Нейтрализующие антитела к вирусу гриппа а и пути их применения



Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
Нейтрализующие антитела к вирусу гриппа а и пути их применения
C12N2750/14143 - Микроорганизмы или ферменты; их композиции (биоциды, репелленты или аттрактанты или регуляторы роста растений, содержащие микроорганизмы, вирусы, микробные грибки, ферменты, агенты брожения или вещества, получаемые или экстрагируемые из микроорганизмов или из материала животного происхождения A01N 63/00; пищевые составы A21,A23; лекарственные препараты A61K; химические аспекты или использование материалов для бандажей, перевязочных средств, впитывающих подкладок или хирургических приспособлений A61L; удобрения C05); размножение, консервирование или сохранение микроорганизмов (консервирование живых тканей или органов людей или животных A01N 1/02); мутации или генная инженерия; питательные среды (среды для микробиологических испытаний C12Q)
C07K2317/14 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2683498:

МЕДИММЬЮН, ЭлЭлСи (US)
ХУМАБС БИОМЕД СА (CH)

Изобретение относится к биохимии. Описано выделенное антитело или его связывающий фрагмент, способные связываться с гемагглютинином вируса гриппа А и нейтрализовать по меньшей мере один подтип группы 1 и по меньшей мере 1 подтип группы 2 вируса гриппа A, которые содержат HCDR1 с последовательностью SEQ ID NO:113, HCDR2 с последовательностью SEQ ID NO:114, HCDR3 с последовательностью SEQ ID NO:115, LCDR1 с последовательностью SEQ ID NO:118, LCDR2 с последовательностью SEQ ID NO:119 и LCDR3 с последовательностью SEQ ID NO:120. Представлены применения данного антитела. Изобретение расширяет арсенал средств, нейтрализующих вирус гриппа А. 12 н. и 12 з.п. ф-лы, 15 ил., 13 табл., 11 пр.

 

Область изобретения

Настоящее изобретение относится к антителам, которые имеют нейтрализующую активность широкого спектра действия против вируса гриппа А, и путям применения таких антител.

Предпосылки изобретения

Вирусы гриппа вызывают ежегодные эпидемии гриппа и периодические пандемии, которые представляют значительную угрозу для здоровья населения во всем мире. Сезонная инфекция, вызванная вирусом гриппа, каждый год сопряжена с 200000-500000 смертей, особенно у маленьких детей, пациентов с ослабленным иммунитетом и у лиц пожилого возраста. Уровень смертности обычно возрастает дополнительно в периоды со вспышками пандемического гриппа. Сохраняется значительная неудовлетворенная медицинская потребность в разработке эффективных противовирусных терапевтических средств для предупреждения и лечения инфекций, вызванных вирусом гриппа, в частности, у малообеспеченного населения.

Существует три типа вирусов гриппа, типы A, B и C. Вирусы гриппа А могут инфицировать многих птиц и млекопитающих, в том числе человека, свиней, кур и хорьков. Вирусы гриппа A можно разделять на подтипы на основании аллельных вариаций в антигенных участках двух генов, которые кодируют поверхностные гликопротеины гемагглютинин (HA) и нейраминидазу (NA). HA представляет собой рецептор-связывающий и обеспечивающий слияние с мембраной гликопротеин, который опосредует прикрепление вируса к клеткам-мишеням и вхождение его в них; HA является первичной мишенью защитных гуморальных иммунных ответов. Белок HA является тримерным по структуре и состоит из трех идентичных копий одного предшественника полипептида, HA0, который при протеолитическом созревании расщепляется на pH-зависимое, метастабильное промежуточное соединение, содержащее глобулярную головку (HA1) и стволовой участок (HA2). Дистальная по отношению к мембране "глобулярная головка" составляет большую часть структуры HA1 и содержит связывающий карман для сиаловой кислоты для вхождения вируса и основные антигенные домены. Проксимальная по отношению к мембране "стволовая" структура, составленная из HA2 и некоторых остатков HA1, содержит аппарат слияния, который подвергается конформационному изменению в окружении низкого рН поздних эндосом для запуска слияния с мембраной и проникновения в клетки. Степень гомологии последовательностей между подтипами вируса A является меньшей в участке HA1 (гомология между подтипами 34%-59%), чем в участке HA2 (гомология 51%-80%). Нейтрализующие антитела, активированные инфекцией, вызванной вирусом гриппа, в норме направлены на вариабельную глобулярную головку HA1 для предупреждения связывания рецептора вируса и обычно штаммоспецифичны. В редких случаях были выявлены перекрестно реагирующие моноклональные антитела широкого спектра действия, которые направлены на глобулярную головку HA (Krause J.C. et al. 2011 J. Virol.85; Whittle J. et al., 2011 PNAS 108; Ekiert DC et al., 2012 Nature 489; Lee PS et al., 2012 PNAS 109). В противоположность этому, структура стволового участка является достаточно консервативной, и недавно было выявлено несколько нейтрализующих антител широкого спектра действия, которые связываются со "стволом" HA для предупреждения pH-активированного этапа слияния для вхождения вируса (Ekiert D.C. et al., 2009 Science 324; Sui J. et al., Nat Struct Mol Biol 16; Wrammert J et al., 2011 J Exp Med 208; Ekiert D. C et al., 2011 Science 333; Corti D et al., 2010 J Clin Invest 120; ThrosbyM 2008 PLoS One 3). Большинство этих реактивных в отношении "ствола" нейтрализующих антител являются специфичными к вирусам гриппа А группы 1 или специфичными к вирусам группы 2. Совсем недавно были выделены антитела, связывающиеся со "стволом", которые перекрестно реагировали с вирусами как группы 1, так и группы 2 (Corti D. et al., 2011 Science 333; Li GM et al., 2012 PNAS 109 и Cyrille D et al., 2012 Science 337; Nakamura G et al., 2013, Cell Host & Microbe 14).

