в положении 7 (например, замену аминокислоты Thr аминокислотой, не содержащей гидроксильной группы, например, Abu или Ile), делецию аминокислоты(т) от C-конца до аминокислоты в положении 27 или 28, что приводит к образованию пептида диной 27 или 28 аминокислот, или их сочетание, где аналог обладает менее чем приблизительно 10% активности GLP-1 в отношении рецептора GLP-1.

Касательно иллюстративных вариантов осуществления аналог можно ковалентно связывать с гидрофильной группой. В некоторых вариантах осуществления аналог ковалентно связывают с гидрофильной группой в любом из положений аминокислот 16, 17, 20, 21, 24, 29, 40 или C-конца. В определенных вариантах осуществления аналог содержит C-концевое удлинение (например, аминокислотную последовательность SEQ ID NO: 1095) и добавление аминокислоты, содержащей гидрофильную группу, таким образом, что гидрофильная группа ковалентно связана с аналогом в положении 40.

В некоторых вариантах осуществления гидрофильная группа ковалентно связана с Lys, Cys, Orn, гомоцистеином или ацетилфенилаланином аналога. Lys, Cys, Orn, гомоцистеин, или ацетилфенилаланин может представлять собой аминокислоту, которая является нативной по отношению к последовательности глюкагона (SEQ ID NO: 1001), или она может представлять собой аминокислоту, которая заменяет нативную аминокислоту SEQ ID NO: 1001. В некоторых вариантах осуществления, где гидрофильная группа является присоединенной к Cys, связь с гидрофильной группой может содержать структуру

Касательно аналогов, содержащих гидрофильную группу, гидрофильная группа может представлять собой любую из гидрофильных групп, описываемых в настоящем описании. См., например, указания под заголовком "Связь гидрофильных групп". В некоторых вариантах осуществления гидрофильная группа представляет собой полиэтиленгликоль (PEG). В определенных вариантах осуществления молекулярная масса PEG составляет приблизительно от 1000 Дальтон приблизительно до 40000 Дальтон, например, приблизительно от 20000 Дальтон приблизительно до 40000 Дальтон.

В иллюстративных вариантах осуществления, где аналог содержит ацильную или алкильную группу, которую присоединяют к аналогу через спейсер, спейсер может представлять собой любой спейсер, как описано в настоящем описании. Длина спейсера, например, может составлять от 3 до 10 атомов, и он может представлять собой, например, аминокислоту (например, 6-аминогексановую кислоту, любую аминокислоту, описываемую в настоящем описании), дипептид (например, Ala-Ala, βAla-βAla, Leu-Leu, Pro-Pro, γGlu-γGlu), трипептид или гидрофильный или гидрофобный бифункциональный спейсер. В определенных аспектах общая длина спейсера и ацильной или алкильной группы составляет приблизительно от 14 приблизительно до 28 атомов. В некоторых вариантах осуществления аминокислотный спейсер не является γ-Glu. В некоторых вариантах осуществления дипептидный спейсер не является γ-Glu-γ-Glu.

Ацильная или алкильная группа представляет собой любую ацильную или алкильную группу, как описано в настоящем описании, такую как ацильная или алкильная группа, которая не является нативной для природной аминокислоты. Ацильная или алкильная группа в некоторых вариантах осуществления представляет собой ацильную группу C4-C30жирных кислот, таких как, например, ацильная или алкильная группа C10жирных кислот, ацильная или алкильная группа C12жирных кислот, ацильная или алкильная группа C14жирных кислот, ацильная или алкильная группа C16жирных кислот, ацильная или алкильная группа C18жирных кислот, ацильная или алкильная группа C120ирных кислот или ацильная или алкильная группа C22ирных кислот, или C4-C30алкильную группу. В конкретных вариантах осуществления ацильная группа представляет собой ацильную группу C12-C18жирных кислот (например, ацильную группу C14-C16жирных кислот).

В некоторых вариантах осуществления удлинение приблизительно от 1 приблизительно до 21 аминокислоты от C-конца до аминокислоты в положении 29 аналога содержит аминокислотную последовательность GPSSGAPPPS (SEQ ID NO: 1095) или XGPSSGAPPPS (SEQ ID NO: 1096), где X представляет собой любую аминокислоту, или GPSSGAPPPK (SEQ ID NO: 1170), или XGPSSGAPPPK (SEQ ID NO: 1171), или XGPSSGAPPPSK (SEQ ID NO: 1172), где X представляет собой Gly или небольшую алифатическую или неполярную или незначительно полярную аминокислота. В некоторых вариантах осуществления приблизительно от 1 приблизительно до 21 аминокислоты могут содержать последовательности, содержащие одну или более консервативных замен относительно SEQ ID NO: 1095, 1096, 1170, 1171 или 1172. В некоторых вариантах осуществления ацилированная или алкилированная аминокислота находится в положении 37, 38, 39, 40, 41, 42 или 43 аналога с C-концевым удлинением. В определенных вариантах осуществления ацилированная или алкилированная аминокислота находится в положении 40 аналога с C-концевым удлинением. В определенных вариантах осуществления ацильная или алкильная группа ковалентно связана с аминокислотой, которая является нативной для SEQ ID NO: 1001, 1227, 1228, 1229 или 1230, или она может быть связана с замещенной аминокислотой. В определенных вариантах осуществления ацильная или алкильная группа ковалентно связана с аминокислотой, которая является нативной для SEQ ID NO: 1095, 1096,1171 или 1172.

Агонист GIP может представлять собой пептид, содержащий аминокислотную последовательность любой из аминокислотных последовательностей, например, SEQ ID NO: 1005-1094, необязательно с 1, 2, 3, 4 или до 5 дополнительных модификаций, которые сохраняют активность агониста GIP. В определенных вариантах осуществления агонист GIP содержит аминокислоты любой из SEQ ID NO: 1099-1262.

Глюкагоноподобные пептиды 3 класса

В определенных вариантах осуществления родственный глюкагону пептид представляет собой родственный глюкагону пептид 3 класса, который описан в настоящем описании и в международной патентной заявке № PCT/US2009/47438 (зарегистрированной 16 июня 2009 года), публикации международной патентной заявки № WO 2008/101017, опубликованной 21 августа 2008 года, и предварительной заявке США № 61/090412 и заявке США № 61/177476, содержание которых полностью включено посредством ссылки.

Некоторые из биологических последовательностей, указанные в следующем ниже разделе (SEQ ID NO: 89-108, 114-128 и 146-656) касательно родственных глюкагону пептидов 3 класса, соответствуют SEQ ID NO: 89-108, 114-128 и 146-656 в международной патентной заявке № PCT/US2009/47438.

Активность

Родственный глюкагону пептид 3 класса может представлять собой пептид, который обладает повышенной активностью в отношении рецептора глюкагона, и в дополнительных вариантах осуществления обладает повышенной биофизической стабильностью и/или растворимостью в воде. Кроме того, в некоторых вариантах осуществления родственный глюкагону пептид 3 класса утратил селективность нативного глюкагона к рецептору глюкагона в сравнении с рецептором GLP-1, и, таким образом, представляет собой коагонисты этих двух рецепторов. Селективными модификациями аминокислот в родственном глюкагону пептиде 3 класса можно контролировать относительную активность пептид в отношении рецептора GLP-1 в сравнении с рецептором глюкагона. Таким образом, родственный глюкагону пептид 3 класса может представлять собой коагонист глюкагона/GLP-1, который обладает более высокой активностью в отношении рецептора глюкагона в сравнении с рецептором GLP-1, коагонист глюкагона/GLP-1, который обладает приблизительно эквивалентной активностью в отношении обоих рецепторов, или коагонист глюкагона/GLP-1, который обладает более высокой активностью в отношении рецептора GLP-1 в сравнении с рецептором глюкагона. Последнюю категория коагониста можно конструировать так, чтобы он обладал незначительной активностью или не обладал активностью в отношении рецептора глюкагона и все ее сохранял способность активировать рецептор GLP-1 с той же или лучшей активностью, чем нативный GLP-1. Любой из этих коагонистов также может содержать модификации, которые обеспечивают повышенную биофизическую стабильность и/или растворимость в воде.

Можно проводить модификации родственного глюкагону пептида 3 класса для получения родственного глюкагону пептида, обладающего по меньшей мере приблизительно от 1% (включая по меньшей мере приблизительно 1,5%, 2%, 5%, 7%, 10%, 20%, 30%, 40%, 50%, 60%, 75%, 100%, 125%, 150%, 175%) приблизительно до 200% или более активности в отношении рецептора GLP-1 по сравнению с нативным GLP-1 и по меньшей мере приблизительно от 1% (включая приблизительно 1,5%, 2%, 5%, 7%, 10%, 20%, 30%, 40%, 50%, 60%, 75%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 350%, 400%, 450%) приблизительно до 500% или более активности в отношении рецептора глюкагона по сравнению с нативным глюкагоном. Аминокислотная последовательность нативного глюкагона представляет собой SEQ ID NO: 701, аминокислотная последовательность амида GLP-1(7-36) представляет собой SEQ ID NO: 703, и аминокислотная последовательность кислоты GLP-1 (7-37) представляет собой SEQ ID NO: 704.

Родственный глюкагону пептид 3 класса может представлять собой родственный глюкагону пептид с повышенной или пониженной активностью в отношении рецептора глюкагона или рецептора GLP-1, или обоих. Родственный глюкагону пептид 3 класса может представлять собой родственный глюкагону пептид с измененной активностью в отношении рецептора глюкагона в сравнении с рецептором GLP-1. Как описано в настоящем описании, предоставлены родственных глюкагону пептидов 3 класса с высокой активностью, которые также обладают улучшенной растворимостью и/или стабильностью.

Модификации, влияющие на активность глюкагона

Увеличенную активность в отношении рецептора глюкагона обеспечивают модификацией аминокислоты в положении 16 нативного глюкагона (SEQ ID NO: 701). В некоторых вариантах осуществления родственный глюкагону пептид 3 класса представляет собой агонист глюкагона, который модифицировали относительно пептида дикого типа His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr (SEQ ID NO: 701) для повышения активности пептида в отношении рецептора глюкагона. Обычно встречающийся серин в положении 16 нативного глюкагона (SEQ ID NO: 701) можно заменять выбранными кислыми аминокислотами для увеличения активности глюкагона в отношении его способности стимулировать синтез цАМФ в утвержденном анализе модели in vitro (см. пример 7). Более конкретно, такая замена повышает активность аналога по меньшей мере в 2 раза, 4 раза, 5 раз и до 10 раз в отношении рецептора глюкагона. Такая замена также повышает активность аналога в отношении рецептора GLP-1 по меньшей мере в 5 раз, 10 раз или 15 раз относительно нативного глюкагона, но селективность сохраняется к рецептору глюкагона для рецептора GLP-1.

В качестве неограничивающего примера, такую повышенную активность можно обеспечивать заменой природного серина в положении 16 глутаминовой кислотой или другой отрицательно заряженной аминокислотой, содержащей боковую цепь длиной 4 атома, или альтернативно любой аминокислотой из глутамина, гомоглутаминовой кислоты или гомоцистеиновой кислоты, или заряженной аминокислотой, содержащей боковую цепь, содержащую по меньшей мере один гетероатом, (например, N, O, S, P), и с длиной боковой цепи приблизительно 4 (или 3-5) атома. В соответствии с некоторыми вариантами осуществления остаток серина в положении 16 нативного глюкагона заменяют аминокислотой, выбранной из группы, состоящей из глутаминовой кислоты, глутамина, гомоглутаминовой кислоты, гомоцистеиновой кислоты, треонина или глицина. В соответствии с некоторыми вариантами осуществления остаток серина в положении 16 нативного глюкагона заменяют аминокислотой, выбранной из группы, состоящей из глутаминовой кислоты, глутамина, гомоглутаминовой кислоты и гомоцистеиновой кислоты, и в некоторых вариантах осуществления остаток серина заменяют глутаминовой кислотой.

В некоторых вариантах осуществления родственный глюкагону пептид 3 класса с повышенной активностью содержит пептид SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 или аналог агониста глюкагона SEQ ID NO: 93. Некоторые варианты осуществления относятся к родственному глюкагону пептиду 3 класса, обладающему повышенной активностью в отношении рецептора глюкагона относительно глюкагона дикого типа, где пептид содержит последовательность SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97 или SEQ ID NO: 98, где родственный глюкагону пептид сохраняет свою селективность к рецептору глюкагона относительно рецепторов GLP-1. В некоторых вариантах осуществления родственный глюкагону пептид 3 класса, обладающий повышенной специфичностью к рецептору глюкагона, содержит пептид SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98 или его аналог агониста глюкагона, где карбокси-концевая аминокислота сохраняет свою нативную группу карбоновой кислоты. В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид 3 класса содержит последовательность NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-COOH (SEQ ID NO: 98), где пептид обладает приблизительно в пять раз повышенной активностью в отношении рецептора глюкагона относительно нативного глюкагона, как измеряют анализом цАМФ in vitro примера 7.

Активность рецептора глюкагона можно снижать, сохранять или повышать модификацией аминокислоты в положении 3, например, заменой природного глутамина в положении 3. В некоторых вариантах осуществления было показано, что замена аминокислоты в положении 3 кислой, основной или гидрофобной аминокислотой (глутаминовой кислотой, орнитином, норлейцином) по существу снижает или подавляет активность рецептора глюкагона. Аналоги, которые замещают, например, глутаминовой кислотой орнитином или норлейцином, обладают приблизительно 10% или менее активности нативного глюкагона в отношении рецептора глюкагона, например, приблизительно 1-10%, или приблизительно 0,1-10%, или более чем приблизительно 0,1%, но менее приблизительно 10%, при этом обладая по меньшей мере 20% активности GLP-1 в отношении рецептора GLP-1. Например, иллюстративные аналоги, описываемые в настоящем описании, обладают приблизительно 0,5%, приблизительно 1% или приблизительно 7% активности нативного глюкагона, при этом обладая по меньшей мере 20% активности GLP-1 в отношении рецептора GLP-1. В частности, любой из родственные глюкагону пептиды 3 класса, включая аналоги глюкагона, аналоги агониста глюкагона, коагонисты глюкагона и молекулы коагониста глюкагона/GLP-1, описываемые в настоящем описании, можно модифицировать, чтобы они содержали модификацию в положении 3, например, Gln заменяют Glu, с получением пептида с высокой селективностью, например, в десять раз большей селективностью к рецептору GLP-1 по сравнению с селективностью к рецептору глюкагона.

В другом варианте осуществления природный глутамин в положении 3 любого из родственных глюкагону пептидов 3 класса можно заменять аналогом глутамина без существенной потери активности в отношении рецептора глюкагона, и в некоторых случаях с повышением активности рецептора глюкагона, как описано в настоящем описании. В конкретных вариантах осуществления аминокислоту в положении 3 заменяют Dab(Ac). Например, агонисты глюкагона могут содержать аминокислотную последовательность SEQ ID NO: 595, SEQ ID NO: 601, SEQ ID NO: 603, SEQ ID NO: 604, SEQ ID NO: 605 и SEQ ID NO: 606.

Наблюдали, что модификации в положении 2 (например, AIB в положении 2) и в некоторых случаях модификации в положении 1 могут снижать активность глюкагона. Это снижение активности глюкагона можно восстанавливать стабилизацией альфа-спирали на C-концевом участке глюкагона, например, способами, описываемыми в настоящем описании, например, через ковалентную связь между боковыми цепями аминокислот в положениях "i" и "i+4", например, 12 и 16, 16 и 20 или 20 и 24. В некоторых вариантах осуществления эта ковалентная связь представляет собой лактамовый мостик между глутаминовой кислотой в положении 16 и лизином в положении 20. В некоторых вариантах осуществления эта ковалентная связь представляет собой внутримолекулярный мостик, отличный от лактамового мостика. Например, подходящие способы ковалентного связывания включают любой один или более из метатезиса олефинов, циклизации на основе лантионина, образования дисульфидного мостика или модифицированного серосодержащего мостика, использования α,ω-диаминоалкановых связей, образования мостиковых связей между атомами металла и других способов циклизации пептидов.

Модификации, влияющие на активность GLP-1

Повышенную активность в отношении рецептора GLP-1 обеспечивают заменой карбоновой кислота C-концевой аминокислоты заряженной нейтральной группой, такой как амидной или сложноэфирной. В некоторых вариантах осуществления такие родственные глюкагону пептиды 3 класса содержат последовательность SEQ ID NO: 108, где карбокси-концевая аминокислота содержит амидную группу вместо группы карбоновой кислоты, встречающейся в нативной аминокислоте. Такие родственные глюкагону пептиды 3 класса обладают сильной активностью в отношении обоих рецепторов глюкагона и GLP-1 и, таким образом, действуют как коагонисты для обоих рецепторов. В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид 3 класса представляет собой коагонист рецептора глюкагон и GLP-1, где пептид содержит последовательность SEQ ID NO: 108, где аминокислота в положении 28 представляет собой Asn или Lys, и аминокислота в положении 29 представляет собой Thr-амид.

Увеличенную активность в отношении рецептора GLP-1 обеспечивают модификациями, которые стабилизируют альфа-спираль в C-концевой части глюкагона (например, около остатков 12-29). В некоторых вариантах осуществления такие модификации обеспечивают образование внутримолекулярного мостика между боковыми цепями двух аминокислот, которые разделены тремя промежуточными аминокислотами (т.е. аминокислоты в положении "i" и аминокислоты в положении "i+4", где i представляет собой любое целое число от 12 до 25), двумя промежуточными аминокислотами, т.е. аминокислоты в положении "j" и аминокислоты в положении "j+3", где j представляет собой любое целое число от 12 до 27, или шестью промежуточными аминокислотами, т.е. аминокислоты в положении "k" и аминокислоты в положении "k+7", где k представляет собой любое целое число от 12 до 22. В иллюстративных вариантах осуществления мостика или линкера составляет приблизительно 8 (или приблизительно 7-9) атомов в длину и образуется между боковыми цепями аминокислот в положениях 12 и 16, или в положениях 16 и 20, или в положениях 20 и 24, или в положениях 24 и 28. Два боковые цепи аминокислот могут быть связаны друг с другом через нековалентные связи, например, водородную связь, ионные взаимодействия, такие как образование солевых мостиков, или ковалентными связями.

В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид 3 класса обладает активностью коагониста рецептора глюкагона/GLP-1 и содержат аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 99, 101, 102 и 103. В некоторых вариантах осуществления боковые цепи являются ковалентно связанными друг с другом, и в некоторых вариантах осуществления две аминокислоты являются связанными друг с другом с образованием лактамового кольца.

В некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит аналог родственного глюкагону пептида SEQ ID NO: 108, где пептид содержит внутримолекулярный лактамовый мостик, образуемый между положениями аминокислоты 12 и 16 или между положениями аминокислоты 16 и 20. В некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит последовательность SEQ ID NO: 108, где внутримолекулярный лактамовый мостик образуется между положениями аминокислоты 12 и 16, между положениями аминокислоты 16 и 20, или между положениями аминокислоты 20 и 24, и аминокислоты в положении 29 представляет собой глицин, где последовательность SEQ ID NO: 29 является связанной с C-концевой аминокислотой SEQ ID NO: 108. В дополнительном варианте осуществления аминокислота в положении 28 представляет собой аспарагиновую кислоту.

В некоторых конкретных вариантах осуществления стабилизацию структуры альфа-спирали в C-концевой части родственного глюкагону пептида 3 класса получают путем образования внутримолекулярного мостика, отличного от лактамового мостика. Например, для стабилизации альфа-спирали используют подходящие способы ковалентного связывания, которые включают любой один или более из метатезиса олефинов, циклизации на основе лантионина, образования дисульфидного мостика или модифицированного серосодержащего мостика, использования α,ω-диаминоалкановых связей, образования мостиковых связей между атомами металла и другие способы циклизации пептидов.

Кроме того, повышенную активность в отношении рецептора GLP-1 можно получать стабилизацией структуры альфа-спирали в C-концевой части родственного глюкагону пептида (около аминокислот 12-29) путем целенаправленного введения одной или более α,α-двузамещенных аминокислот в положениях, которые сохраняют желаемую активность. Такие пептиды могут рассматривать в настоящее описание как пептид, не содержащий внутримолекулярный мостик. В некоторых аспектах, таким образом, проводят стабилизацию альфа-спирали без введения внутримолекулярного мостика, такого как солевой мостик, или ковалентной связи. В некоторых вариантах осуществления одно, два, три, четыре или более положений 16, 17, 18, 19, 20, 21, 24 или 29 родственного глюкагону пептида замещают α,α-двузамещенной аминокислотой. Например, замена положения 16 родственного глюкагону пептида 3 класса аминоизомасляной кислотой (AIB) повышает активность GLP-1 в отсутствие солевого или лактамового мостика. В некоторых вариантах осуществления одно, два, три, четыре или более положений 16, 20, 21 или 24 замещают AIB.

Повышенную активность в отношении рецептора GLP-1 можно получать модификацией аминокислоты в положении 20. В некоторых вариантах осуществления глутамин в положении 20 заменяют другой гидрофильной аминокислотой, содержащей боковую цепь, которая является заряженной или обладает способностью образовывать водородные связи, и ее длина составляет по меньшей мере приблизительно 5 (или приблизительно 4-6) атомов, например, лизином, цитруллином, аргинином или орнитином.

Увеличенную активность в отношении рецептора GLP-1 демонстрируют для родственных глюкагону пептидов 3 класса, содержащих C-концевое удлинение SEQ ID NO: 78. Активность GLP-1 у таких родственных глюкагону пептидов 3 класса, содержащих SEQ ID NO: 78, можно дополнительно повышать модификацией аминокислоты в положении 18, 28 или 29, или в положении 18 и 29, как описано в настоящем описании. Дополнительное небольшое повышение активности GLP-1 можно получать модификацией аминокислоты в положении 10, чтобы она представляла собой Trp.

Комбинации модификаций, которые повышают активность рецептора GLP-1, могут обеспечивать более высокую активность GLP-1, чем любая из таких модификаций, проводимая по отдельности. Например, родственные глюкагону пептиды 3 класса могут содержать модификации в положении 16, в положении 20 и в C-концевой группе карбоновой кислоты необязательно с ковалентной связью между аминокислотами в положениях 16 и 20; могут содержать модификации в положении 16 и в C-концевой группе карбоновой кислоты; могут содержать модификации в положениях 16 и 20, необязательно с ковалентной связью между аминокислотами в положениях 16 и 20, или могут содержать модификации в положении 20 и в C-концевой группе карбоновой кислоты, необязательно при условии, что аминокислота в положении 12 не является Arg, или необязательно при условии, что аминокислота в положении 9 не является Glu.

Модификации, влияющие на растворимость

Добавление гидрофильной группы

Родственные глюкагону пептиды 3 класса можно дополнительно модифицировать для улучшения растворимости и стабильности пептидов в водных растворах при физиологическом pH, при этом сохраняя высокую биологическую активность относительно нативного глюкагона. Гидрофильные группы, как описано в настоящее описание, можно присоединять к родственному глюкагону пептиду 3 класса, как дополнительно описано в настоящее описание. В соответствии с некоторыми вариантами осуществления ожидают, что введение гидрофильных групп в положениях 17, 21 и 24 родственного глюкагону пептида 3 класса, содержащему SEQ ID NO: 97 или SEQ ID NO: 98, улучшает растворимость и стабильность аналога глюкагона с высокой активностью в растворах, с физиологическим pH. Введение таких групп также увеличивает продолжительность действия, например, как измеряют по пролонгированному периоду полувыведения из кровотока.

В некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 и SEQ ID NO: 107, где боковая цепь аминокислотного остатка в одном из положений 16, 17,21 или 24 указанного родственного глюкагону пептида 3 класса дополнительно содержит цепь полиэтиленгликоля с молекулярной массой, выбранной из диапазона приблизительно от 500 приблизительно до 40000 Дальтон. В некоторых вариантах осуществления цепь полиэтиленгликоля имеет молекулярную массу, выбранную из диапазона приблизительно от 500 приблизительно до 5000 Дальтон. В другом варианте осуществления молекулярная масса цепи полиэтиленгликоля составляет приблизительно от 10000 приблизительно до 20000 Дальтон. В еще одних других иллюстративных вариантах осуществления молекулярная масса цепи полиэтиленгликоля составляет приблизительно от 20000 приблизительно до 40000 Дальтон. В соответствии с некоторыми вариантами осуществления гидрофильная группа содержит цепь полиэтилена (PEG). Более конкретно, в некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит последовательность SEQ ID NO: 94 или SEQ ID NO: 95, где цепь PEG ковалентно связана с боковыми цепями аминокислот, содержащихся в положениях 21 и 24 родственного глюкагону пептида 3 класса, и карбокси-концевая аминокислота родственного глюкагону пептида 3 класса содержит группу карбоновой кислоты. В соответствии с некоторыми вариантами осуществления цепь полиэтиленгликоля имеет среднюю молекулярную массу, выбранную из диапазона приблизительно от 500 приблизительно до 10000 Дальтон.

В соответствии с некоторыми вариантами осуществления пегилированный родственный глюкагону пептид 3 класса содержит две или более цепи полиэтиленгликоля, ковалентно связанные с родственным глюкагону пептидом 3 класса, где общая молекулярная масса цепей глюкагона составляет приблизительно от 1000 приблизительно до 5000 Дальтон. В некоторых вариантах осуществления пегилированный агонист глюкагона содержит пептид, состоящий из SEQ ID NO: 93, или аналог агониста глюкагона SEQ ID NO: 93, где цепь PEG ковалентно связана я аминокислотным остатком в положении 21 и в положении 24, и где суммарная молекулярная масса двух цепей PEG составляет приблизительно от 1000 приблизительно до 5000 Дальтон.

Заряженный C-конец

Растворимость родственного глюкагону пептида 3 класса, содержащего SEQ ID NO: 20, можно дополнительно улучшать, например, введением одной, двух, трех или более заряженных аминокислот в C-концевой участок родственного глюкагону пептида SEQ ID NO: 108, предпочтительно в положение от C-конца до положения 27. Такую заряженную аминокислоту можно вводить заменой нативной аминокислоты заряженной аминокислотой, например, в положениях 28 или 29, или альтернативно добавлением заряженной аминокислоты, например, после положения 27, 28 или 29. В иллюстративных вариантах осуществления одна, две, три или все заряженные аминокислоты являются отрицательно заряженными. Дополнительные модификации, например, консервативные замены, можно проводить по отношению к родственному глюкагону пептида 3 класса, которые все еще позволят сохранять активность глюкагона. Некоторые варианты осуществления относятся к аналогу родственного глюкагону пептида 3 класса SEQ ID NO: 108, где аналог отличается от SEQ ID NO: 108 1-2 заменами аминокислот в положениях 17-26, и в некоторых вариантах осуществления аналог отличается от пептида SEQ ID NO: 108 заменой аминокислоты в положении 20.

Ацилирование/алкилирование

В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид модифицируют, чтобы он содержал ацильную или алкильную группу, например, C4-C30ацильную или C4-C30алкильную группу. В некоторых вариантах осуществления изобретение относится к родственному глюкагону пептиду 3 класса, модифицированного, чтобы он содержал ацильную группу или алкильную группу, ковалентно связанную с аминокислотой в положении 10 родственного глюкагону пептида. Родственный глюкагону пептид может дополнительно содержать спейсер между аминокислотой в положении 10 родственного глюкагону пептида 3 класса и ацильной групп или алкильной группой. Любой из указанных выше родственных глюкагону пептидов 3 класса может содержать два ацильные группы или две алкильные группы, или их сочетание. В конкретном аспекте по изобретению, ацилированный родственный глюкагону пептид 3 класса содержит аминокислотную последовательность любой из SEQ ID NO: 534-544 и 546-549.

C-концевое усечение

В некоторых вариантах осуществления родственные глюкагону пептиды 3 класса, описываемые в настоящем описании, дополнительно модифицируют усечением или делецией одной или двух аминокислот C-конца пептида глюкагона (т.е. положение 29 и/или 28), не оказывая влияния на активность и/или активность в отношении рецепторов глюкагона и GLP-1. В связи с этим родственный глюкагону пептид 3 класса может содержать аминокислоты 1-27 или 1-28 нативного пептида глюкагона (SEQ ID NO: 1) необязательно с одной или более модификациями, описываемыми в настоящем описании. В некоторых вариантах осуществления усеченный родственный глюкагону пептид 3 класса содержит SEQ ID NO: 550 или SEQ ID NO: 551. В другом варианте осуществления усеченный агонист пептида глюкагона содержит SEQ ID NO: 552 или SEQ ID NO: 553.

C-концевое удлинение

В соответствии с некоторыми вариантами осуществления родственные глюкагону пептиды 3 класса, описываемые в настоящем описании, модифицируют добавлением второго пептида к C-концу родственного глюкагону пептида, например, SEQ ID NO: 78, SEQ ID NO: 117 или SEQ ID NO: 118. В некоторых вариантах осуществления родственный глюкагону пептид 3 класса, содержащий последовательность, выбранную из группы, состоящей из SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111 и SEQ ID NO: 69, ковалентно связывают через пептидную связь со вторым пептидом, где второй пептид содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 78, SEQ ID NO: 117 и SEQ ID NO: 118. В дополнительном варианте осуществления в родственных глюкагону пептидах 3 класса, которые содержат C-концевое удлинение, треонин в положении 29 нативного родственного глюкагону пептида, заменяют глицином. Родственный глюкагону пептид 3 класса, содержащий замену глицина треонином в положении 29 и содержащий карбокси-концевое удлинение SEQ ID NO: 78, является в четыре раза более активным в отношении рецептора GLP-1, как нативный глюкагон, модифицированный чтобы содержать карбокси-концевое удлинение SEQ ID NO: 78. Активность в отношении рецептора GLP-1 можно дополнительно повышать заменой аланина нативного аргинина в положении 18.

Таким образом, родственный глюкагону пептид 3 класса может содержать карбокси-концевое удлинение SEQ ID NO: 117 (KRNRNNIA) или SEQ ID NO: 118. В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид 3 класса, содержащий SEQ ID NO: 81 или SEQ ID NO: 108, дополнительно содержит аминокислотную последовательность SEQ ID NO: 117 (KRNRNNIA) или SEQ ID NO: 118, связанную с аминокислотой 29 родственного глюкагону пептида. Более конкретно, родственный глюкагону пептид 3 класса содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 98, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 и SEQ ID NO: 103, дополнительно содержащей аминокислотную последовательность SEQ ID NO: 117 (KRNRNNIA) или SEQ ID NO: 118, связанную с аминокислотой 29 родственного глюкагону пептида. Более конкретно, родственный глюкагону пептид содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 98, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 112, SEQ ID NO: 72 и SEQ ID NO: 120, дополнительно содержащей аминокислотную последовательность SEQ ID NO: 78 (GPSSGAPPPS) или SEQ ID NO: 79, связанную с аминокислотой 29 родственного глюкагону пептида 3 класса. В некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит последовательность SEQ ID NO: 121.

Любую из модификаций, описанных выше по отношению к родственным глюкагону пептидам 3 класса, которые повышают или понижают активность рецептора глюкагона и которые повышают активность рецептора GLP-1, можно применять отдельно или в комбинации. Иллюстративные модификации включают, но не ограничиваются ими:

(A) Улучшение растворимости, например, введением одной, двух, трех или более заряженных аминокислот в C-концевой участок нативного глюкагона, предпочтительно в положение от C-конца до положения 27. Такую заряженную аминокислоту можно вводить заменой нативной аминокислоты заряженной аминокислотой, например, в положениях 28 или 29 или, альтернативно, добавлением заряженной аминокислоты, например, после положения 27, 28 или 29. В иллюстративных вариантах осуществления одна, две, три или все заряженные аминокислоты являются отрицательно заряженными. В других вариантах осуществления одна, две, три или все заряженные аминокислоты являются положительно заряженными. Такие модификации повышают растворимость, например, обеспечивают по меньшей мере в 2-раза, 5-раз, 10-раз, 15-раз, 25-раз, 30-раз или большую растворимость относительно нативного глюкагона при данном pH приблизительно от 5,5 до 8, например, pH 7, при введении через 24 часа при 25°C.

(B) Увеличение растворимости и продолжительности действия или времени полувыведения из кровотока добавлением гидрофильной группы, такой как цепь полиэтиленгликоля, как описано в настоящем описании, например, в положении 16, 17, 20, 21, 24 или 29 или в C-концевой аминокислоте пептида.

(C) Повышение стабильности модификацией аспарагиновой кислоты в положении 15, например, делецией или заменой глутаминовой кислотой, гомоглутаминовой кислотой, цистеиновой кислотой или гомоцистеиновой кислотой. Такие модификации могут уменьшать деградацию или расщепление при pH в диапазоне от 5,5 до 8, в частности в кислых или щелочных буферах, например, сохраняя по меньшей мере 75%, 80%, 90%, 95%, 96%, 97%, 98% или 99% исходного пептида через 24 часа при 25°C.