К настоящему времени реализуемые на рынке антитела широкого спектра действия, которые полностью нейтрализуют или ингибируют инфекцию, вызванную вирусами гриппа A, или ослабляют симптомы заболевания, вызванного вирусом гриппа A, отсутствуют. Таким образом, сохраняется потребность в новых антителах, обеспечивающих защиту от нескольких подтипов группы 1 и группы 2 вируса гриппа A.

Описание изобретения

Настоящее изобретение предусматривает антитело к вирусу гриппа A или его связывающий фрагмент, которые способны к связыванию с гемагглютинином вируса гриппа А и нейтрализации по меньшей мере одного подтипа группы 1 и по меньшей мере 1 подтипа группы 2 вируса гриппа A.

Предпочтительно, антитело или связывающие фрагменты по настоящему изобретению способны к связыванию с гемагглютинином вируса гриппа A и нейтрализации по меньшей мере 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 подтипов группы 1 вируса гриппа A и по меньшей мере 1, 2, 3, 4, 5 или 6 подтипов группы 2 вируса гриппа A. Антитело или связывающие фрагменты по настоящему изобретению также предпочтительно способны к связыванию с гемагглютинином вируса гриппа A и нейтрализации по меньшей мере 5 подтипов группы 1 вируса гриппа A и по меньшей мере 1 или 2 подтипов группы 2 вируса гриппа A.

Подтипы гемагглютинина вирусов гриппа A разделяются на две основные филогенетические группы, идентифицируемые как группа 1, которая включает подтипы H1, H2, H5, H6, H8, H9, H11, H12, H13, H16 и H17, и группа 2, которая включает подтипы H3, H4, H7, H10, H14 и H15. В одном варианте осуществления антитело или связывающий фрагмент в соответствии с настоящим изобретением способны к связыванию и/или нейтрализации одного или нескольких подтипов группы 1 вируса гриппа A, выбранных из H1, H2, H5, H6, H8, H9, H11, H12, H13, H16 и H17 и их вариантов, и одного или нескольких подтипов группы 2 вируса гриппа A, выбранных из H3, H4, H7, H10, H14 и H15 и их вариантов. В другом варианте осуществления антитело или связывающий фрагмент в соответствии с настоящим изобретением способны к связыванию и/или нейтрализации подтипов H1, H2, H5, H6, H8, H9, H11, H12, H13, H16 и H17 группы 1 вируса гриппа A и подтипов H3, H4, H7, H10, H14 и H15 группы 2 вируса гриппа A. В другом варианте осуществления антитело или связывающий фрагмент способны к связыванию и/или нейтрализации подтипов H1, H2, H5, H6 и H9 группы 1 и подтипов H3 и H7 группы 2. В дополнительном варианте осуществления антитело или связывающий фрагмент способны к связыванию и/или нейтрализации подтипов H1, H2, H5 и H6 группы 1 и подтипов H3 и H7 группы 2.

Настоящее изобретение основано на выделении встречающегося в природе человеческого моноклонального антитела (mAb) из IgG В-клеток памяти, которые были собраны от отдельных доноров в качестве исходных материалов. Для получения вариантов антител с улучшенными характеристиками применялась оптимизация, как описано в данном документе. Оптимизированные варианты антител не встречаются в природе; их получают с помощью рекомбинантных методик. Антитело или его фрагменты по настоящему изобретению связываются со стволовым участком HA и нейтрализуют инфекцию, вызванную более чем одним подтипом вируса гриппа A, выбранным из подтипов группы 1 и группы 2, соответственно. Антитела по настоящему изобретению, которые представляют собой антитела к вирусу гриппа А, связывающиеся со "стволом" HA, продемонстрировали более широкий спектр действия или лучшую нейтрализующую активность против вирусов гриппа A по сравнению с антителом из опубликованной литературы (антитело FI6v4, описанное в WO2013/011347A1) и представлены в таблице 6 примера 5. Кроме того, антитела по настоящему изобретению могут быть более эффективными, чем другое(другие) mAb, в блокировании созревания HA, как представлено на фигуре 1 примера 6.

В некоторых вариантах осуществления антитело или его связывающий фрагмент содержат совокупность из шести CDR, при этом совокупность из шести CDR выбрана из группы, состоящей из:

(a) HCDR1 c SEQ ID NO: 3, HCDR2 c SEQ ID NO: 4, HCDR3 c SEQ ID NO: 5, LCDR1 c SEQ ID NO: 8, LCDR2 c SEQ ID NO: 9 и LCDR3 c SEQ ID NO: 10;

(b) HCDR1 c SEQ ID NO: 13, HCDR2 c SEQ ID NO: 14, HCDR3 c SEQ ID NO: 15, LCDR1 c SEQ ID NO: 18, LCDR2 c SEQ ID NO: 19, LCDR3 c SEQ ID NO: 20;

(c) HCDR1 c SEQ ID NO: 23, HCDR2 c SEQ ID NO: 24, HCDR3 c SEQ ID NO: 25, LCDR1 c SEQ ID NO: 28, LCDR2 c SEQ ID NO: 29 и LCDR3 c SEQ ID NO: 30;

(d) HCDR1 c SEQ ID NO: 33, HCDR2 c SEQ ID NO: 34, HCDR3 c SEQ ID NO: 35, LCDR1 c SEQ ID NO: 38, LCDR2 c SEQ ID NO: 39 и LCDR3 c SEQ ID NO: 40;

(e) HCDR1 c SEQ ID NO: 43, HCDR2 c SEQ ID NO: 44, HCDR3 c SEQ ID NO: 45, LCDR1 c SEQ ID NO: 48, LCDR2 c SEQ ID NO: 49 и LCDR3 c SEQ ID NO: 50;