(D) Повышение стабильности модификацией метионина в положении 27, например, заменой лейцином или норлейцином. Такие модификации могут уменьшать окислительную деградацию. Стабильность также можно увеличивать модификацией Gln в положении 20 или 24, например, заменой Ser, Thr, Ala или AIB. Такие модификации могут уменьшать деградацию, которая происходит путем дезамидирования Gln. Стабильность можно увеличивать модификацией Asp в положении 21, например, заменой на Glu. Такие модификации могут уменьшать деградацию, которая происходит путем дегидратации Asp с образованием циклического сукцинимидного промежуточного соединения с последующей изомеризацией до изоаспартата.

(E) Повышение устойчивости к расщеплению дипептидилпептидазой IV (DPP IV) модификацией аминокислоты в положении 1 или 2 устойчивыми к DPP-IV аминокислотами, описываемыми в настоящем описании и включая модификацию аминокислоты в положении 2 N-метилаланином.

(F) Консервативные или неконсервативные замены, добавления или делеции, которые не влияют на активность, например, консервативные замены в одном или более положений 2, 5, 7, 10, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 24, 27, 28 или 29; делеции в одном или более положений 27, 28 или 29, или делеция аминокислоты 29 необязательно в сочетании с C-концевым амидом или сложным эфиром вместо C-концевой группы карбоновой кислоты;

(G) Добавление C-концевых удлинений, как описано в настоящем описании;

(H) Увеличение времени полувыведения из кровотока и/или продолжительности действия, и/или замедление начала действия, например, путем ацилирования или алкилирования родственного глюкагону пептида, как описано в настоящем описании;

(I) Гомодимеризацию или гетеродимеризацию, как описано в настоящем описании.

Другие модификации включают замену His в положении 1 большой ароматической аминокислотой (например, Tyr, Phe, Trp или амино-Phe); Ser в положении 2 на Ala; замену Tyr в положении 10 на Val или Phe; замену Lys в положении 12 на Arg; замену Asp в положении 15 на Glu; замену Ser в положении 16 на Thr или AIB.

Родственные глюкагону пептиды 3 класса с активностью GLP-1, которые содержат неконсервативную замену His в положении 1 большой ароматической аминокислотой (например, Tyr) могут сохранять активность GLP-1 при условии, что альфа-спираль является стабилизированной посредством внутримолекулярного мостика, например, такого как любого из внутримолекулярных мостиков, описываемым в настоящем описании.

Конъюгаты и слияния

Родственный глюкагону пептид 3 класса можно связывать необязательно через ковалентную связь и необязательно через линкер с конъюгатной группой. Родственный глюкагону пептид 3 класса также может являться частью слитого пептида или белка, где второй пептид или полипептид сливали с концом, например, карбокси-концом родственного глюкагону пептида 3 класса. Более конкретно, слитый родственный глюкагону пептид 3 класса может содержать агонист глюкагона SEQ ID NO: 72, SEQ ID NO: 97 или SEQ ID NO: 98, дополнительно содержащий аминокислотную последовательность SEQ ID NO: 78 (GPSSGAPPPS), SEQ ID NO: 117 (KRNRNNIA) или SEQ ID NO: 118 (KRNR), связанную с аминокислотой 29 родственного глюкагону пептида. В некоторых вариантах осуществления аминокислотная последовательность SEQ ID NO: 78 (GPSSGAPPPS), SEQ ID NO: 117 (KRNRNNIA) или SEQ ID NO: 118 (KRNR) является связанной с аминокислотой 29 родственного глюкагону пептида 3 класса через пептидную связь. Заявители открыли, что в слитых пептидах родственного глюкагону пептида 3 класса, содержащих C-концевое удлинение пептида экзендина-4 (например, SEQ ID NO: 78 или SEQ ID NO: 79), замена нативного остатка треонина в положении 29 глицином значительно повышает активность рецептора GLP-1. Такую замену аминокислоты можно использовать в сочетании с другими модификациями, описываемыми в настоящем описании по отношению к родственным глюкагону пептидам 3 класса, для повышения аффинности аналогов глюкагона к рецептору GLP-1. Например, замену T29G можно комбинировать с заменами аминокислот S16E и N20K, необязательно с лактамовым мостиком между аминокислотами 16 и 20, и необязательно с добавлением цепи PEG, как описано в настоящем описании.

В некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит последовательность SEQ ID NO: 121. В некоторых вариантах осуществления часть родственного глюкагону пептида 3 класса слитого пептида глюкагона выбрана из группы, состоящей из SEQ ID NO: 72, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, и SEQ ID NO: 93, где цепь PEG, если находится в положениях 17, 21, 24, или в C-концевой аминокислоте, или в обоих положениях 21 и 24, выбрана из диапазона от 500 до 40000 Дальтон. Более конкретно, в некоторых вариантах осуществления сегмент родственного глюкагону пептида 3 класса выбран из группы, состоящей из SEQ ID NO: 95, SEQ ID NO: 96, и SEQ ID NO: 122, где цепь PEG выбрана из диапазона от 500 до 5000. В некоторых вариантах осуществления родственный глюкагону пептид 3 класса представляет собой слитый пептид, содержащий последовательность SEQ ID NO: 72 и SEQ ID NO: 80, где пептид SEQ ID NO: 80 является слитым с C-концом SEQ ID NO: 72.

В соответствии с некоторыми вариантами осуществления дополнительная химическая модификация родственного глюкагону пептида 3 класса SEQ ID NO: 98 обеспечивает повышенную активность рецептора GLP-1 до той точки, где относительная активность в отношении рецепторов глюкагона и GLP-1 является фактически равной. Таким образом, в некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит концевую аминокислоту, содержащую амидную группу вместо группы карбоновой кислоты, которая содержится в нативной аминокислоте. Относительная активность родственного глюкагону пептида 3 класса в отношении соответствующих рецепторов глюкагона и GLP-1 можно регулировать дополнительными модификациями родственного глюкагону пептида 3 класса с получением аналогов, демонстрирующих приблизительно от 40% приблизительно до 500% или более активности нативного глюкагона в отношении рецептора глюкагона и приблизительно от 20% приблизительно до 200% или более активности нативного GLP-1 в отношении рецептора GLP-1, например, в 50 раз, 100 раз или более повышение относительно нормальной активности глюкагона в отношении рецептора GLP-1.

Иллюстративные варианты осуществления

Некоторые варианты осуществления относятся к аналогу глюкагона, содержащему последовательность SEQ ID NO: 72, где указанный аналог отличается от SEQ ID NO: 72 на 1-3 аминокислоты, выбранных из положений 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 24, 27, 28 и 29, где указанный родственный глюкагону пептид обладает по меньшей мере 20% активности нативного GLP-1 в отношении рецептора GLP-1.

Некоторые варианты осуществления относятся к коагонисту рецептора глюкагона/GLP-1, содержащему последовательность:

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Xaa-Arg-Arg-Ala-Xaa-Asp-Phe-Val-Xaa-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 81), где Xaa в положении 15 выбран из группы из аминокислот, состоящих из Asp, Glu, цистеиновой кислоты, гомоглутаминовой кислоты и гомоцистеиновой кислоты, Xaa в положении 16 выбран из группы из аминокислот, состоящих из Ser, Glu, Gln, гомоглутаминовой кислоты и гомоцистеиновой кислоты, Xaa в положении 20 представляет собой Gln или Lys, Xaa в положении 24 представляет собой Gln или Glu, Xaa в положении 28 представляет собой Asn, Lys или кислую аминокислоту, Xaa в положении 29 представляет собой Thr, Gly или кислую аминокислоту, и R представляет собой COOH или CONH2 при условии, что, когда положение 16 представляет собой серин, положение 20 представляет собой Lys, или альтернативно, когда положение 16 представляет собой серин, положение 24 представляет собой Glu, и либо положение 20, либо положение 28 представляет собой Lys. В некоторых вариантах осуществления коагонист рецептора глюкагона/GLP-1 содержит последовательность SEQ ID NO: 81, где аминокислота в положении 28 представляет собой аспарагиновую кислоту, и аминокислота в положении 29 представляет собой глутаминовую кислоту. В другом варианте осуществления аминокислота в положении 28 представляет собой нативный аспарагин, аминокислота в положении 29 представляет собой глицин, и аминокислотная последовательность SEQ ID NO: 79 или SEQ ID NO: 80 ковалентно связана с C-концом SEQ ID NO: 81.

Некоторые варианты осуществления относятся к коагонисту, содержащему последовательность SEQ ID NO: 81, где дополнительные кислые аминокислоты добавлены к карбокси-концу пептида. В дополнительном варианте осуществления карбокси-концевая аминокислота аналога глюкагона содержит амид вместо группы карбоновой кислоты природной аминокислоты. В некоторых вариантах осуществления аналог глюкагона содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87 и SEQ ID NO: 88.

Некоторые варианты осуществления относятся к аналогу родственного глюкагону пептида SEQ ID NO: 81, где указанный аналог отличается от SEQ ID NO: 81 1-3 аминокислотами, выбранными из положений 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21 и 27, при условии, что, когда аминокислота в положении 16 представляет собой серин, положение 20 представляет собой лизин, или образуется лактамовый мостик между аминокислотой в положении 24 и аминокислотой в положении 20 или положении 28. В соответствии с некоторыми вариантами осуществления аналог отличается от SEQ ID NO: 81 1-3 аминокислотами, выбранными из положений 1, 2, 3, 21 и 27. В некоторых вариантах осуществления глюкагон пептид аналог SEQ ID NO: 81 отличается от этой последовательности 1-2 аминокислотами или в некоторых вариантах осуществления одной аминокислотой, выбранной из положений 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21 и 27, при условии, что, когда аминокислота в положении 16 представляет собой серин, положение 20 представляет собой лизин, или образуется лактамовый мостик между аминокислотой в положении 24 и аминокислотой в положении 20 или положении 28.

Другой вариант осуществления относится к относительно селективному агонисту рецептора GLP-1, содержащему последовательность NH2-His-Ser-Xaa-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Xaa-Arg-Arg-Ala-Xaa-Asp-Phe-Val-Xaa-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 83), где Xaa в положении 3 выбран из группы аминокислот, состоящей из Glu, Orn или Nle, Xaa в положении 15 выбран из группы аминокислот, состоящей из Asp, Glu, цистеиновой кислоты, гомоглутаминовой кислоты и гомоцистеиновой кислоты, Xaa в положении 16 выбран из группы аминокислот, состоящей из Ser, Glu, Gln, гомоглутаминовой кислоты и гомоцистеиновой кислоты, Xaa в положении 20 представляет собой Gln или Lys, Xaa в положении 24 представляет собой Gln или Glu, Xaa в положении 28 представляет собой Asn, Lys или кислую аминокислоту, Xaa в положении 29 представляет собой Thr, Gly или кислую аминокислоту, и R представляет собой COOH, CONH2, SEQ ID NO: 78 или SEQ ID NO: 79, при условии, что, когда положение 16 представляет собой серин, положение 20 представляет собой Lys, или альтернативно, когда положение 16 представляет собой серин положение 24 представляет собой Glu, и положение 20 или положение 28 представляет собой Lys. В некоторых вариантах осуществления аминокислота в положении 3 представляет собой глутаминовую кислоту. В некоторых вариантах осуществления кислая аминокислота, замещенная в положении 28 и/или 29, представляет собой аспарагиновую кислоту или глутаминовую кислоту.

В некоторых вариантах осуществления родственный глюкагону пептид, включая пептид коагониста, содержит последовательность SEQ ID NO: 81, дополнительно содержащую дополнительную кислую аминокислоту, добавляемую к C-концу пептида. В дополнительном варианте осуществления карбокси-концевая аминокислота аналога глюкагона содержит амид вместо группы карбоновой кислоты природной аминокислоты.

Некоторые варианты осуществления относятся к коагонисту рецептора глюкагона/GLP-1, содержащему модифицированный родственный глюкагону пептид, выбранный из группы, состоящей из:

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Xaa-Arg-Arg-Ala-Xaa-Asp-Phe-Val-Xaa-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 82), где Xaa в положении 15 выбран из группы аминокислот, состоящей из Asp, Glu, цистеиновой кислоты, гомоглутаминовой кислоты и гомоцистеиновой кислоты, Xaa в положении 16 выбран из группы аминокислот, состоящей из Ser, Glu, Gln, гомоглутаминовой кислоты и гомоцистеиновой кислоты, Xaa в положении 20 представляет собой Gln или Lys, Xaa в положении 24 представляет собой Gln или Glu, и Xaa в положении 28 представляет собой Asn, Asp или Lys, R представляет собой COOH или CONH2, Xaa в положении 29 представляет собой Thr или Gly, и R представляет собой COOH, CONH2, SEQ ID NO: 78 или SEQ ID NO: 79, при условии, что, когда положение 16 представляет собой серин, положение 20 представляет собой Lys, или альтернативно, когда положение 16 представляет собой серин, положение 24 представляет собой Glu, и положение 20 или положение 28 представляет собой Lys. В некоторых вариантах осуществления R представляет собой CONH2, Xaa в положении 15 представляет собой Asp, Xaa в положении 16 выбран из группы аминокислот, состоящей из Glu, Gln, гомоглутаминовой кислоты и гомоцистеиновой кислоты, каждый из Xaa в положениях 20 и 24 представляет собой Gln, Xaa в положении 28 представляет собой Asn или Asp, и Xaa в положении 29 представляет собой Thr.

В некоторых вариантах осуществления каждый из Xaa в положениях 15 и 16 представляет собой Glu, каждый из Xaa в положениях 20 и 24 представляет собой Gln, Xaa в положении 28 представляет собой Asn или Asp, Xaa в положении 29 представляет собой Thr, и R представляет собой CONH2.

Опубликовано, что определенные положения нативного пептида глюкагона можно модифицировать при сохранении по меньшей мере некоторой активности исходного пептида. Таким образом, заявители ожидают, что одну или более аминокислот, находящихся в положениях в положениях 2, 5,7, 10, 11, 12, 13, 14, 17, 18, 19, 20,21,24, 27,28 или 29 пептида SEQ ID NO: 99, можно заменять аминокислотой, отличающейся от содержащейся в нативном пептиде глюкагона, и все еще сохранять активность в отношении рецептора глюкагона. В некоторых вариантах осуществления остаток метионина, содержащийся в положении 27 нативного пептида, заменяют лейцином или норлейцином для предотвращения окислительной деградации пептида. В другом варианте осуществления аминокислоту в положении 20 заменяют Lys, Arg, Orn или цитруллином, и/или положение 21 замещают Glu, гомоглутаминовой кислотой или гомоцистеиновой кислотой.

Некоторые варианты осуществления относятся к аналогу глюкагона SEQ ID NO: 108, где от 1 до 6 аминокислот, выбранных из положений 1, 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 27, 28 или 29 аналога, отличаются от соответствующей аминокислоты SEQ ID NO: 701 при условии, что, когда аминокислота в положении 16 представляет собой серин, положение 20 представляет собой Lys, или альтернативно, когда положение 16 представляет собой серин, положение 24 представляет собой Glu, и положение 20 или положение 28 представляет собой Lys. Другой вариант осуществления относится к аналогу глюкагона SEQ ID NO: 108, где от 1 до 3 аминокислот, выбранных из положений 1, 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 20, 21, 27, 28 или 29 аналога, отличаются от соответствующей аминокислоты SEQ ID NO: 701. Другой вариант осуществления относится к аналогу глюкагона SEQ ID NO: 96, SEQ ID NO: 97 или SEQ ID NO: 99, где от 1 до 2 аминокислот, выбранных из положений 1, 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 20 или 21 аналога, отличаются от соответствующей аминокислоты SEQ ID NO: 701, и в дополнительном варианте осуществления от одной до двух различных аминокислот приставляют собой консервативные аминокислотные замены относительно аминокислоты, содержащейся в нативной последовательности глюкагона (SEQ ID NO: 701). Некоторые варианты осуществления относятся к пептиду глюкагона SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 или SEQ ID NO: 103, где пептид глюкагона дополнительно содержит одну, две или три замены аминокислот в положениях, выбранных из положений 2, 5, 7, 10, 11, 13, 14, 17, 18, 19, 20, 21, 27 или 29. В некоторых вариантах осуществления замены в положениях 2, 5, 7, 10, 11, 13, 14, 16, 17, 18, 19, 20, 21, 27 или 29 представляют собой консервативные замены аминокислот.