(f) HCDR1 c SEQ ID NO: 53, HCDR2 c SEQ ID NO: 54, HCDR3 c SEQ ID NO: 55, LCDR1 c SEQ ID NO: 58, LCDR2 c SEQ ID NO: 59 и LCDR3 c SEQ ID NO: 60;

(g) HCDR1 c SEQ ID NO: 63, HCDR2 c SEQ ID NO: 64, HCDR3 c SEQ ID NO: 65, LCDR1 c SEQ ID NO: 68, LCDR2 c SEQ ID NO: 69 и LCDR3 c SEQ ID NO: 70;

(h) HCDR1 c SEQ ID NO: 73, HCDR2 c SEQ ID NO: 74, HCDR3 c SEQ ID NO: 75, LCDR1 c SEQ ID NO: 78, LCDR2 c SEQ ID NO: 79 и

LCDR3 c SEQ ID NO: 80;

(i) HCDR1 c SEQ ID NO: 83, HCDR2 c SEQ ID NO: 84, HCDR3 c SEQ ID NO: 85, LCDR1 c SEQ ID NO: 88, LCDR2 c SEQ ID NO: 89, LCDR3 c SEQ ID NO: 90;

(j) HCDR1 c SEQ ID NO: 93, HCDR2 c SEQ ID NO: 94, HCDR3 c SEQ ID NO: 95, LCDR1 c SEQ ID NO: 98, LCDR2 c SEQ ID NO: 99 и LCDR3 c SEQ ID NO: 100;

(k) HCDR1 c SEQ ID NO: 103, HCDR2 c SEQ ID NO: 104, HCDR3 c SEQ ID NO: 105, LCDR1 c SEQ ID NO: 108, LCDR2 c SEQ ID NO: 109 и

LCDR3 c SEQ ID NO: 110;

(l) HCDR1 c SEQ ID NO: 113, HCDR2 c SEQ ID NO: 114, HCDR3 c SEQ ID NO: 115, LCDR1 c SEQ ID NO: 118, LCDR2 c SEQ ID NO: 119 и

LCDR3 c SEQ ID NO: 110;

(m) HCDR1 c SEQ ID NO: 123, HCDR2 c SEQ ID NO: 124, HCDR3 c SEQ ID NO: 125, LCDR1 c SEQ ID NO: 128, LCDR2 c SEQ ID NO: 129 и LCDR3 c SEQ ID NO: 130;

(n) HCDR1 c SEQ ID NO: 133, HCDR2 c SEQ ID NO: 134, HCDR3 c SEQ ID NO: 135, LCDR1 c SEQ ID NO: 138, LCDR2 c SEQ ID NO: 139 и LCDR3 c SEQ ID NO: 140; и

(o) HCDR1 c SEQ ID NO: 143, HCDR2 c SEQ ID NO: 144, HCDR3 c SEQ ID NO: 145, LCDR1 c SEQ ID NO: 148, LCDR2 c SEQ ID NO: 149 и

LCDR3 c SEQ ID NO: 150;

(p) совокупности из шести CDR в соответствии с любым из (a)-(o), содержащих одну или несколько замен, делеций или вставок аминокислот;

(q) совокупности из шести CDR в соответствии с любым из (a)-(p), содержащих 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, или 24, или 25 замен аминокислот;

(r) совокупности из шести CDR HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, LCDR3 в соответствии с любым из (a)-(q), содержащих:

(i) HCDR1 с аминокислотной последовательностью, идентичной или содержащей 3 или меньшее количество замен аминокислотных остатков по сравнению с SEQ ID NO: 3;

(ii) HCDR2 с аминокислотной последовательностью, идентичной или содержащей 5 или меньшее количество замен аминокислотных остатков по сравнению с SEQ ID NO:4;

(iii) HCDR3 с аминокислотной последовательностью, идентичной или содержащей 6 или меньшее количество замен аминокислотных остатков по сравнению с SEQ ID NO:5;

(iv) LCDR1 с аминокислотной последовательностью, идентичной или содержащей 5 или меньшее количество замен аминокислотных остатков и/или одну делецию по сравнению с SEQ ID NO:6;

(v) LCDR2 с аминокислотной последовательностью, идентичной или содержащей 5 или меньшее количество замен аминокислотных остатков по сравнению с SEQ ID NO:7; и

(vi) LCDR3 с аминокислотной последовательностью, идентичной или содержащей 1 или меньшее количество замен аминокислотных остатков по сравнению с SEQ ID NO:8;

(s) совокупности из шести CDR HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, LCDR3 в соответствии с любым из (a)-(r), содержащих:

(i) HCDR1, в котором:

остаток 31 по Kabat представляет собой S,

остаток 32 по Kabat представляет собой N или Y,

остаток 33 по Kabat представляет собой N, S или R,

остаток 34 по Kabat представляет собой A,

остаток 35 по Kabat представляет собой V или T,

остаток 35А по Kabat представляет собой W,

остаток 35B по Kabat представляет собой N;

(ii) HCDR2, в котором:

остаток 50 по Kabat представляет собой R,

остаток 51 по Kabat представляет собой T,

остаток 52 по Kabat представляет собой Y,

остаток 52A по Kabat представляет собой Y,

остаток 53 по Kabat представляет собой R,

остаток 54 по Kabat представляет собой S,

остаток 55 по Kabat представляет собой K или G,

остаток 56 по Kabat представляет собой W,

остаток 57 по Kabat представляет собой Y,

остаток 58 по Kabat представляет собой N или Y,

остаток 59 по Kabat представляет собой D,

остаток 60 по Kabat представляет собой Y,

остаток 61 по Kabat представляет собой A,

остаток 62 по Kabat представляет собой E, V или D,

остаток 63 по Kabat представляет собой S или F,

остаток 64 по Kabat представляет собой V или L,

остаток 65 по Kabat представляет собой K;