Некоторые варианты осуществления относятся к коагонисту рецептора глюкагона/GLP-1, содержащему вариант последовательности SEQ ID NO 81, где от 1 до 10 аминокислот, выбранных из положений 16, 17, 18, 20, 21, 23, 24, 27, 28 и 29, соответственно, варианта отличаются от соответствующей аминокислоты SEQ ID NO: 701. Некоторые варианты осуществления относятся к варианту последовательности SEQ ID NO 81, где вариант отличается от SEQ ID NO: 81 одной или более заменами аминокислот, выбранными из группы, состоящей из Gln17, Ala18, Glu21, Ile23, Ala24, Val27 и Gly29. Некоторые варианты осуществления относятся к коагонисту рецептора глюкагона/GLP-1, содержащему варианты последовательности SEQ ID NO 81, где от 1 до 2 аминокислот, выбранных из положений 17-26 варианта, отличаются от соответствующей аминокислоты SEQ ID NO: 701. Некоторые варианты осуществления относятся к варианту последовательности SEQ ID NO 81, где вариант отличается от SEQ ID NO: 81 заменой аминокислоты выбранной из группы, состоящей из Gln17, Ala18, Glu21, Ile23 и Ala24. Некоторые варианты осуществления относятся к варианту последовательности SEQ ID NO 81, где вариант отличается от SEQ ID NO: 81 заменой аминокислоты в положении 18, где замещенная аминокислота выбрана из группы, состоящей из Ala, Ser, Thr и Gly. Некоторые варианты осуществления относятся к варианту последовательности SEQ ID NO 81, где вариант отличается от SEQ ID NO: 81 заменой аминокислоты Ala в положении 18. Такие варианты включены в SEQ ID NO: 72. Другой вариант осуществления относится к коагонисту рецептора глюкагона/GLP-1, содержащему варианты последовательности SEQ ID NO 81, где от 1 до 2 аминокислот, выбранных из положений 17-22 варианта, отличаются от соответствующей аминокислоты SEQ ID NO: 701, и дополнительный вариант осуществления относится к варианту SEQ ID NO 81, где вариант отличается от SEQ ID NO: 81 1 или 2 заменами аминокислот в положениях 20 и 21.

Некоторые варианты осуществления относятся к коагонисту рецептора глюкагона/GLP-1, содержащему последовательность:

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Xaa-Xaa-Arg-Arg-Ala-Xaa-Xaa-Phe-Val-Xaa-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 123), где Xaa в положении 15 представляет собой Asp, Glu, цистеиновую кислоту, гомоглутаминовую кислоту или гомоцистеиновую кислоту, Xaa в положении 16 представляет собой Ser, Glu, Gln, гомоглутаминовую кислоту или гомоцистеиновую кислоту, Xaa в положении 20 представляет собой Gln, Lys, Arg, Orn или цитруллин, Xaa в положении 21 представляет собой Asp, Glu, гомоглутаминовую кислоту или гомоцистеиновую кислоту, Xaa в положении 24 представляет собой Gln или Glu, Xaa в положении 28 представляет собой Asn, Lys или кислую аминокислоту, Xaa в положении 29 представляет собой Thr или кислую аминокислоту, и R представляет собой COOH или CONH2. В некоторых вариантах осуществления R представляет собой CONH2. Некоторые варианты осуществления относятся к коагонисту рецептора глюкагона/GLP-1, содержащему вариант SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 114, SEQ ID NO: 115 или SEQ ID NO: 116, где вариант отличается от указанной последовательности заменой аминокислоты в положении 20. В некоторых вариантах осуществления замена аминокислоты выбрана из группы, состоящей из Lys, Arg, Orn или цитруллина для положения 20.

Некоторые варианты осуществления относятся к агонисту глюкагона, содержащему аналог пептида SEQ ID NO: 82, где аналог отличается от SEQ ID NO: 82 содержанием аминокислоты, отличной от серина в положении 2. В некоторых вариантах осуществления остаток серина замещают аминоизомасляной кислотой, D-аланином, и в некоторых вариантах осуществления остаток серина замещают аминоизомасляной кислотой. Такие модификации подавляют расщепление дипептидилпептидазой IV при сохранении природной активности исходного соединения (например, по меньшей мере 75, 80, 85, 90, 95% или более активности исходного соединения). В некоторых вариантах осуществления повышают растворимость аналога, например, введением одной, двух, трех или более заряженных аминокислот в C-концевой участок нативного глюкагона, предпочтительно в положение от C-конца до положения 27. В иллюстративных вариантах осуществления одна, две, три или все заряженные аминокислоты являются отрицательно заряженными. В другом варианте осуществления аналог дополнительно содержит кислую аминокислоту, замещающую нативную аминокислоту в положении 28 или 29, или кислую аминокислоту, добавляемую к C-концу пептида SEQ ID NO: 82.

В некоторых вариантах осуществления аналоги глюкагона, описываемые в настоящем описании, дополнительно модифицируют по положению 1 или 2 для снижения чувствительности к расщеплению дипептидилпептидазой IV. Некоторые варианты осуществления относятся к аналогу глюкагона SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 или SEQ ID NO: 103, где аналог отличается от исходной молекулы заменой в положении 2 и обладает сниженной чувствительностью (т.е. обладает устойчивостью) к расщеплению дипептидилпептидазой IV. Более конкретно, в некоторых вариантах осуществления положение 2 аналога пептид замещают аминокислотой, выбранной из группы, состоящей из D-серина, D-аланина, валина, амино-н-масляной кислоты, глицина, N-метилсерина и аминоизомасляной кислоты. В некоторых вариантах осуществления положение 2 аналога пептида замещают аминокислотой, выбранной из группы, состоящей из D-серина, D-аланина, глицина, N-метилсерина и аминоизомасляной кислоты. В другом варианте осуществления положение 2 аналога пептид замещают аминокислотой, выбранной из группы, состоящей из D-серина, глицина, N-метилсерина и аминоизомасляной кислоты. В некоторых вариантах осуществления аминокислота в положении 2 не является D-серином. В некоторых вариантах осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 127 или SEQ ID NO: 128.

Некоторые варианты осуществления относятся к аналогу глюкагона SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102 или SEQ ID NO: 103, где аналог отличается от исходной молекулы заменой в положении 1 и обладает сниженной чувствительностью (т.е. обладает устойчивостью) к расщеплению дипептидилпептидазой IV. Более конкретно, положение 1 аналога пептид замещают аминокислотой, выбранной из группы, состоящей из D-гистидина, альфа,альфа-диметилимидазолуксусной кислоты (DMIA), N-метилгистидина, альфа-метилгистидина, имидазолуксусной кислоты, дезаминогистидина, гидроксилгистидина, ацетилгистидина и гомогистидина. Другой вариант осуществления относится к агонисту глюкагона, содержащему пептид аналога SEQ ID NO: 82, где аналог отличается от SEQ ID NO: 82 содержанием аминокислоты, отличной от гистидина в положении 1. В некоторых вариантах осуществления повышают растворимость аналога, например, введением одной, двух, трех или более заряженных аминокислот в C-концевой участок нативного глюкагона, предпочтительно в положение от C-конца до положения 27. В иллюстративных вариантах осуществления одна, две, три или все заряженные аминокислоты являются отрицательно заряженными. В другом варианте осуществления аналог дополнительно содержит кислую аминокислоту, замещенную нативной аминокислотой в положении 28 или 29, или кислую аминокислоту, добавляемую к C-концу пептида SEQ ID NO: 82. В некоторых вариантах осуществления кислая аминокислота представляет собой аспарагиновую кислоту или глутаминовую кислоту.

В некоторых вариантах осуществления коагонист рецептора глюкагона/GLP-1 содержит последовательность SEQ ID NO: 108, дополнительно содержащую дополнительное карбокси-концевое удлинение одной аминокислоты или пептид, выбранный из группы, состоящей из SEQ ID NO: 78, SEQ ID NO: 117 и SEQ ID NO: 118. В одном из вариантов осуществления, где одну аминокислоту добавляют к C-концу SEQ ID NO: 108, аминокислоту, как правило, выбирают из одной из 20 природных аминокислот, и в некоторых вариантах осуществления дополнительная C-концевая аминокислота содержит амидную группу вместо карбоновой кислоты нативной аминокислоты. В некоторых вариантах осуществления дополнительная аминокислота выбрана из группы, состоящей из глутаминовой кислоты, аспарагиновой кислоты и глицина.

Альтернативный вариант осуществления относится к коагонисту рецептора глюкагона/GLP-1, где пептид содержит по меньшей мере одно лактамовое кольцо, образуемое между боковой цепью остатка глутаминовой кислоты и остатка лизина, где остаток глутаминовой кислоты и остаток лизина разделяют три аминокислоты. В некоторых вариантах осуществления карбокси-концевая аминокислота лактама несущего пептида глюкагона содержит амидную группу вместо карбоновой кислоты нативной аминокислоты. Более конкретно, некоторые варианты осуществления относятся к коагонисту глюкагона и GLP-1, содержащему модифицированный пептид глюкагона, выбранный из группы, состоящей из:

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 66)

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Lys-Asp-Phe-Val-Gln-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 109)

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Lys-Asp-Phe-Val-Glu-Trp-Leu-Met-Xaa-Xaa-R (SEQ ID NO: 111)

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Glu-Trp-Leu-Met-Lys-Xaa-R (SEQ ID NO: 112)

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Lys-Asp-Phe-Val-Glu-Trp-Leu-Met-Asn-Thr-R (SEQ ID NO: 104)

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Gln-Asp-Phe-Val-Glu-Trp-Leu-Met-Lys-Thr-R (SEQ ID NO: 105)

NH2-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Lys-Asp-Phe-Val-Glu-Trp-Leu-Met-Lys-Thr-R (SEQ ID NO: 106),

где Xaa в положении 28=Asp или Asn, Xaa в положении 29 представляет собой Thr или Gly, R выбран из группы, состоящей из COOH, CONH2, глутаминовой кислоты, аспарагиновой кислоты, глицина, SEQ ID NO: 78, SEQ ID NO: 117 и SEQ ID NO: 118, и лактамовый мостик образуется между Lys в положении 12 и Glu в положении 16 для SEQ ID NO: 109, между Glu в положении 16 и Lys в положении 20 для SEQ ID NO: 110, между Lys в положении 20 и Glu в положении 24 для SEQ ID NO: 111, между Glu в положении 24 и Lys в положении 28 для SEQ ID NO: 112, между Lys в положении 12 и Glu в положении 16 и между Lys в положении 20 и Glu в положении 24 для SEQ ID NO: 104, между Lys в положении 12 и Glu в положении 16 и между Glu в положении 24 и Lys в положении 28 для SEQ ID NO: 105, и между Glu в положении 16 и Lys в положении 20 и между Glu в положении 24 и Lys в положении 28 для SEQ ID NO: 106. В некоторых вариантах осуществления R выбран из группы, состоящей из COOH, CONH2, глутаминовой кислоты, аспарагиновой кислоты, глицина, аминокислота в положении 28 представляет собой Asn, и аминокислота в положении 29 представляет собой треонин. В некоторых вариантах осуществления R представляет собой CONH2, аминокислота в положении 28 представляет собой Asn, и аминокислота в положении 29 представляет собой треонин. В другом варианте осуществления R выбран из группы, состоящей из SEQ ID NO: 78, SEQ ID NO: 79 и SEQ ID NO: 80, и аминокислота в положении 29 представляет собой глицин.

В дополнительном варианте осуществления коагонист рецептора глюкагона/GLP-1 выбран из группы, состоящей из SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105 и SEQ ID NO: 106, где пептид дополнительно содержит дополнительное карбокси-концевое удлинение из одной аминокислоты или пептид, выбранный из группы, состоящей из SEQ ID NO: 78, SEQ ID NO: 117 и SEQ ID NO: 118. В некоторых вариантах осуществления концевое удлинение содержит последовательность SEQ ID NO: 78, SEQ ID NO: 79 или SEQ ID NO: 80, и родственный глюкагону пептид содержит последовательность SEQ ID NO: 72. В некоторых вариантах осуществления коагонист рецептора глюкагона/GLP-1 содержит последовательность SEQ ID NO: 81, где аминокислота в положении 16 представляет собой глутаминовую кислоту, аминокислота в положении 20 представляет собой лизин, аминокислота в положении 28 представляет собой аспарагин, и аминокислотная последовательность SEQ ID No: 78 или SEQ ID NO: 79 является связанной с C-концом SEQ ID NO: 81.

В одном из вариантов осуществления, где одну аминокислота добавляют к C-концу SEQ ID NO: 108, аминокислоту, как правило, выбирают из одной из 20 природных аминокислот, и в некоторых вариантах осуществления аминокислота содержит амидную группу вместо карбоновой кислоты нативной аминокислоты. В некоторых вариантах осуществления дополнительная аминокислота выбрана из группы, состоящей из глутаминовой кислоты и аспарагиновой кислоты, и глицина. В вариантах осуществления, где аналог агониста глюкагона дополнительно содержит карбокси-концевое удлинение, карбокси-концевая аминокислота удлинения в некоторых вариантах осуществления оканчивается амидной группой или сложноэфирной группой, а не карбоновой кислотой.

В другом варианте осуществления коагонист рецептора глюкагона/GLP-1 содержит последовательность: NPE-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Xaa-CONH2 (SEQ ID NO: 107), где Xaa в положении 30 представляет собой любую аминокислоту. В некоторых вариантах осуществления Xaa выбран из одной из 20 природных аминокислот, и в некоторых вариантах осуществления аминокислота представляет собой глутаминовую кислоту, аспарагиновую кислоту или глицин. Растворимость такого пептида можно дополнительно увеличивать ковалентным связыванием цепи PEG с боковой цепью аминокислоты в положении 17, 21, 24 или 30 SEQ ID NO: 107. В дополнительном варианте осуществления пептид содержит дополнительное карбокси-концевое удлинение пептида, выбранного из группы, состоящей из SEQ ID NO: 78, SEQ ID NO: 117 и SEQ ID NO: 118. В соответствии с некоторыми вариантами осуществления коагонист рецептора глюкагона/GLP-1 содержит последовательность SEQ ID NO: 129, SEQ ID NO: 130 и SEQ ID NO: 131.

Можно проводить дополнительные сайт-специфические модификации внутри последовательности глюкагона SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 107 и SEQ ID NO: 121 с получением набора агонистов глюкагона, которые обладают различной степенью агонизма к GLP-1. Таким образом, получали и характеризовали пептиды, которые обладают фактически идентичной активностью in vitro в отношении каждого из рецепторов. Аналогично, идентифицировали и характеризовали пептиды с активностью, повышенной селективно в десть раз, в отношении каждого из двух рецепторов. Как указано выше, замена остатка серина в положении 16 глутаминовой кислотой повышает активность нативного глюкагона в отношении рецепторов глюкагона и GLP-1, но сохраняет приблизительно в десять раз большую селективность к рецептору глюкагона. Кроме того, заменой нативного глутамина в положении 3 глутаминовой кислотой (SEQ ID NO: 128) получают аналог глюкагона, который обладает приблизительно в десять раз большей селективностью к рецептору GLP-1.

Растворимость пептидов коагонистов глюкагона/GLP-1 можно дополнительно увеличивать в водных растворах при физиологическом pH при сохранении высокой биологической активности относительно нативного глюкагона путем введения гидрофильных групп в положениях 16, 17, 21 и 24 пептида или добавлением одной модифицированной аминокислоты (т.е. аминокислоты, модифицированной, чтобы содержать гидрофильную группу) к C-концу пептида коагонист глюкагона/GLP-1. В соответствии с некоторыми вариантами осуществления гидрофильная группа содержит полиэтиленовую (PEG) цепь. Более конкретно, в некоторых вариантах осуществления пептид глюкагона содержит последовательность SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105 или SEQ ID NO: 106, где цепь PEG ковалентно связана с боковой цепью аминокислот в положении 16, 17, 21, 24, 29 или C-концевой аминокислотой пептида глюкагона, при условии, что, когда пептид содержит SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100 или SEQ ID NO: 101, цепь полиэтиленгликоля ковалентно связана с аминокислотным остатком в положении 17, 21 или 24, где пептид содержит SEQ ID NO: 102 или SEQ ID NO: 103, цепь полиэтиленгликоля ковалентно связана с аминокислотным остатком в положении 16, 17 или 21, и когда пептид содержит SEQ ID NO: 104, SEQ ID NO: 105 или SEQ ID NO: 106, цепь полиэтиленгликоля ковалентно связана с аминокислотным остатком в положении 17 или 21.

В некоторых вариантах осуществления глюкагон пептид содержит последовательность SEQ ID NO: 99, SEQ ID NO: 100 или SEQ ID NO: 101, где цепь PEG ковалентно связана с боковой цепью аминокислот в положении 17, 21, 24 или C-концевой аминокислотой пептида глюкагона, и карбокси-концевая аминокислота пептида содержит амидную группу вместо группы карбоновой кислоты нативной аминокислоты. В некоторых вариантах осуществления коагонист рецептора глюкагона/GLP-1 пептид содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 и SEQ ID NO: 107, где цепь PEG ковалентно связана с боковой цепью аминокислоты в положении 17, 21 или 24 SEQ ID NO: 100, SEQ ID NO: 101 и SEQ ID NO: 107 или в положении 16, 17 или 21 SEQ ID NO: 102 и SEQ ID NO: 103, или в положении 17 или 21 SEQ ID NO: 104, SEQ ID NO: 105 и SEQ ID NO: 106 пептида глюкагона. В другом варианте осуществления пептид коагониста рецептора глюкагона/GLP-1 содержит последовательность SEQ ID NO: 99 или SEQ ID NO: 107, где цепь PEG ковалентно связана с боковой цепью аминокислот в положении 17, 21 или 24 или C-концевой аминокислотой пептида глюкагона.

В некоторых вариантах осуществления пептид глюкагона, выбранные из группы, состоящей из SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106 и SEQ ID NO: 107, дополнительно модифицируют, чтобы он содержал цепь PEG, ковалентно связанную с боковой цепью аминокислоты в положении 17 или 21 пептида глюкагона. В некоторых вариантах осуществления пегилированный коагонист рецептора глюкагона/GLP-1 дополнительно содержит последовательность SEQ ID NO: 78, SEQ ID NO: 117 или SEQ ID NO: 79.

В другом варианте осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 72 или SEQ ID NO: 120, дополнительно содержащую C-концевое удлинение SEQ ID NO: 78, SEQ ID NO: 79 или SEQ ID NO: 80, связанной с C-концевой аминокислотой SEQ ID NO: 72 или SEQ ID NO: 120, и необязательно дополнительно содержащую цепь PEG, ковалентно связанную с боковой цепью аминокислот в положении 17, 18, 21, 24 или 29 или C-концевой аминокислотой пептида. В другом варианте осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 72 или SEQ ID NO: 120, где цепь PEG ковалентно связана с боковой цепью аминокислот в положении 21 или 24 родственного глюкагону пептида, и пептид дополнительно содержит C-концевое удлинение SEQ ID NO: 78, или SEQ ID NO: 79.

В другом варианте осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 72 или SEQ ID NO: 81, или SEQ ID NO: 82, где дополнительную аминокислоту добавляют к C-концу SEQ ID NO: 81 или SEQ ID NO: 82, и цепь PEG ковалентно связана с боковой цепью добавляемой аминокислоты. В дополнительном варианте осуществления пегилированный аналог глюкагона дополнительно содержит C-концевое удлинение SEQ ID NO: 78 или SEQ ID NO: 79, связанной с C-концевой аминокислотой SEQ ID NO: 81 или SEQ ID NO: 82. В другом варианте осуществления родственный глюкагону пептид содержит последовательность SEQ ID NO: 107, где цепь PEG ковалентно связана с боковой цепью аминокислоты в положении 30 родственного глюкагону пептида, и пептид дополнительно содержит C-концевое удлинение SEQ ID NO: 78 или SEQ ID NO: 79, связанное с C-концевой аминокислотой SEQ ID NO: 107.

Цепь полиэтиленгликоля может находиться в форме неразветвленной цепи, или она может быть разветвленной. В соответствии с некоторыми вариантами осуществления цепь полиэтиленгликоля имеет, среднюю молекулярную массу, выбранную из диапазона приблизительно от 500 приблизительно до 10000 Дальтон. В некоторых вариантах осуществления цепь полиэтиленгликоля имеет среднюю молекулярную массу, выбранную из диапазона приблизительно от 1000 приблизительно до 5000 Дальтон. В альтернативном варианте осуществления цепь полиэтиленгликоля имеет среднюю молекулярную массу, выбранную из диапазона приблизительно 10000 приблизительно до 20000 Дальтон. В соответствии с некоторыми вариантами осуществления пегилированный родственный глюкагону пептид содержит две или более цепей полиэтиленгликоля ковалентно связанных с родственным глюкагону пептидом, где общая молекулярная масса цепей глюкагона составляет приблизительно от 1000 приблизительно до 5000 Дальтон. В некоторых вариантах осуществления пегилированный агонист глюкагона содержит пептид, состоящий из SEQ ID NO: 93 или аналога агониста глюкагона SEQ ID NO: 93, где цепь PEG ковалентно связана с аминокислотным остатком в положении 21 и в положении 24, и где суммарная молекулярная масса двух цепей PEG составляет приблизительно от 1000 приблизительно до 5000 Дальтон.

В определенных иллюстративных вариантах осуществления пептид глюкагона содержит аминокислотную последовательность SEQ ID NO: 701, содержащую до десяти модификаций аминокислот, и содержит аминокислоту в положении 10, которая является ацилированной или алкилированной. В некоторых вариантах осуществления аминокислота в положении 10 является ацилированной или алкилированной C4-C30жирной кислотой. В определенных аспектах аминокислота в положении 10 содержит ацильную группу или алкильную группу, которая не является нативной для природной аминокислоты.

В определенных вариантах осуществления пептид глюкагона, содержащий аминокислоту в положении 10, которая является ацилированной или алкилированной, содержит стабилизированную альфа-спираль. Таким образом, в определенных аспектах пептид глюкагона содержит ацильную или алкильную группу, как описано в настоящем описании, и внутримолекулярный мостик, например, ковалентный внутримолекулярный мостик (например, лактамовый мостик) между боковыми цепями аминокислоты в положении i и аминокислоты в положении i+4, где i равно 12, 16, 20 или 24. Альтернативно или дополнительно, пептид глюкагона содержит, ацильную или алкильную группу, как описано в настоящем описании, и одно, два, три, четыре или более положений 16, 20, 21 и/или 24 пептида глюкагона являются замещенными α,α-двузамещенной аминокислотой, например, AIB. В некоторых случаях, ненативный пептид глюкагона содержит Glu в положении 16 и Lys в положении 20, где необязательно лактамовый мостик связывает Glu и Lys, и необязательно пептид глюкагона дополнительно содержит одну или более модификаций, выбранных из группы, состоящей из: Gln в положении 17, Ala в положении 18, Glu в положении 21, Ile в положении 23 и Ala в положении 24.

Также в любом из вариантов осуществления, где родственный глюкагону пептид содержит аминокислоту в положении 10, которая является ацилированной или алкилированной, родственный глюкагону пептид может дополнительно содержать C-концевой амид вместо C-концевого альфа-карбоксилата.

В некоторых вариантах осуществления родственный глюкагону пептид, содержащий ацильную или алкильную группу, как описано в настоящем описании, дополнительно содержит замену аминокислоты в положении 1, в положении 2 или в положениях 1 и 2, где заменой(ами) аминокислот получают устойчивость к протеазе DPP-IV. В некоторых конкретных вариантах осуществления родственный глюкагону пептид представляет собой пептид, который содержит SEQ ID NO: 72 с ацилированной или алкилированной аминокислотой в положении 10, как описано в настоящем описании. Ацильная или алкильная группа этих вариантов осуществления может представлять собой любую ацильную или алкильную группу, описываемую в настоящем описании. Например, ацильная группа может представлять собой ацильную группа C4-C30жирной кислоты (например, C8-C24), и алкильная группа может представлять собой C4-C30алкильную группу (например, C8-C24).

Аминокислота, к которой присоединяют ацильную или алкильную группу, может представлять собой любую из аминокислот, описываемых в настоящем описании, например, аминокислоту любой из формулы I (например, Lys), формулы II и формулы III.

В некоторых вариантах осуществления ацильная группа или алкильная группа непосредственно присоединяют к аминокислоте в положении 10. В некоторых вариантах осуществления ацильная или алкильная группа присоединяют к аминокислоте в положении 10 через спейсер, такой как, например, спейсер, длина которого составляет от 3 до 10 атомов, например, аминокислота или дипептид. Подходящие спейсеры для целей присоединения ацильной или алкильной группы описаны в настоящем описании.

В определенных аспектах аналоги глюкагона содержат по меньшей мере одну модификацию аминокислоты и до 15 модификаций аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 модификаций аминокислот) или до 10 модификаций аминокислот. В определенных вариантах осуществления аналоги, содержащие по меньшей мере одну модификацию аминокислоты и до 10 модификаций аминокислот, представляют собой консервативные модификации аминокислот. Консервативные модификации аминокислот описаны в настоящем описании.

Таким образом, в некоторых аспектах аналог глюкагона содержит аминокислотную последовательность SEQ ID NO: 701 с одним или более из: Gln в положении 17, Ala в положении 18, Glu в положении 21, Ile в положении 23 и Ala или Cys в положении 24, или их консервативными аминокислотными заменами. В некоторых аспектах аналог содержит C-концевой амид вместо C-концевого альфа-карбоксилата. В определенных вариантах осуществления аналог содержит замену аминокислоты в положении 1, положении 2 или положениях 1 и 2, где заменой(ами) получают устойчивость к протеазе DPP-IV. Подходящие замены аминокислот описаны в настоящем описании. Например, DMIA в положении 1 и/или d-Ser или AIB в положении 2. В некоторых вариантах осуществления аминокислота в положении 2 не является D-серином.

Дополнительно или альтернативно, аналог может содержать одну или комбинаций: (a) Ser в положении 2, замещенного Ala; (b) Gln в положении 3, замещенного Glu или аналогом глутамина; (c) Thr в положении 7, замещенного Ile; (d) Tyr в положении 10, замещенного Trp или аминокислотой, содержащей ацильную или алкильную группу, которая не является нативной для природной аминокислоты; (e) Lys в положении 12, замещенного Ile; (f) Asp в положении 15, замещенного Glu; (g) Ser в положении 16, замещенного Glu; (h) Gln в положении 20, замещенного Ser, Thr, Ala, AIB; (i) Gln в положении 24, замещенного Ser, Thr, Ala, AIB; (j) Met в положении 27, замещенного Leu или Nle; (k) Asn в положении 29, замещенного заряженной аминокислотой, необязательно, Asp или Glu, и (l) Thr в положении 29, замещенного Gly или заряженной аминокислотой, необязательно, Asp или Glu. В определенных аспектах аналог содержит аминокислотную последовательность любой из SEQ ID NO: 657-669.

Касательно аналогов, которые обладают активностью агониста в отношении рецептора GIP, аналог содержит удлинение 1-21 аминокислот (например, 5-19, 7-15, 9-12 аминокислот). Удлинение аналога может содержать любую аминокислотную последовательность при условии, что удлинение составляет от 1 до 21 аминокислоты. В некоторых аспектах удлинение составляет от 7 до 15 аминокислот, и в других аспектах удлинение составляет от 9 до 12 аминокислот. В некоторых вариантах осуществления удлинение содержит (i) аминокислотную последовательность SEQ ID NO: 78 или 674, (ii) аминокислотную последовательность, которая обладает высокой идентичностью последовательности (например, по меньшей мере 80%, 85%, 90%, 95%, 98%, 99%) с аминокислотной последовательностью SEQ ID NO: 78 или 674, или (iii) аминокислотную последовательность (i) или (ii) с одной или более консервативных модификаций аминокислот.

В некоторых вариантах осуществления по меньшей мере одна из аминокислот удлинения является ацилированной или алкилированной. Аминокислота, содержащая ацильную или алкильную группу, может находиться в любом положении удлинения аналога. В определенных вариантах осуществления ацилированная или алкилированная аминокислота удлинения находится в одном из положений 37, 38, 39, 40, 41 или 42 (в соответствии с нумерацией SEQ ID NO: 701) аналога. В определенных вариантах осуществления ацилированная или алкилированная аминокислота находится в положении 40 аналога.

В иллюстративных вариантах осуществления ацильная или алкильная группа представляет собой ацильную или алкильную группу, которая не является нативной для природной аминокислоты. Например, ацильная или алкильная группа может представлять собой ацильную группу C4-C30жирной кислоты (например, C12-C18) или C4-C30алкил (например, C12-C18). Ацильная или алкильная группа может представлять собой любую из таких групп, описываемых в настоящее описание.

В некоторых вариантах осуществления ацильную или алкильную группу присоединяют непосредственно к аминокислоте, например, через боковую цепь аминокислоты. В других вариантах осуществления ацильную или алкильную группу присоединяют к аминокислоте через спейсер (например, аминокислотный, дипептидный, трипептидный, гидрофильный бифункциональный спейсер, гидрофобный бифункциональный спейсер). В определенных аспектах длина спейсер составляет от 3 до 10 атомов. В некоторых вариантах осуществления аминокислотный спейсер не является γ-Glu. В некоторых вариантах осуществления дипептидный спейсер не является γ-Glu-γ-Glu.

Также в иллюстративных вариантах осуществления аминокислота, к которой присоединяют ацильную или алкильную группу, может представлять собой любую из описываемых в настоящем описании, включая, например, аминокислоту формулы I, II или III. Аминокислота, которая является ацилированной или алкилированной, может представлять собой, например, Lys. Подходящие аминокислоты, содержащие ацильную или алкильную группу, а также подходящие ацильные группы и алкильные группы описаны в настоящем описании. См., например, указания в разделах, озаглавленных "Ацилирование и алкилирование".

В других вариантах осуществления 1-6 аминокислот (например, 1-2, 1-3, 1-4, 1-5 аминокислот) удлинения представляют собой положительно заряженные аминокислоты, например, аминокислоты формулы IV, такие как, например, Lys. В настоящем описании, термин "положительно заряженная аминокислота" относится к любой аминокислоте, природной или неприродной, содержащей положительный заряд на атоме своей боковой цепи при физиологическом pH. В определенных аспектах положительно заряженные аминокислоты находятся в положениях 37, 38, 39, 40, 41, 42 и 43. В конкретных вариантах осуществления положительно заряженная аминокислота находится в положении 40. В других случаях удлинение является ацилированным или алкилированнным, как описано в настоящем описании, и содержит 1-6 положительно заряженных аминокислот, как описано в настоящем описании.

В других вариантах осуществления аналоги, которые обладают активностью агониста в отношении рецептора GIP, содержат (i) SEQ ID NO: 701 по меньшей мере с одной модификацией аминокислоты, (ii) удлинение от 1 до 21 аминокислоты (например, от 5 до 18, от 7 до 15, от 9 до 12 аминокислот) от C-конца до аминокислоты в положении 29 аналога, и (iii) аминокислоту, содержащую ацильную или алкильную группу, которая не является нативной для природной аминокислоты, которая располагается вне C-концевого удлинения (например, в положениях 1-29). В некоторых вариантах осуществления аналог содержит ацилрованную или алкилированную аминокислоту в положении 10. В конкретных аспектах ацильная или алкильная группа представляет собой ацильную группу C4-C30жирной кислоты или C4-C30алкильную группу. В некоторых вариантах осуществления ацильную или алкильную группу присоединяют через спейсер, например, аминокислотный, дипептидный, трипептидный, гидрофильный бифункциональный спейсер, гидрофобный бифункциональный спейсер). В определенных аспектах аналог содержит модификацию аминокислоты, которая стабилизирует альфа-спираль, такую как солевой мостик между Glu в положении 16 и Lys в положении 20, или альфа,альфа-двузамещенную аминокислоту в любом одном, двух, трех или более положениях 16, 20, 21 и 24. В конкретных аспектах аналог дополнительно содержит модификации аминокислот, которые обеспечивают устойчивость к протеазе DPP-IV, например, DMIA в положении 1, AIB в положении 2. Аналоги, содержащие дополнительные модификации аминокислот, предусматриваются в настоящее изобретении. В одном из вариантов осуществления родственный глюкагону пептид 3 класса содержит структуры любой из SEQ ID NO: 657-669.

В соответствии с некоторыми вариантами осуществления, родственный глюкагону пептид 3 класса содержит аминокислотную последовательность нативного глюкагона (SEQ ID NO: 701), содержащую следующие модификации: AIB в положении 2, Glu в положении 3, Lys в положении 10, Glu в положении 16, Gln в положении 17, Ala в положении 18, Lys в положении 20, Glu в положении 21, Ile в положении 23, Ala в положении 24; где Lys в положении 10 является ацилированным C14- или C16жирной кислотой, и где C-концевой карбоксилат замещают амидом. В конкретном варианте осуществления такой родственный глюкагону пептид 3 класса присоединяют через его N-концевую аминокислоту к дипептиду D-Lys-саркозин.