(iii) HCDR3, в котором:

остаток 95 по Kabat представляет собой S или G,

остаток 96 по Kabat представляет собой G,

остаток 97 по Kabat представляет собой H,

остаток 98 по Kabat представляет собой I,

остаток 99 по Kabat представляет собой T,

остаток 100 по Kabat представляет собой V или E,

остаток 100A по Kabat представляет собой F,

остаток 100B по Kabat представляет собой G,

остаток 100C по Kabat представляет собой V или L,

остаток 100D по Kabat представляет собой N;

остаток 100E по Kabat представляет собой V или I,

остаток 100F по Kabat представляет собой D,

остаток 100G по Kabat представляет собой A,

остаток 100F по Kabat представляет собой F или Y,

остаток 101 по Kabat представляет собой D,

остаток 102 по Kabat представляет собой M, I или V;

(iv) LCDR1, в котором:

остаток 24 по Kabat представляет собой R,

остаток 25 по Kabat представляет собой T, A или отсутствует,

остаток 26 по Kabat представляет собой S или A,

остаток 27 по Kabat представляет собой Q,

остаток 28 по Kabat представляет собой S или R,

остаток 29 по Kabat представляет собой L,

остаток 30 по Kabat представляет собой S, N или R,

остаток 31 по Kabat представляет собой S,

остаток 32 по Kabat представляет собой Y,

остаток 33 по Kabat представляет собой L, T или D,

остаток 34 по Kabat представляет собой H;

(v) LCDR2, в котором:

остаток 50 по Kabat представляет собой A,

остаток 51 по Kabat представляет собой A, T или S,

остаток 52 по Kabat представляет собой S или T,

остаток 53 по Kabat представляет собой S или T,

остаток 54 по Kabat представляет собой L или R,

остаток 55 по Kabat представляет собой Q, L или G,

остаток 56 по Kabat представляет собой S; и

(vi) LCDR3, в котором:

остаток 89 по Kabat представляет собой Q,

остаток 90 по Kabat представляет собой Q или L,

остаток 91 по Kabat представляет собой S,

остаток 92 по Kabat представляет собой R, и

остаток 93 по Kabat представляет собой T.

Настоящее изобретение предусматривает антитела и их связывающие фрагменты, содержащие совокупность из шести CDR: HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, LCDR3, где совокупность из шести CDR представлена в таблицах 11 и 13.

Варианты последовательностей антител по настоящему изобретению могут характеризоваться 75% или большей (например, 80%, 85%, 90%, 95%, 97%, 98%, 99% или большей) идентичностью аминокислотной последовательности с последовательностями, изложенными в настоящей заявке. В некоторых вариантах осуществления идентичность последовательности рассчитывают по отношению к полной длине эталонной последовательности (т.е. последовательности, изложенной в заявке). В некоторых дополнительных вариантах осуществления процент идентичности, как упомянуто в данном документе, определяют с помощью BLAST версии 2.1.3 с использованием параметров по умолчанию, определенных NCBI (Национальный центр биотехнологической информации; http://www.ncbi.nlm.nih.gov/) [матрица Blosum 62; штраф за открытие гэпа=1 и штраф за продолжение гэпа=1].

Варианты антител также включены в объем настоящего изобретения. Таким образом, варианты последовательностей, изложенных в настоящей заявке, также включены в объем настоящего изобретения. Варианты последовательностей антител с улучшенной аффинностью и/или эффективностью могут быть получены с помощью способов, известных в данной области техники, и включены в объем настоящего изобретения. Например, замены аминокислот могут применяться для получения антител с дополнительно улучшенной аффинностью. Альтернативно, оптимизация кодонов нуклеотидной последовательности может применяться для улучшения эффективности трансляции в системах экспрессии для выработки антитела. Также полинуклеотиды, содержащие последовательность, оптимизированную в отношении специфичности или нейтрализующей активности антитела с помощью метода направленной эволюции применительно к любой из последовательностей нуклеиновых кислот по настоящему изобретению, находятся в объеме настоящего изобретения.

Настоящее изобретение предусматривает антитело или его связывающий фрагмент в соответствии с настоящим изобретением, содержащие VH, который по меньшей мере на 75% идентичен, и/или VL, который по меньшей мере на 75% идентичен VH и/или VL, выбранными из группы, состоящей из:

(a) VH с SEQ ID NO: 2 и VL с SEQ ID NO: 7,

(b) VH с SEQ ID NO: 12 и VL с SEQ ID NO: 17,

(c) VH с SEQ ID NO: 22 и VL с SEQ ID NO: 27,

(d) VH с SEQ ID NO: 32 и VL с SEQ ID NO: 37,

(e) VH с SEQ ID NO: 42 и VL с SEQ ID NO: 47,

(f) VH с SEQ ID NO: 52 и VL с SEQ ID NO: 57,

(g) VH с SEQ ID NO: 62 и VL с SEQ ID NO: 67,

(h) VH с SEQ ID NO: 72 и VL с SEQ ID NO: 77,

(i) VH с SEQ ID NO: 82 и VL с SEQ ID NO: 87,

(j) VH с SEQ ID NO: 92 и VL с SEQ ID NO: 97,

(k) VH с SEQ ID NO: 102 и VL с SEQ ID NO: 107,

(l) VH с SEQ ID NO: 112 и VL с SEQ ID NO: 117,

(m) VH с SEQ ID NO: 122 и VL с SEQ ID NO: 127,

(n) VH с SEQ ID NO: 132 и VL с SEQ ID NO: 137,

(o) VH с SEQ ID NO: 144 и VL с SEQ ID NO: 147 и

(p) VH с SEQ ID NO: 152 и VL с SEQ ID NO: 157.