В соответствии с некоторыми вариантами осуществления родственный глюкагону пептид 3 класса содержит, состоит по существу из или состоит из аминокислотной последовательности любой из SEQ ID NO: 514, 517-534 или 554, необязательно, содержащей до 1, 2, 3, 4 или 5 дополнительных модификаций, которые сохраняют активность агониста GLP-1 и/или агониста глюкагона. В определенных вариантах осуществления родственный глюкагону пептид 3 класса содержит аминокислоты любой из SEQ ID NO: 562-684 и 1701-1776. В некоторых вариантах осуществления родственный глюкагону пептид 3 класса содержит аминокислотные последовательности любой из SEQ ID NO: 1801-1908.

Полагают, что раскрытые конъюгаты родственный глюкагону пептид-инсулиновый пептид являются подходящими для любого использования, которое было ранее описано для инсулиновых пептидов. Таким образом, конъюгаты родственный глюкагону пептид-инсулин, описываемые в настоящем описании, можно использовать для лечения гипергликемии или лечения других метаболических заболеваний, которые обусловлены высокими уровнями глюкозы в крови. Таким образом, настоящее изобретение относится к фармацевтическим композициям, содержащим конъюгат родственный глюкагону пептид-инсулин, как описано в настоящем описании, и фармацевтически приемлемый носитель, для применения для лечения пациента, страдающего высокими уровнями глюкозы в крови. В соответствии с одним из вариантов осуществления пациент, подлежащие лечению с использованием конъюгата родственный глюкагону пептид-инсулин по настоящему изобретению, представляет собой одомашненное животное, и в другом варианте осуществления пациент, подлежащий лечению, представляет собой человека.

Один из способов лечения гипергликемии в соответствии с настоящим изобретением включает этапы введения конъюгата родственный глюкагону пептид-инсулин по настоящему изобретению пациенту с использованием любого стандартного пути введения, включая парентеральное, такое как внутривенное, интраперитонеальное, подкожное или внутримышечное, интратекальное, внутрикожное, ректальное, пероральное, назальное или путем ингаляции. В одном из вариантов осуществления композицию вводят подкожно или внутримышечно. В одном из вариантов осуществления композицию вводят парентерально и конъюгат родственный глюкагону пептид-инсулин предварительно упаковывают в шприц.

Родственный глюкагону пептид-инсулин конъюгат, описываемый в настоящем описании, можно вводить отдельно или в комбинации с другими противодиабетическими средствами. Противодиабетические средства, известные в данной области или проходящие испытания, включают нативный инсулин, нативный глюкагон и его функциональные аналоги, сульфонилкарбамиды, такие как толбутамид (ориназ), ацетогексамид (димерол), толазамид (толиназ), хлорпропамид (диабинез), глипизид (глюкотрол), глибурид (диабета, микроназ, глиназ), глимепирид (амарил) или гликлазид (диамикрон); меглитиниды, такие как репаглинид (прандин) или натеглинид (старликс); бигуаниды, такие как метформин (глюкофаж) или фенформин; тиазолидиндионы, такие как росиглитазон (авандиа), пиоглитазон (актос) или троглитазон (резулин), или другие ингибиторы PPARγ; ингибиторы альфа-глюкозидазы, которые ингибируют расщепление углевода, такие как миглитол (глисет), акарбоз (прекоз/глюкобай); экзенатид (баета) или прамлинтид; ингибиторы дипептидилпептидазы-4 (DPP-4), такие как вилдаглиптин или ситаглиптин; ингибиторы SGLT (натрий-зависимого транспортера глюкозы 1) или ингибиторы ФБФазы (фруктозо-1,6-бисфосфатазы).

Фармацевтические композиции, содержащие конъюгаты родственный глюкагону пептид-инсулин, описываемые в настоящем описании, можно формулировать и вводить пациентам с использование стандартных фармацевтически приемлемых носителей и путей введения, известных специалистам в данной области. Таким образом, настоящее изобретение также предусматривает фармацевтические композиции, содержащие один или более конъюгатов родственный глюкагону пептид-инсулин, описываемых в настоящем описании, или их фармацевтически приемлемой соли в комбинации с фармацевтически приемлемым носителем. В одном из вариантов осуществления фармацевтическая композиция содержит конъюгат родственный глюкагону пептид-инсулин в концентрации 1 мг/мл при pH приблизительно от 4,0 приблизительно до 7,0 в фосфатном буфером растворе. Фармацевтические композиции могут содержать конъюгат родственный глюкагону пептид-инсулин в качестве единственного фармацевтически активного компонента, или пептид конъюгата родственный глюкагону пептид-инсулин можно комбинировать с одним или более дополнительных активных средств.

Все терапевтические способы, фармацевтические композиции, наборы и другие аналогичные варианты осуществления, описываемые в настоящем описании, предусматривают, что пептиды конъюгата родственный глюкагону пептид-инсулин включают все его фармацевтически приемлемые соли.

Один из вариантов осуществления относится к набору с устройством для введения конъюгата родственный глюкагону пептид-инсулин пациенту. Набор может дополнительно содержать различные контейнеры, например, флаконы, пробирки, бутылки и т.п. Предпочтительно наборы также содержат инструкции по применению. В соответствии с одним из вариантов осуществления устройство набора представляет собой аэрозольный дозатор, где композицию предварительно упаковывают в аэрозольное устройство. В другом варианте осуществления набор содержит шприц и иглу, и в одном из вариантов осуществления композицию конъюгата родственный глюкагону пептид-инсулин предварительно упаковывают в шприц.

Соединения по настоящему изобретению можно получать стандартными способами синтеза, технологиями рекомбинантной ДНК или любыми другими способами получения пептидов и слитых белков. Хотя определенные неприродные аминокислоты невозможно экспрессировать посредством стандартных технологий рекомбинантной ДНК, техники их получения известны в данной области. Соединения по настоящему изобретению, которые содержат непептидные участки, можно синтезировать посредством стандартных реакций органической химии, в дополнение к стандартным реакциям химии пептидов, в соответствующих случаях.

Вариант осуществления 1 относится к конъюгату агонист инсулина/инкретин, содержащему родственный глюкагону пептид и инсулиновый пептид, где родственный глюкагону пептид является непосредственно связанным или связанным через линкер с инсулиновым пептидом. В одном из вариантов осуществления 2 конъюгат варианта осуществления 1 содержит C-концевую область родственных глюкагону пептидов, ковалентно связанных с инсулиновым пептидом в положении, независимо выбранном из боковой цепи аминокислоты, и в положении, выбранном из группы, состоящей из A9, A14 и A15 A-цепи, положений B1, B2, B10, B22, B28 или B29 B-цепи, N-концевого альфа-амина B-цепи, C-конца B-цепи, и в боковой цепи аминокислоты в любом положении связывающей группы, которая связывает A-цепь и B-цепь одноцепочечного аналога инсулина. В одном из вариантов осуществления 3 вариант осуществления 1 или 2 содержит C-конец родственного глюкагону пептида, ковалентно связанный с амино-концом B-цепи инсулинового пептида. В одном из вариантов осуществления 4 конъюгат по любому из вариантов осуществления 1-3 содержит инсулиновый пептид в виде одноцепочечного аналога инсулина. В одном из вариантов осуществления 5 конъюгат по любому из вариантов осуществления 1-4 содержит одноцепочечный аналог инсулина, где родственный глюкагону пептид связан с боковой цепью аминокислоты связывающей группы, которая связывает A-цепь и B-цепь одноцепочечного аналога инсулина. В одном из вариантов осуществления 6 конъюгат по любому из вариантов осуществления 1-4 содержит двухцепочечный аналог инсулина, и указанный конъюгат содержит первый и второй родственный глюкагону пептид, где каждый родственный глюкагону пептид является независимо ковалентно связанным с инсулиновым пептидом в положении, выбранном из группы, состоящей из амино-конца B-цепи, C-конца A-цепи и C-конца B-цепи.

Вариант осуществления 7 относится к конъюгату по любому из вариантов осуществления 1-6, где родственный глюкагону пептид содержит:

(i) аминокислотную последовательность:

X1-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Z (SEQ ID NO: 839) с 1-3 модификациями аминокислот в ней, где

X1 и/или X2 является ненативной (относительно SEQ ID NO: 701) аминокислотой, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

Z выбран из группы, состоящей из Asn-Thr-COOH и Y-COOH, где Y представляет собой от 1 до 2 аминокислот, и дополнительно, где

(1) лактамовый мостик соединяет боковые цепи аминокислоты в положении i и аминокислоты в положении i+4, где i равно 12, 16, 20 или 24 или

(2) одна, две, три или все аминокислоты в положениях 16, 20, 21 и 24 родственного глюкагону пептида являются замещенными α,α-двузамещенной аминокислотой;

и указанный родственный глюкагону пептид обладает активностью агониста глюкагона;

(ii) аминокислотную последовательность SEQ ID NO: 701, модифицированную, чтобы содержать по меньшей мере одну модификацию аминокислоты, выбранную из группы, состоящей из:

замены Asn в положении 28 заряженной аминокислотой;

замены Asn в положении 28 заряженной аминокислотой, выбранной из группы, состоящей из Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замены в положении 28 Asn, Asp или Glu;

замены в положении 28 Glu;

замены Thr в положении 29 заряженной аминокислотой;

замены Thr в положении 29 заряженной аминокислотой, выбранной из группы, состоящей из Lys, Arg, His, Asp, Glu, цистеиновой кислоты и гомоцистеиновой кислоты;

замены в положении 29 Asp, Glu или Lys;

замены в положении 29 Glu;

вставки 1-3 заряженных аминокислот после положения 29;

вставки после положения 29 Glu или Lys;

вставки после положения 29 Gly-Lys или Lys-Lys, или их комбинации;

и по меньшей мере одну модификацию аминокислоты, выбранную из группы A или группы B, или их комбинации;

где группа A представляет собой модификацию аминокислоты, выбранную из группы, состоящей из замены Ser в положении 16 на Thr или AIB; и

где группа B представляет собой модификацию аминокислоты, выбранную из группы, состоящей из:

замены His в положении 1 ненативной аминокислотой, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

замены Ser в положении 2 ненативной аминокислотой, которая снижает чувствительность родственного глюкагону пептида к расщеплению дипептидилпептидазой IV (DPP-IV),

замены Tyr в положении 10 Phe или Val;

замены Lys в положении 12 Arg;

замены Gln в положении 20 Ala или AIB;

замены Asp в положении 21 Glu;

замены Gln в положении 24 Ala или AIB;

замены Met в положении 27 Leu или Nle;

или их комбинации;

и где указанный родственный глюкагону пептид обладает активностью агониста глюкагона;

(iii) родственный глюкагону пептид SEQ ID NO: 701, модифицированный, чтобы содержать:

(a) модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP,

(b) (1) лактамовый мостик между боковыми цепями аминокислоты в положениях i и i+4 или между боковыми цепями аминокислот в положениях j и j+3, где i равно 12, 13, 16, 17, 20 или 24, и где j равно 17, или

(2) одна, две, три или все аминокислоты в положениях 16, 20, 21 и 24 аналога являются замещенными α,α-двузамещенной аминокислотой,

(c) модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, и

(d) 1-6 дополнительных модификаций аминокислот,

где EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее;

(iv) последовательность SEQ ID NO: 72 или аналог SEQ ID NO: 72, где указанный аналог отличается от SEQ ID NO: 72 1-3 модификациями аминокислот, выбранными из положений 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 24, 27, 28 и 29, где указанный родственный глюкагону пептид обладает по меньшей мере 20% активности нативного GLP-1 в отношении рецептора GLP-1;

(v) аминокислоту, которая отличается от SEQ ID NO: 701 не более, чем десятью модификациями аминокислот, содержащими одну или более замен аминокислот на AIB в положениях 16, 20, 21, и/или 24, и модификацию аминокислоты в положении 1 и/или 2, которая обеспечивает пониженную чувствительность к расщеплению дипептидилпептидазой IV, где указанный родственный глюкагону пептид обладает по меньшей мере 20% активности нативного GLP-1 в отношении рецептора GLP-1;

Вариант осуществления 8 относится к конъюгату по любому из вариантов осуществления 1-7, где указанный инсулиновый пептид содержит A-цепь и B-цепь, где указанная A-цепь содержит последовательность GIVX4X5CCX8X9X10CX12LX14X15LX17X18YCX21-R13 (SEQ ID NO: 19), и указанная B-цепь содержит последовательность R22-X25LCGX29X30LVX33X34LYLVCGX41X42GFX45 (SEQ ID NO: 20), где:

X4 представляет собой глутаминовую кислоту или аспарагиновую кислоту;

X5 представляет собой глутамин или глутаминовую кислоту

X8 представляет собой гистидин, треонин или фенилаланин;

X9 представляет собой серин, аргинин, лизин, орнитин или аланин;

X10 представляет собой изолейцин или серин;

X12 представляет собой серин или аспарагиновую кислоту;

X14 представляет собой тирозин, аргинин, лизин, орнитин или аланин;

X15 представляет собой глутамин, глутаминовую кислоту, аргинин, аланин, лизин, орнитин или лейцин;

X17 представляет собой глутаминовую кислоту, аспарагиновую кислоту, аспарагин, лизин, орнитин или глутамин;

X18 представляет собой метионин, аспарагин, глутамин, аспарагиновую кислоту, глутаминовую кислоту или треонин;

X21 выбран из группы, состоящей из аланина, глицина, серина, валина, треонина, изолейцина, лейцина, глутамина, глутаминовой кислоты, аспарагина, аспарагиновой кислоты, гистидина, триптофана, тирозина и метионина;

X25 представляет собой гистидин или треонин;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислоты и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X41 выбран из группы, состоящей из глутаминовой кислоты, аспарагиновой кислоты или аспарагина;

X42 выбран из группы, состоящей из аланина, орнитина, лизина и аргинина;

X45 представляет собой тирозин или фенилаланин;

R22 выбран из группы, состоящей из AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), трипептида глицин-пролин-глутаминовая кислота, трипептида валин-аспарагин-глутамин, дипептида пролин-глутаминовая кислота, дипептида аспарагин-глутамин, глутамина, глутаминовой кислоты и N-концевого амина; и

R13 представляет собой COOH или CONH2.

Вариантов осуществления 9 относится к конъюгату по любому из вариантов осуществления 1-7, где указанная A-цепь содержит последовательность GIVEQCCX8X9ICSLYQLENYCX21-R13 (SEQ ID NO: 73), указанная B-цепь содержит последовательность R22-X25LCGX29X30LVX33X34LYLVCGX41X42GFX45 (SEQ ID NO: 20)

X8 представляет собой гистидин или треонин;

X9 представляет собой серин, лизин или аланин;

X21 представляет собой аланин, глицин или аспарагин;

X25 представляет собой гистидин или треонин;

X29 выбран из группы, состоящей из аланина, глицина и серина;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X33 выбран из группы, состоящей из аспарагиновой кислоты и глутаминовой кислоты;

X34 выбран из группы, состоящей из аланина и треонина;

X41 выбран из группы, состоящей из глутаминовой кислоты, аспарагиновой кислоты или аспарагина;

X42 выбран из группы, состоящей из аланина, орнитина, лизина и аргинина;

X45 представляет собой тирозин или фенилаланин;

R22 выбран из группы, состоящей из FVNQ (SEQ ID NO: 12), трипептида валин-аспарагин-глутамин, дипептида аспарагин-глутамин, глутамина и N-концевого амина; и

R13 представляет собой COOH или CONH2.

Вариантов осуществления 10 относится к конъюгату по любому из вариантов осуществления 1-7, где указанная A-цепь содержит последовательность GIVDECCX8X9SCDLRRLEMX19CX21-R13 (SEQ ID NO: 74), и указанная B-цепь содержит последовательность R22-X25LCGAX30LVDALYLVCGDX42GFY (SEQ ID NO: 75), где

X8 представляет собой фенилаланин или гистидин;

X9 представляет собой аргинин, орнитин или аланин;

X19 представляет собой тирозин, 4-метоксифенилаланин или 4-аминофенилаланин;

X21 представляет собой аланин или аспарагин;

X25 представляет собой гистидин или треонин;

X30 выбран из группы, состоящей из гистидина, аспарагиновой кислоты, глутаминовой кислоты, гомоцистеиновой кислоты и цистеиновой кислоты;

X42 выбран из группы, состоящей из аланина, орнитина и аргинин; и R13 представляет собой COOH или CONH2;

R22 выбран из группы, состоящей из AYRPSE (SEQ ID NO: 14), FVNQ (SEQ ID NO: 12), PGPE (SEQ ID NO: 11), трипептида глицин-пролин-глутаминовая кислота, трипептида валин-аспарагин-глутамин, дипептида пролин-глутаминовая кислота, дипептида аспарагин-глутамин, глутамина, глутаминовой кислоты и N-концевого амина; и

R13 представляет собой COOH или CONH2.