Антитело или его связывающий фрагмент в соответствии с настоящим изобретением могут содержать VH и VL, выбранные из группы, состоящей из:

(a) VH с SEQ ID NO: 2 и VL с SEQ ID NO: 7,

(b) VH с SEQ ID NO: 12 и VL с SEQ ID NO: 17,

(c) VH с SEQ ID NO: 22 и VL с SEQ ID NO: 27,

(d) VH с SEQ ID NO: 32 и VL с SEQ ID NO: 37,

(e) VH с SEQ ID NO: 42 и VL с SEQ ID NO: 47,

(f) VH с SEQ ID NO: 52 и VL с SEQ ID NO: 57,

(g) VH с SEQ ID NO: 62 и VL с SEQ ID NO: 67,

(h) VH с SEQ ID NO: 72 и VL с SEQ ID NO: 77,

(i) VH с SEQ ID NO: 82 и VL с SEQ ID NO: 87,

(j) VH с SEQ ID NO: 92 и VL с SEQ ID NO: 97,

(k) VH с SEQ ID NO: 102 и VL с SEQ ID NO: 107,

(l) VH с SEQ ID NO: 112 и VL с SEQ ID NO: 117,

(m) VH с SEQ ID NO: 122 и VL с SEQ ID NO: 127,

(n) VH с SEQ ID NO: 132 и VL с SEQ ID NO: 137,

(o) VH с SEQ ID NO: 144 и VL с SEQ ID NO: 147 и

(p) VH с SEQ ID NO: 152 и VL с SEQ ID NO: 157.

Антитело или его связывающий фрагмент в соответствии с настоящим изобретением могут быть выбраны из группы, состоящей из: молекулы иммуноглобулина, моноклонального антитела, химерного антитела, антитела с трансплантированным CDR, гуманизированного антитела, Fab, Fab', F(аb')2, Fv, Fv c дисульфидной связью, scFv, однодоменного антитела, диатела, полиспецифического антитела, антитела с двойной специфичностью и биспецифического антитела.

Антитело или его связывающий фрагмент в соответствии с настоящим изобретением могут содержать VH, содержащий человеческую каркасную область зародышевого типа, предпочтительно, VH6-1, и/или VL, содержащий человеческую каркасную область зародышевого типа, предпочтительно, VK1-39. Предпочтительно, антитело или его связывающий фрагмент в соответствии с настоящим изобретением содержат VH, содержащий человеческую каркасную область VH6-1 зародышевого типа, и/или VL, содержащий человеческую каркасную область VK1-39 зародышевого типа. Каркасная область VH6 редко применяется в антителах.

Антитело или его связывающий фрагмент в соответствии с настоящим изобретением могут содержать Fc-участок, предпочтительно, антитело представляет собой IgG1, IgG2 или IgG4 или их связывающий фрагмент.

В одном варианте осуществления антитело по настоящему изобретению содержит константный домен человеческого IgG с одной или несколькими заменами аминокислот по сравнению с константным доменом человеческого IgG дикого типа. Антитело по настоящему изобретению может содержать константный домен человеческого IgG с заменами аминокислот M252Y, S254T и T256E ("YTE"), где аминокислотные остатки пронумерованы в соответствии с EU-индексом, как у Kabat.

Настоящее изобретение также предусматривает антитело к вирусу гриппа A или его связывающий фрагмент, способные к связыванию с гемагглютинином вируса гриппа А и нейтрализации по меньшей мере одного подтипа группы 1 и по меньшей мере одного подтипа группы 2 вируса гриппа A, характеризующиеся тем, что антитело или его связывающий фрагмент конкурируют за связывание с гемагглютинином вируса гриппа А с антителом по настоящему изобретению, описанным выше. Соответственно, настоящее изобретение включает антитело или его фрагмент, которые связываются с тем же эпитопом, что и антитело по настоящему изобретению, или антитело, которое конкурирует за связывание с антителом по настоящему изобретению.

Настоящее изобретение дополнительно предусматривает выделенную нуклеиновую кислоту, кодирующую антитело или его фрагмент в соответствии с настоящим изобретением. Предпочтительно, нуклеиновой кислотой является кДНК. Настоящее изобретение также включает последовательности нуклеиновых кислот, кодирующие часть или все из легкой и тяжелой цепей и CDR антител по настоящему изобретению. Таким образом, в данном документе представлены последовательности нуклеиновых кислот, кодирующие часть или все из легкой и тяжелой цепей и CDR иллюстративных антител по настоящему изобретению. Представлены номера SEQ ID для последовательностей нуклеиновых кислот, кодирующих CDR, вариабельные участки тяжелой и легкой цепей иллюстративных антител по настоящему изобретению. Вследствие избыточности генетического кода будут существовать варианты этих последовательностей, которые кодируют одинаковые аминокислотные последовательности.

Настоящее изобретение, кроме того, дополнительно предусматривает вектор, содержащий выделенную нуклеиновую кислоту в соответствии с настоящим изобретением; предпочтительно, вектором является вектор экспрессии.

Кроме того, настоящее изобретение предусматривает клетку-хозяина, содержащую выделенную нуклеиновую кислоту или вектор в соответствии с настоящим изобретением. Подходящие клетки-хозяева включают линии клеток млекопитающих, как, например, происходящие из клеток HEK или CHO.

Также настоящее изобретение предусматривает способ получения антитела или его фрагмента по настоящему изобретению, включающий культивирование клетки-хозяина по настоящему изобретению в условиях, подходящих для экспрессии антитела или его фрагмента.

Такие способы могут дополнительно включать выделение антитела или его фрагмента из культуры клетки-хозяина и необязательно составление выделенного антитела или его фрагмента в композицию.

Настоящее изобретение, кроме того, предусматривает композицию, содержащую антитело или его фрагмент в соответствии с настоящим изобретением и фармацевтически приемлемый носитель.

Также в настоящем изобретении предусмотрена композиция, содержащая антитело или его фрагмент в соответствии с настоящим изобретением, гистидин и NaCl при pH в диапазоне от приблизительно 5,5 до приблизительно 6,5, предпочтительно при pH приблизительно 6,0; еще более предпочтительно, содержащая антитело или его фрагмент в соответствии с настоящим изобретением, от приблизительно 20 до приблизительно 30 мM гистидина и от приблизительно 0,1 до приблизительно 0,2M NaCl, при pH в диапазоне от приблизительно 5,5 до приблизительно 6,5, предпочтительно при pH приблизительно 6,0; наиболее предпочтительно, содержащая 25 мM His и 0,15M NaCl при pH в диапазоне от приблизительно 5,5 до приблизительно 6,5, например, при pH приблизительно 6,0.

Кроме того, настоящее изобретение предусматривает:

- антитело или его фрагмент в соответствии с настоящим изобретением для применения в профилактике или лечении инфекции, вызванной вирусом гриппа A, у субъекта;

- применение антитела или его фрагмента в соответствии с настоящим изобретением в производстве лекарственного препарата для профилактики или лечения инфекции, вызванной вирусом гриппа A, у субъекта;

- способ профилактики или лечения инфекции, вызванной вирусом гриппа A, у субъекта, включающий введение антитела или его фрагмента в соответствии с настоящим изобретением;

- применение антитела или его фрагмента в соответствии с настоящим изобретением для предупреждения рН-активированного этапа слияния для вхождения вируса гриппа A в клетки; или

- применение антитела или его фрагмента в соответствии с настоящим изобретением для ингибирования созревания HA вируса гриппа A.

Иллюстративные антитела по настоящему изобретению включают, без ограничения: антитело 3, антитело 5, антитело 6, антитело 8, антитело 10, антитело 11, антитело 12, антитело 13, антитело 14 и антитело 15.

Настоящее изобретение также предусматривает применение антитела или его связывающего фрагмента в соответствии с настоящим изобретением в диагностике in vitro инфекции, вызванной вирусом гриппа A, у субъекта.

Подробное описание

Введение

Настоящее изобретение предусматривает антитела, в том числе человеческие формы, а также их фрагменты, производные/конъюгаты и композиции, которые связываются со "стволом" гемагглютинина (HA) вируса гриппа A и нейтрализуют инфекцию, вызванную подтипами группы 1 и группы 2 вируса гриппа A, как описано в данном документе; такие антитела к вирусу гриппа A, связывающиеся со "стволом" HA, называются в данном документе антителами по настоящему изобретению.

Как используется в данном документе, выражение "нейтрализовать" относится к способности антитела или его связывающего фрагмента связываться с возбудителем инфекции, таким как вирус гриппа A, и снижать биологическую активность, например, вирулентность, возбудителя инфекции. Минимальным требованием для нейтрализации является способность антитела или его связывающего фрагмента связываться с возбудителем инфекции. В одном варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению иммуноспецифично связывают по меньшей мере один определенный эпитоп или антигенную детерминанту вируса гриппа А. В более конкретном варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению иммуноспецифично связывают по меньшей мере один определенный эпитоп или антигенную детерминанту белка "ствола" HA вируса гриппа А.

Антитело может нейтрализовать активность возбудителя инфекции, такого как вирус гриппа А, в различных точках в течение жизненного цикла вируса. Например, антитело может нарушать прикрепление вируса к клетке-мишени, препятствуя взаимодействию вируса и одного или нескольких рецепторов клеточной поверхности. Альтернативно, антитело может нарушать один или несколько видов взаимодействия вируса со своими рецепторами после прикрепления, например, препятствуя интернализации вируса в результате эндоцитоза, опосредованного рецепторами.

В одном варианте осуществления антитело или его связывающий фрагмент нейтрализуют активность вируса гриппа A, нарушая процесс слияния, например, препятствуя слиянию вируса и эндосомальных мембран. В другом варианте осуществления антитело или его связывающий фрагмент нарушают опосредованное протеазами расщепление HA0, препятствуя, таким образом, созреванию вирусов и образованию вирусного гибридного пептида HA2. Например, в одном варианте осуществления антитело или его связывающий фрагмент нарушают опосредованное протеазами расщепление HA0, необходимое для активации вируса гриппа A.

Как используется в данном документе, выражения "антитело" и "антитела", также известные как иммуноглобулины, охватывают моноклональные антитела (в том числе моноклональные антитела полной длины), человеческие антитела, гуманизированные антитела, верблюжьи антитела, химерные антитела, одноцепочечные Fv (scFv), одноцепочечные антитела, однодоменные антитела, доменные антитела, Fab-фрагменты, F(аb')2-фрагменты, фрагменты антител, которые проявляют необходимую биологическую активность (например, антигенсвязывающую часть), Fv c дисульфидными связями (dsFv) и антиидиотипические (анти-Id) антитела (включая, например, анти-Id антитела к антителам по настоящему изобретению), внутриклеточные антитела и эпитопсвязывающие фрагменты любого из вышеупомянутого. В частности, антитела включают молекулы иммуноглобулинов и иммунологически активные фрагменты молекул иммуноглобулинов, т.е. молекулы, которые содержат по меньшей мере один антигенсвязывающий участок. Молекулы иммуноглобулинов могут быть любого изотипа (например, IgG, IgE, IgM, IgD, IgA и IgY), субизотипа (например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или аллотипа (например, Gm, например, G1m(f, z, a или x), G2m(n), G3m(g, b или c), Am, Em и Km(1, 2 или 3)).