Вариант осуществления 11 относится к конъюгату по любому из вариантов осуществления 1-7, где указанная B-цепь содержит последовательность R22-X25LCGX29X30LVX33X34LYLVCGX41X42GFX45YT-Z1-B1 (SEQ ID NO: 142), где

Z1 представляет собой дипептид, выбранный из группы, состоящей из аспартата-лизина, лизина-пролина и пролина-лизина; и

B1 выбран из группы, состоящей из треонина, аланина или трипептида треонин-аргинин-аргинин.

Вариант осуществления 12 относится к конъюгату по любому из вариантов осуществления 1-7, где указанная A-цепь содержит последовательность GIVEQCCTSICSLYQLENYCN-R13 (SEQ ID NO: 1), и указанная B-цепь содержит последовательность FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 2).

Вариант осуществления 13 относится к конъюгату по любому из вариантов осуществления 1-12, где инсулиновый пептид представляет собой одноцепочечный инсулин, и пептидный линкер, соединяющий B- и A-цепи выбран из группы, состоящей из SSSSKAPPPSLPSPSRLPGPSDTPILPQR (SEQ ID NO: 52), SSSSRAPPPSLPSPSRLPGPSDTPILPQK (SEQ ID NO: 51), GAGSSSX57X58 (SEQ ID NO: 76), GYGSSSX57X58 (SEQ ID NO: 21) и GYGSSSX57X58APQT; (SEQ ID NO: 77), где

X57 и X58 независимо представляют собой аргинин, лизин или орнитин.

Вариант осуществления 14 относится к конъюгату по любому из вариантов осуществления 1-13, где пептидный линкер выбран из группы, состоящей из GYGSSSRR (SEQ ID NO: 18) и GAGSSSRR (SEQ ID NO: 22).

Вариант осуществления 15 относится к конъюгату по любому из вариантов осуществления 1-14, где родственный глюкагону пептид содержит последовательность SEQ ID NO: 72 или аналог SEQ ID NO: 72, где указанный аналог отличается от SEQ ID NO: 72 1-3 модификациями аминокислот, выбранными из положений 1, 2, 3, 5, 7, 10, 11, 13, 14, 17, 18, 19, 21, 24, 27, 28 и 29, где родственный глюкагону пептид содержит внутримолекулярный мостик между боковыми цепями аминокислот в положениях 12 и 16, 16 и 20, 20 и 24 или 24 и 28, или его фармацевтически приемлемую соль.

Вариант осуществления 16 относится к конъюгату по любому из вариантов осуществления 1-15, где родственный глюкагону пептид содержит солевой мостик или лактамовый мостик между аминокислотами в положениях 16 и 20.

Вариантов осуществления 17 относится к конъюгату по любому из вариантов осуществления 1-16, волнительно содержащему пептид, выбранный из группы, состоящей из SEQ ID NO: 78, 79 и 80, связанной с C-концом указанного родственного глюкагону пептида. Вариант осуществления 18 относится к конъюгату по любому из вариантов осуществления 1-17, где аминокислота в положении 3 родственного глюкагону пептида представляет собой глутаминовую кислоту. Вариант осуществления 19 относится к конъюгату по любому из вариантов осуществления 1-18, где аминокислота в положении 28 родственного глюкагону пептида представляет собой Asp, Asn или Lys, и аминокислота в положении 29 родственного глюкагону пептида представляет собой Gly или Thr. Вариант осуществления 20 относится к конъюгату по любому из вариантов осуществления 1-19, где аминокислота в положении 16 родственного глюкагону пептида представляет собой глутаминовую кислоту, аминокислота в положении 20 родственного глюкагону пептида представляет собой лизин, и C-концевая группа карбоновой кислоты родственного глюкагону пептида является замещенной амидом, необязательно с лактамовым мостиком между глутаминовой кислотой в положении 16 и лизином в положении 20 родственного глюкагону пептида. Вариант осуществления 21 относится к конъюгату по любому из вариантов осуществления 1-20, где аминокислоту в положении 1 или 2 родственного глюкагону пептида модифицируют так, чтобы она обладала сниженной чувствительностью к расщеплению дипептидилпептидазой IV (DPP-IV). Вариант осуществления 22 относится к конъюгату по любому из вариантов осуществления 1-21, где родственный глюкагону пептид содержит аминокислотную последовательность, выбранную из группы, состоящей из:

a. SEQ ID NO: 81;

b. SEQ ID NO: 83;

c. SEQ ID NO: 89;

d. любой из SEQ ID NO: 84-88;

e. любой из SEQ ID No: 100-103;

f. SEQ ID NO: 108, где аминокислота в положении 20 выбрана из группы, состоящей из аргинина, орнитина и цитруллина;

g. любой из SEQ ID No: 98, 99, 109-112, 104-106 и SEQ ID NO: 72, где Xaa в положении 28 пептида представляет собой аспарагин или аспарагиновую кислоту; Xaa в положении 29 пептида представляет собой треонин или глицин; и C-конец пептида дополнительно содержит SEQ ID NO: 78, SEQ ID NO: 79, COOH или CONH2; и

h. любой из SEQ ID No: 251, 319 и 510.

Вариант осуществления 23 относится к конъюгату по любому из вариантов осуществления 1-14, где родственный глюкагону пептид содержит аналог глюкагона (SEQ ID NO: 701), обладающий активностью агониста GIP, где указанный аналог содержит одну или более следующих ниже модификаций:

(a) модификацию аминокислоты в положении 1, которая обеспечивает активность агониста GIP, необязательно, где аминокислота в положении 1 представляет собой аминокислоту, не содержащую имидазольную боковую цепь;

(b) замены аминокислоты Ser в положении 16 аминокислотой формулы IV:

[Формула IV],

где n равно от 1 до 7, где каждый из R1 и R2 независимо выбраны из группы, состоящей из H, C1-C18алкила, (C1-C18алкил)OH, (C1-C18алкил)NH2, (C1-C18алкил)SH, (C0-C4алкил)(C3-C6)циклоалкила, (C0-C4алкил)(C2-C5гетероцикл), (C0-C4алкил)(C6-C10арил)R7, и (C1-C4алкил)(C3-C9гетероарил), где R7 представляет собой H или OH, и боковая цепь аминокислоты формулы IV содержит свободную аминогруппу, где аминокислота формулы IV необязательно представляет собой гомо-Lys, Lys, Orn или 2,4-диаминомасляную кислоту (Dab),

(c) одна, две, три или все аминокислоты в положениях 16, 20, 21 и 24 аналога являются замещенными α,α-двузамещенной аминокислотой,

(d) модификации аминокислот в одном, двух или всех положениях 27, 28 и 29, и

(e) 1-9 дополнительных модификаций аминокислот относительно последовательности глюкагона (SEQ ID NO: 701),

где EC50 аналога для активации рецептора GIP составляет приблизительно 10 нМ или менее.

Вариантов осуществления 24 относится к конъюгату по любому из вариантов осуществления 1-14, где родственный глюкагону пептид содержит следующие модификации: (a) аминокислота в положении 1 представляет собой большую ароматическую аминокислоту необязательно, Tyr, и (b), где (i) Met в положении 27, является замещенным большой алифатической аминокислотой необязательно Leu, (ii) Asn в положении 28, является замещенным небольшой алифатической аминокислотой необязательно Ala, или (iii) Thr в положении 29, является замещенным небольшой алифатической аминокислотой необязательно Gly, или где аналог содержит комбинацию (i), (ii) и (iii).

Вариант осуществления 25 относится к конъюгату по любому из вариантов осуществления 23 или 24, где родственный глюкагону пептид дополнительно содержит аминокислотную последовательность GPSSGAPPPS (SEQ ID NO: 95) или XGPSSGAPPPS (SEQ ID NO: 96), связанную с указанным пептидом в положении, находящемся от C-конца до аминокислоты в положении 29. Вариант осуществления 26 относится к конъюгату по любому из вариантов осуществления 1-14 и 23-25, где родственный глюкагону пептид дополнительно содержит одну или более следующих ниже модификаций:

(a) Ser в положении 2, замещенного D-Ser, Ala, D-Ala, Gly, N-метил-Ser, AIB, Val или α-амино-N-масляной кислотой;

(b) Gln в положении 3, замещенного Glu;

(c) замены аминокислоты Tyr в положении 10 аминокислотой, необязательно аминокислотой формулы I:

,

где n = от 1 до 4,

содержащей боковую цепь, ковалентно связанную с ацильной группой или алкильной группой;

(d) добавления аминокислоты, необязательно аминокислота формулы I, содержащей боковую цепь, ковалентно связанную с ацильной группой или алкильной группой, в виде C-концевой аминокислоты аналога;

(e) Lys в положении 12, замещенного Ile;

(f) Arg в положении 17, замещенного Gln;

(г) Arg в положении 18, замещенного Ala;

(h) Asp в положении 21, замещенного Glu;

(i) Gln в положении 24, замещенного Asn; и

(j) замены карбоновой кислоты C-концевой аминокислоты нейтрально заряженной группой, необязательно амидом.

Вариант осуществления 27 относится к конъюгату по любому из вариантов осуществления 1-14 и 23-25, где родственный глюкагону пептид содержит аминокислотную последовательность в соответствии с любой из SEQ ID NO: 227, 228, 229 или 230, дополнительно содержащей концевое удлинение аминокислотной последовательности GPSSGAPPPS (SEQ ID NO: 820) или XGPSSGAPPPS (SEQ ID NO: 1096), где X представляет собой любую аминокислоту от C-концевой до аминокислоты в положении 29. Вариант осуществления 28 относится к конъюгату по любому из вариантов осуществления 1-14 или 23, где родственный глюкагону пептид содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 920-964, 146-164, 166, 192-207, 209-221 и 223. Вариант осуществления 29 относится к конъюгату по любому из вариантов осуществления 1-14, где родственный глюкагону пептид содержит последовательность SEQ ID NO: 701 или модифицированную SEQ ID NO: 701, содержащую одну, две, три или более заряженных аминокислот в положении от C-конца до аминокислоты в положении 27 родственного глюкагону пептида и до 7 дополнительных модификаций аминокислот относительно SEQ ID NO: 701. Вариант осуществления 30 относится к конъюгату по любому из вариантов осуществления 1-14 или 29, где предоставлены одна, две, три или более заряженных аминокислот в положении от C-конца до аминокислоты в положении 27, где заряженные аминокислоты представляют собой Glu или Asp. Вариант осуществления 31 относится к конъюгату по любому из вариантов осуществления 1-30, где родственный глюкагону пептид содержит последовательность HAEGTFTSDVSSYLEEQAAREFIAWLVRGRG (SEQ ID NO: 700), HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 703), HAEGTFTSDVSSYLEGQAAKEFICWLVKGR (SEQ ID NO: 717) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (SEQID NO: 701) или HSQGTFTSDYSKYLDERRAQDFVQWLMNT (SEQ ID NO: 699). Вариант осуществления 29 относится к конъюгату по любому из вариантов осуществления 1-31, где инсулиновый пептид представляет собой одноцепочечный аналог инсулина, содержащий последовательность

GPEX25LCGAX30LVDALYLVCGDX42GFYFNX48X49GAGSSSRRGIVDECCX8RSCDLRRLENYCN-R13 (SEQ ID NO: 144),

FVNQHLCGSHLVEALYLVCGERGFFYTPKTGAGSSSRRGIVEQCCTSICSLYQLENYCN-R13 (SEQ ID NO: 143) или

GPEHLCGAHLVDALYLVCGDRGFYFNDRGAGSSSRRGIVDECCHRSCDLRRLENYCN (SEQ ID NO: 145), где

X8 представляет собой фенилаланин или гистидин;

X25 представляет собой гистидин или треонин;

X30 представляет собой гистидин, аспарагиновую кислоту, глутаминовую кислоту, гомоцистеиновую кислоту или цистеиновую кислоту;

X42 представляет собой аланин орнитин или аргинин;

X48 представляет собой лизин или аспарагиновую кислоту;

X49 представляет собой пролин, орнитин или аргинин; и

R13 представляет собой COOH или CONH2.

Вариант осуществления 33 относится к конъюгату по любому из вариантов осуществления 1-32, где конъюгат дополнительно модифицируют, чтобы он содержал структуру U-J, где U представляет собой аминокислоту или гидроксикислоту;

J представляет собой N-алкилированную аминокислоту, связанную с указанным конъюгатом посредством амидной связи между карбоксильной группой J и амином конъюгата, где U, J или аминокислота конъюгата, к которой присоединяют U-J, является некодируемой аминокислотой, а также где полупериод химического расщепления (t1/2) U-J из конъюгата составляет по меньшей мере приблизительно от 1 часа приблизительно до 1 недели в PBS в физиологических условиях.

Вариант осуществления 34 относится к конъюгату по любому из вариантов осуществления 33, где конъюгат дополнительно содержит гидрофильную группу, ковалентно связанную со структурой U-J, или, альтернативно, гидрофильная группа ковалентно связана с боковой цепью аминокислоты указанного конъюгата, включая гидрофильную группу, ковалентно связанную с одним или более положений, соответствующих A14, A15, B0, B1, B10, B22, B28, B29, или положений 16, 17, 20, 21, 24 или 29 нативного глюкагона (SEQ ID NO: 701), или с C-концевой областью родственного глюкагону пептида. Необязательно в любом из этих вариантов осуществления гидрофильная группа представляет собой полиэтиленгликоль.

Вариант осуществления 35 относится к конъюгату по любому из вариантов осуществления 1-32, где конъюгат дополнительно модифицируют, чтобы он содержал ацильную группу или алкильную группу, ковалентно связанную с аминокислотой боковой цепи. В дополнительном варианте осуществления указанная ацильная группа или алкильная группа ковалентно связана с положением родственного глюкагону пептида, которое соответствует положению 10 нативного глюкагона (SEQ ID NO: 701), или с одним или более положений, выбранных из A14, A15, B0, B1, B10, B22, B28, B29 инсулинового пептида, или с боковой цепью аминокислоты структуры U-J. Настоящее изобретение также относится к фармацевтической композиции, содержащей конъюгат по любому из предшествующих вариантов осуществления или его фармацевтически приемлемую соль и фармацевтически приемлемый носитель.

ПРИМЕР 1

Синтез A- и B-цепей инсулина

A- и B-цепи инсулина синтезировали на 4-метилбензгидриламиновой смоле (MBHA) или 4-гидроксиметилфенилацетамидометиловой смоле (PAM) с использованием химии защитных групп Boc. Пептиды отщепляли от смолы с использованием HF/пара-крезола 95:5 в течение 1 часа при 0°C. После удаления HF и осаждения простым эфиром пептиды растворяли в 50% водной уксусной кислоте и лиофилизировали. Альтернативно, пептиды синтезировали с использованием химии защитных групп Fmoc. Пептиды отщепляли от смолы с использованием трифторуксусной кислоты (TFA)/триизопропилсилана (TIS)/H2O (95:2,5:2,5) в течение 2 часов при комнатной температуре. Пептид осаждали добавлением избыточного количества простого диэтилового эфира и растворяли осадок в водном кислом буфере. Мониторинг качества пептидов проводили посредством обращено-фазной ВЭЖХ и подтверждали масс-спектрометрией (ESI или MALDI).

A-цепи инсулина синтезировали с одним свободным цистеином в 7 аминокислоте и всеми другими цистеинами с защитными группами как ацетамидометил A-(SH)7(Acm)6,11,20. B-цепи инсулина синтезировали с одним свободным цистеином в положении 7 и другим цистеином с защитными группами как ацетамидометил B-(SH)7(Acm)19. Неочищенные пептиды очищали общепринятой обращенно-фазной ВЭЖХ.

Синтезированные A- и B-цепи связывали друг с другом через их нативную дисульфидную связь в соответствии с общим способом, указанным на фиг. 1. Соответствующую B-цепь активировали до аналога Cys7-Npys путем растворения в DMF или DMSO и подвергали взаимодействию с 2,2'-дитиобис(5-нитропиридином) (Npys) в молярном отношении 1:1 при комнатной температуре. Мониторинг активации проводили обращено-фазной ВЭЖХ и продукт подтверждали ESI-MS.

Первая дисульфидная связь B7-A7 образовывалась при растворении соответствующих A-(SH)7(Acm)6,11,20 и B-(Npys)7(Acm)19 в молярном отношении 1:1 до общей концентрации пептида 10 мг/мл. Когда реакция объединения цепей завершалась, смесь разбавляли до концентрации 50% водной уксусной кислоты. Последние две дисульфидные связи образовывались одновременно при добавлении йода. К раствору добавляли 40-кратный молярный избыток йода и перемешивали смесь при комнатной температуре в течение дополнительного часа. Реакцию блокировали добавлением водного раствора аскорбиновой кислоты. Смесь очищали обращено-фазной ВЭЖХ и конечное соединение подтверждали MALDI-MS. Как представлено на фиг. 2 и данными в таблице 1, синтетический инсулин, получаемый этим способом, также сравнивают с очищенным инсулином в отношении связывания с инсулиновым рецептором.

Инсулиновые пептиды, содержащие модифицированную аминокислоту (такую как 4-аминофенилаланин в положении A19) также можно синтезировать in vivo с использованием системы, которая обеспечивает введение некодируемых аминокислот в белки, включая, например, систему, указанную в патентах США № 7045337 и 7083970.

Таблица 1
Активность синтезированного инсулина по сравнению с нативным инсулином
Стандарт инсулина Инсулин A7-B7
сред. зн. ст. откл. сред. зн. ст. откл.
IC50(нМ) 0,24 0,07 0,13 0,08
% активности инсулина 100 176,9

ПРИМЕР 2

Пегилирование аминогрупп (N-конца и лизина) восстановительным алкилированием

a. Синтез

Инсулин (или аналог инсулина) mPEG20k-альдегид и NaBH3CN в молярном отношении 1:2:30 растворяли в буфере на основе уксусной кислоты при pH 4,1-4,4. Реакционный раствор состоял из 0,1н. NaCl, 0,2н. уксусной кислоты и 0,1н. Na2CO3. Концентрация инсулинового пептида составляла приблизительно 0,5 мг/мл. Реакция протекала в течение шести часов при комнатной температуре. Мониторинг степени реакции проводили обращенно-фазной ВЭЖХ, и выход реакции составлял приблизительно 50%.

b. Очистка

Реакционную смесь разбавляли в 2-5 раз 0,1% TFA и наносили на колонку для препаративной обращено-фазной ВЭЖХ. Условия ВЭЖХ: колонка C4; скорость потока 10 мл/мин; буфер A: 10% ACN и 0,1% TFA в воде; буфер B: 0,1% TFA в ACN; линейный градиент A-B % 0-40% (0-80 минут); PEG-инсулин или аналоги элюировали приблизительно при 35% буфере B. Желаемые соединения подтверждали MALDI-TOF после химической модификации путем сульфитолиза или деградации трипсином.

Пегилирование аминогрупп (N-конца и лизина) ацилированием N-гидроксисукцинимидом

Инсулин (или аналог инсулина) вместе с mPEG20k-NHS растворяли в 0,1н. бицином буфере (pH 8,0) в молярном отношении 1:1. Концентрация инсулинового пептида составляла приблизительно 0,5 мг/мл. Мониторинг протекания реакции проводили посредством ВЭЖХ. Выход реакции составлял приблизительно 90% через 2 часа при комнатной температуре.

b. Очистка

Реакционную смесь разбавляли в 2-5 раз и нагружали в обращено-фазную ВЭЖХ.

Условие ВЭЖХ: колонка C4; скорость потока 10 мл/мин; буфер A 10% ACN и 0,1% TFA в воде; буфер B 0,1% TFA в ACN; линейный градиент A-B % 0-40% (0-80 минут); PEG-инсулин или аналоги собирали приблизительно при 35% B. Желаемое соединение подтверждали MALDI-TOF, после химической модификации путем сульфитолиза или деградации трипсином.

Пегилирование путем восстановительного аминирования ацетильной группы на ароматическом кольце фенилаланина

a. Синтез

Инсулин (или аналог инсулина), mPEG20k-гидразид и NaBH3CN в молярном отношении 1:2:20 растворяли в буфере на основе уксусной кислоты (pH от 4,1 до 4,4). Реакционный раствор состоял из 0,1н. NaCl, 0,2н. уксусной кислоты и 0,1н. Na2CO3. Концентрация инсулина или аналога инсулина составляла приблизительно 0,5 мг/мл при комнатной температуре в течение 24 часов. Мониторинг протекания реакции проводили посредством ВЭЖХ. Конверсия реакции составляла приблизительно 50%. (рассчитываемая посредством ВЭЖХ).

b. Очистка

Реакционную смесь разбавляли в 2-5 раз и нагружали в обращено-фазную ВЭЖХ.

Условие ВЭЖХ: колонка C4; скорость потока 10 мл/мин; буфер A 10% ACN и 0,1% TFA в воде; буфер B 0,1% TFA в ACN; линейный градиент A-B % 0-40% (0-80 минут); PEG-инсулин или PEG-аналог инсулина собирали при приблизительно 35% B. Желаемое соединение подтверждали MALDI-TOF после химической модификации путем сульфитолиза или деградации трипсином.

ПРИМЕР 3

Анализ связывания инсулинового рецептора

Аффинность каждого пептида к рецептору инсулина или IGF-1 измеряли в конкурентном анализе связывания с использованием сцинтилляционного технологии сближения. Проводили серийные 3-кратные разведения пептидов в буфере Tris-Cl (0,05 M Tris-HCl, pH 7,5, 0,15 M NaCl, 0,1% масс./об. бычий сывороточный альбумин) и смешивали в 96-луночных планшетах (Coming Inc., Acton, MA) с 0,05 нМ инсулина (3-[125I]йодтирозил) TyrA14 или IGF-1 (3-[I25I]йодтирозил) (Amersham Biosciences, Piscataway, NJ). Аликвоту 1-6 микрограмм фрагментов плазматической мембраны, получаемой из клеток, сверхэкспрессирующих рецепторы инсулина или IGF-1 человека, помещали в каждую лунку и добавляли 0,25 мг/лунку гранул обработанного полиэтиленимином агглютинин типа A зародышей пшеницы для сцинтилляционного анализа сближения (Amersham Biosciences, Piscataway, NJ). После пяти минут встряхивания при 800 об/мин планшет инкубировали в течение 12 часов при комнатной температуре и измеряли радиоактивность жидкостным сцинтилляционным счетчиком MicroBetal450 (Perkin-Elmer, Wellesley, MA). Неспецифически связанную радиоактивность (NSB) измеряли в лунках с концентрацией "холодного" нативного лиганда в 4 раза выше, чем наибольшая концентрация в тестируемых образцах. Общую связанную радиоактивность детектировали в лунках без конкурентного соединения. Процент специфического связывания рассчитывали как, указано ниже: % специфического связывания = (связывание-NSB/общее связывание-NSB)×100. Значения IC50 определяли с использованием программного обеспечения Origin (OriginLab, Northampton, MA).

ПРИМЕР 4

Анализ фосфорилирования инсулинового рецептора

Для измерения фосфорилирования рецептора инсулина или конъюгата инкретин-инсулин трансфицированные рецептором клетки HEK293 высевали в 96-луночные планшеты для культивирования тканей (Costar №3596, Cambridge, MA) и культивировали в модифицированной Дульбекко среде Игла (DMEM), дополненной 100 МЕд./мл пенициллина, 100 мкг/мл стрептомицина, 10 мМ HEPES и 0,25% сыворотки новорожденных телят (HyClone SH30541, Logan, UT) в течение 16-20 часов при 37°C, 5% CO2 и влажности 90%. Серийные разведения инсулина или аналогов инсулина получали в DMEM, дополненной 0,5% бычьего сывороточного альбумина (Roche Applied Science №100350, Indianapolis, IN) и добавляли в лунки с прикрепленными клетками. После 15 минут инкубации при 37°C в увлажненной среде с 5% CO2 клетки фиксировали 5% параформальдегидом в течение 20 минут при комнатной температуре, промывали два раза фосфатно-солевым буфером pH 7,4 и блокировали 2% бычьим сывороточным альбумином в PBS в течение 1 часа. Затем планшеты промывали три раза и наполняли конъюгированным с пероксидазой хрена антителом против фосфотирозина (Upstate biotechnology №16-105, Temecula, CA), восстанавливаемого в PBS 2% бычьим сывороточным альбумином в соответствии с рекомендациями производителя. После 3 часов инкубации при комнатной температуре планшет промывали 4 раза и в каждую лунку добавляли 0,1 мл субстрата одного раствора TMB (Invitrogen, №00-2023, Carlbad, CA). Развитие цвета останавливали через 5 минут после добавлением 0,05 мл 1н. HCl. Измеряли оптическую плотность при 450 нм на Titertek Multiscan MCC340 (ThermoFisher, Pittsburgh, PA). На график наносили оптическую плотность в зависимости от кривых доза-ответ концентрации пептида и определяли значения EC50 с использованием Origin программного обеспечения (OriginLab, Northampton, MA).

Функциональный анализ - синтез цАМФ глюкагона и GLP-1

Способность отдельного инкретина или аналогов инкретина-инсулина индуцировать цАМФ измеряли в репортерном анализе на основе люциферазы светляка. Клетки HEK293, котрансфицированные рецептором (рецептором глюкагона, рецептором GLP-1 или рецептором GIP) и геном люциферазы, связанным с чувствительным к цАМФ элементом, подвергали депривации сыворотки культивированием 16 часов в DMEM (Invitrogen, Carlsbad, CA), дополненной 0,25% сывороткой новорожденных телят (HyClone, Logan, UT), а затем инкубировали с серийными разведениями глюкагона, GLP-1, GIP или новых аналогов глюкагона в течение 5 часов при 37°C, 5% CO2 в 96-луночных планшетах, покрытых поли-D-лизином, "Biocoat" (BD Biosciences, San Jose, CA). В конце инкубации в каждую лунку добавляли 100 микролитров люминесцентного реагента-субстрата LucLite (Perkin-Elmer, Wellesley, MA). Планшет быстро встряхивали, инкубировали 10 минут в темноте и измеряли выходное оптическое излучение на жидкостном сцинтилляционном счетчике MicroBeta-1450 (Perkin-Elmer, Wellesley, MA). Эффективные 50% концентрации рассчитывали с использованием программного обеспечения Origin (OriginLab, Northampton, MA).

ПРИМЕР 5

Аналог инсулиноподобного фактора роста (IGF) IGF1 (YB16LB17)

Заявители открыли аналог IGF, для которого демонстрируют сходную активность в отношении инсулинового рецептора как для нативного инсулина. Более конкретно, аналог IGF (IGF 1 (YB16 LB17) содержит нативную A-цепь IGF (SEQ ID NO: 5) и модифицированную B-цепь (SEQ ID NO: 6), где нативные глутамин и фенилаланин в положениях 15 и 16 нативной B-цепи IGF (SEQ ID NO: 3) заменяли остатками тирозина и лейцина, соответственно. Как представлено на фиг. 4 и в таблице 2 ниже, активности связывания IGF1 (YB16 LB17) и нативный инсулин демонстрируют, что каждый является высокоэффективным агонистом инсулинового рецептора.

Таблица 2
Стандартный инсулин IGF1(YB16LB17)
сред. зн. ст. откл. сред. зн. ст. откл.
IC50(нМ) 1,32 0,19 0,51 0,18
% активности инсулина 100 262

ПРИМЕР 6

Дополнительные аналоги инсулина IGF

Дополнительные модификации пептидной последовательности IGF1 (YB16LB17) выявляют дополнительные аналоги инсулина IGF, у которых различается активность в отношении рецептора инсулина и IGF-1. В таблице 3 представлены данные связывания для каждого из этих аналогов (с использованием анализа из примера 3), где положение модификации обозначают на основании соответствующего положения в нативном инсулиновом пептиде (DPI=дезB26-30). Например, ссылка в настоящее описание на "положение B28" при отсутствии дополнительного уточнения означает соответствующее положение B27 B-цепи аналога инсулина, в котором удаляли первую аминокислоту SEQ ID NO: 2. Таким образом, общая ссылка на "B(Y16)" относится к замене остатка тирозина в положении 15 B-цепи нативной последовательности IGF-1 (SEQ ID NO: 3). Данные, касающиеся относительного связывания с рецептором инсулина и аналогов IGF, приведены в таблице 3, и данные, касающиеся стимулированного аналогом IGF фосфорилирования (с использованием анализа из примера 4), приведены в таблице 4.

ПРИМЕР 7

Биосинтез и очистка одноцепочечных аналогов инсулина

Миниген инсулин-IGF-I, содержащий нативную B- и A-цепь инсулина, связанную посредством C-цепи IGF-I (B0-C1-A0), клонировали в экспрессирующий вектор pGAPZα A (приобретаемый от In vitrogen) под промотором GAP (промотор глицеральдегид-3-фосфатдегидрогеназы (GAPDH)) для конститутивной экспрессии и очистки рекомбинантного белка в дрожжах Pichia pastoris. Миниген сливали с N-концевым пептидом, кодирующим лидерный сигнал α-фактор спаривания Saccharomyces cerevisiae, для секреции рекомбинантного белка в среду. Участок расщепления Kex2 между минигеном и лидерной последовательности α-фактора спаривания использовали для расщепления лидерной последовательности для секреции минигена с нативными амино-концами. Мутации на одном участке аланина вводили в C-пептид в положениях 1 (G1A), 2 (Y2A), 3 (G3A), 4 (S4A), 5 (S5A), 6 (S6A), 7 (R7A), 8 (R8A), 10 (P10A), 11 (Q11A) и 12 (T12A) минигена B0C1A0.

Минигены, включая B0C1A0, одиннадцать мутантов по аланину и другие отобранные производные трансформировали в дрожжи Pichia pastoris электропорацией. Отбирали положительных трансформантов на планшетах с минимальным содержанием метанола и получали геномный препарат каждого изолята Pichia и интеграцию конструкций в геном дрожжей подтверждали ПЦР. Продукт ПЦР 833 пар оснований визуализировали на агарозном геле для ДНК. Аналоги инсулина получали ферментацией соответствующей линии дрожжей. Дрожжевые клетки осаждали центрифугированием при 5 K в течение 20 минут в 500 мл центрифужных пробирках Beckman и сохраняли среду для последующей очистки белка.

Супернатанты среды для выращивания фильтровали через 0,2 мкм фильтр Millipore. Ацетонитрил (ACN) добавляли к супернатанту до конечного объема 20%. Супернатант очищали на смоле Amberlite XAD7HP от Sigma, предварительно уравновешенной 20% водным ACN. Затем смолу дважды промывали 30 мл 20% водного ACN и удаляли загрязняющие примеси 30% водным ACN, содержащим 0,1% TFA. Частично очищенные аналоги инсулина элюировали из колонки 54% водным ACN, содержащим 0,1% TFA, и лиофилизировали. Лиофилизированные образцы ресуспендировали в 0,025M NH3HCO3 pH 8 и очищали на колонке Luna C18 (размер частиц 10 мкм, размер пор 300Å). Белок элюировали из колонки с использованием линейного градиента 20-60% водного ACN. Фракции, положительные в анализе MALDI-MS, объединяли и переносили в одноразовый сцинтилляционный флакон для последующей лиофилизации. Затем лиофилизированные образцы ресуспендировали в 20% водном ACN, содержащем 0,1% TFA, и очищали на колонке Luna C18 (размер частиц 10 мкм, размер пор 300Å). Белок элюировали из колонки с использованием линейного градиента 18-54% водного ACN с 0,1% TFA. Мониторинг элюирования белка проводили при оптической плотности 280 нм. Положительные в анализе MALDI-MS фракции анализировали посредством аналитической колонки C8 для подтверждения чистоты.

Для аналога B0-C1-A0 демонстрировали активность, которая являлась в равной степени эффективной для обеих изоформ инсулинового рецептора и рецептора IGF-1. Мутация тирозина в положении 2 до аланина или укорочение C-пептида до восьми аминокислот посредством делеции C9-12 обеспечивало селективное повышение специфичности действия инсулина посредством значительного снижения активности рецептора IGF-1. Также см. данные, приведенные в таблицах 5A и 5B

Таблица 5A
Анализ связывания и фосфорилирования инсулина (B0C1A0)
Пептид Связывание инсулина Фосфорилирование инсулина
IC50, нМ n EC50, нМ n
Инсулин 0,54±0,02 4 1,67±0,13 1
IGF-1 18,81±1,77 3 29,20±8,41 1
010 (B0C1A0) 2,83±0,52 2 1,93±0,43 1
G1A 1,21±0,15 1 2,4±0,24 1
Y2A 1,95±0,28 3 1,86±0,42 1
G3A 1,41±0,05 2 2,13±0,02 1