Человеческие антитела, как правило, представляют собой гетеротетрамерные гликопротеины массой приблизительно 150000 дальтон, состоящие из двух идентичных легких (L) цепей и двух идентичных тяжелых (H) цепей. Каждая легкая цепь связана с тяжелой цепью одной ковалентной дисульфидной связью, при этом среди тяжелых цепей разных изотипов иммуноглобулина количество дисульфидных связей различается. Каждая тяжелая и легкая цепь также имеет расположенные с равными интервалами дисульфидные мостики между цепями. Каждая тяжелая цепь имеет на одном конце вариабельный домен (VH), за которым расположены несколько константных доменов (CH). Каждая легкая цепь имеет вариабельный домен на одном конце (VL) и константный домен (CL) на своем другом конце; причем константный домен легкой цепи расположен на одной линии с первым константным доменом тяжелой цепи, и вариабельный домен легкой цепи расположен на одной линии с вариабельным доменом тяжелой цепи. Легкие цепи относят к лямбда-цепям либо каппа-цепям на основании аминокислотной последовательности константного участка легкой цепи. Вариабельный домен легкой каппа-цепи также может обозначаться в данном документе как VK.

Антитела по настоящему изобретению включают антитело полной длины или интактное антитело, фрагменты антител, в том числе антигенсвязывающие фрагменты, антитело с нативной последовательностью или аминокислотными вариантами, человеческие, гуманизированные, подвергнутые посттрансляционной модификации, химерные или гибридные антитела, иммуноконъюгаты и их функциональные фрагменты. Антитела могут быть модифицированы в Fc-участке для обеспечения желаемых эффекторных функций или периода полувыведения из сыворотки. Как обсуждается более подробно в следующих далее разделах в отношении соответствующих Fc-участков, "голое" антитело, связанное на клеточной поверхности, может индуцировать цитотоксичность, например, в результате антителозависимой клеточной цитотоксичности (ADCC), или с помощью привлечения компонентов системы комплемента в комплементзависимой цитотоксичности (CDC), или с помощью привлечения неспецифических цитотоксических клеток, которые экспрессируют один или несколько эффекторных лигандов, распознающих связанное антитело на "стволе" HA вируса гриппа А и затем вызывающих фагоцитоз клетки по типу антителозависимого клеточноопосредованного фагоцитоза (ADCP) или какого-либо другого механизма. Альтернативно, если необходимо исключить или ослабить эффекторную функцию для того, чтобы минимизировать побочные эффекты или терапевтические осложнения, можно применять определенные другие Fc-участки. Fc-участок антител по настоящему изобретению может быть модифицирован для увеличения аффинности связывания FcRn и, таким образом, увеличения периода полувыведения из сыворотки. Альтернативно, Fc-участок может быть конъюгирован с PEG или альбумином для увеличения периода полувыведения из сыворотки или подвергнут какому-либо другому конъюгированию, которое приводит к желаемому эффекту.

Антитела по настоящему изобретению к вирусу гриппа A, связывающиеся со "стволом" HA, полезны для диагностики, предупреждения, лечения и/или облегчения одного или нескольких симптомов инфекции, вызванной вирусом гриппа A, у млекопитающего.

Настоящее изобретение предусматривает композицию, содержащую антитело к вирусу гриппа A, связывающееся со "стволом" HA, по настоящему изобретению и носитель. С целью предупреждения или лечения инфекции, вызванной вирусом гриппа А, композиции можно вводить пациенту, нуждающемуся в таком лечении. Настоящее изобретение также предусматривает составы, содержащие антитело к вирусу гриппа A, связывающееся со "стволом" HA, по настоящему изобретению и носитель. В одном варианте осуществления состав представляет собой терапевтический состав, содержащий фармацевтически приемлемый носитель.

В определенных вариантах осуществления настоящее изобретение предусматривает способы, пригодные для предупреждения или лечения инфекции, вызванной вирусом гриппа А, у млекопитающего, включающие введение терапевтически эффективного количества антитела млекопитающему. Терапевтические композиции антитела можно вводить кратковременно (однократно), длительно или периодически, как указывается врачом.

В определенных вариантах осуществления настоящее изобретение также предусматривает готовые изделия, содержащие по меньшей мере антитело к вирусу гриппа A, связывающееся со "стволом" HA, такие как стерильные лекарственные формы и наборы. Могут быть представлены наборы, которые содержат антитела для выявления и количественного определения вируса гриппа А in vitro, например, в ELISA или вестерн-блоттинге. Такое антитело, пригодное для выявления, можно обеспечить меткой, такой как флуоресцентная или радиоизотопная метка.

Терминология

Прежде чем подробно описывать настоящее изобретение, следует понимать, что настоящее изобретение не ограничивается конкретными композициями или этапами способов, поскольку таковые могут изменяться. Следует отметить, что, как используется в данном описании и прилагаемой формуле изобретения, формы единственного числа включают определяемые объекты во множественном числе, если из контекста явно не следует иное.

Если не определено иное, все технические и научные выражения, используемые в данном документе, имеют то же значение, которое обычно понимает специалист в данной области техники, к которой относится настоящее изобретение. Например, Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press и Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, обеспечивают специалиста общим словарем многих выражений, используемых в настоящем изобретении.

Аминокислоты могут называться в данном документе по их общеизвестным трехбуквенным символам либо по однобуквенным символам, рекомендованным комиссией по биохимической номенклатуре IUPAC-IUB. Аналогично, нуклеотиды могут называться по их общепринятым однобуквенным кодам.

При нумерации аминокислот в вариабельном домене, участках, определяющих комплементарность (CDR), и каркасных областях (FR) антитела следуют, если не указано иное, определению по Kabat, как изложено в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991). При применении этой системы нумерации фактическая линейная аминокислотная последовательность может содержать меньшее количество аминокислот или дополнительные аминокислоты, соответствующие укорочению FR или CDR вариабельного домена или вставке в них. Например, вариабельный домен тяжелой цепи может содержать вставку одной аминокислоты (остаток 52a согласно Kabat) после остатка 52 в H2 и вставленные остатки (например, остатки 82a, 82b и 82c и т.д., согласно Kabat) после остатка 82 FR тяжелой цепи. Нумерацию остатков по Kabat можно определить для данного антитела путем выравнивания участков антитела с гомологией последовательности антитела со "стандартной" последовательностью с нумерацией по Kabat. Максимальное выравнивание остатков каркасных областей часто требует введения "спейсерных" остатков в систему нумерации, чтобы применять ее для Fv-участка. Кроме того, идентичность определенных отдельных остатков в любом указанном участке с нумерацией по Kabat может изменяться от цепи антитела к цепи антитела вследствие межвидовой или аллельной дивергенции.

Антитела к вирусу гриппа A, связывающееся со "стволом" HA

В определенных вариантах осуществления антитела являются выделенными, и/или очищенными, и/или апирогенными антителами. Выражение "очищенный", как используется в данном документе, относится к другим молекулам, например, молекуле полипептида, нуклеиновой кислоты, которая была идентифицирована и отделена и/или извлечена из компонента своего естественного окружения. Таким образом, в одном варианте осуществления антитела по настоящему изобретению представляют собой очищенные антитела, при этом они были отделены от одного или нескольких компонентов их естественного окружения. Выражение "выделенное антитело", как используется в данном документе, относится к антителу, которое фактически не содержит других молекул антител, имеющих отличающуюся антигенную специфичность (например, выделенное антитело, которое специфично связывается со "стволом" HA вируса гриппа А, фактически не содержит антител, которые специфично связывают антигены, отличные от таковых "ствола" HA вируса гриппа А). Таким образом, в одном варианте осуществления антитела по настоящему изобретению являются выделенными антителами, при этом они были отделены от антител с отличающейся специфичностью. Обычно выделенное антитело представляет собой моноклональное антитело. Кроме того, выделенное антитело по настоящему изобретению может фактически не содержать одного или нескольких других материалов и/или химических веществ клетки и называется в данном документе выделенным и очищенным антителом. В одном варианте осуществления настоящего изобретения комбинация "выделенных" моноклональных антител относится к антителам, имеющим отличающиеся специфичности и объединенным в четко определенную композицию. Способы получения и очистки/выделения антител более подробно описаны ниже.

Выделенные антитела по настоящему изобретению включают в себя аминокислотные последовательности антител, раскрытые в данном документе, кодируемые любым подходящим полинуклеотидом, или любое выделенное или составленное антитело.

Антитела по настоящему изобретению иммуноспецифично связывают по меньшей мере один определенный эпитоп, специфичный для белка "ствола" HA вируса гриппа А. Выражение "эпитоп", как используется в данном документе, относится к детерминанте белка, способной связываться с антителом. Эпитопы обычно включают химически активные поверхностные группы молекул, таких как аминокислоты или боковые цепи сахаров, и обычно обладают специфическими характеристиками трехмерной структуры, а также специфическими характеристиками заряда. Конформационные и неконформационные эпитопы отличаются тем, что связывание с первыми, но не с последними утрачивается в присутствии денатурирующих растворителей.

В одном варианте осуществления антитело или его связывающий фрагмент связываются с эпитопом, который является консервативным среди по меньшей мере H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15, H16 или H17 или всех подтипов HA вируса гриппа A. В другом варианте осуществления антитело или его связывающий фрагмент связываются с эпитопом, который является консервативным среди одного или нескольких или по меньшей мере 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 подтипов вируса гриппа A группы 1, выбранных из H1, H2, H5, H6, H8, H9, H11, H12, H13 и H16, и одного или нескольких или по меньшей мере 1, 2, 3, 4, 5 или 6 подтипов группы 2, выбранных из H3, H4, H7, H10, H14 и H15.

В одном варианте осуществления антитело или его связывающий фрагмент связывают по меньшей мере H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15, H16 или H17 или все подтипы вируса гриппа A с EC50 от приблизительно 0,01 мкг/мл до приблизительно 5 мкг/мл, или от приблизительно 0,01 мкг/мл до приблизительно 0,5 мкг/мл, или от приблизительно 0,01 мкг/мл до приблизительно 0,1 мкг/мл, или менее чем приблизительно 5 мкг/мл, 1 мкг/мл, 0,5 мкг/мл, 0,1 мкг/мл или 0,05 мкг/мл. В другом варианте осуществления антитело или его связывающий фрагмент связывают по меньшей мере один или несколько или по меньшей мере 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 подтипов вируса гриппа А группы 1, выбранных из H1, H2, H5, H6, H8, H9, H11, H12, H13 и H16, и один или несколько или по меньшей мере 1, 2, 3, 4, 5 или 6 подтипов группы 2, выбранных из H3, H4, H7, H10, H14 и H15, с EC50 от приблизительно 0,01 мкг/мл до приблизительно 5 мкг/мл, или от приблизительно 0,01 мкг/мл до приблизительно 0,5 мкг/мл, или от приблизительно 0,01 мкг/мл до приблизительно 0,1 мкг/мл, или менее чем приблизительно 5 мкг/мл, 1 мкг/мл, 0,5 мкг/мл, 0,1 мкг/мл или 0,05 мкг/мл.

В одном варианте осуществления антитело или его связывающий фрагмент распознают эпитоп, который является линейным эпитопом или непрерывным эпитопом. В другом варианте осуществления антитело или его связывающий фрагмент распознают нелинейный или конформационный эпитоп. В одном варианте осуществления эпитоп расположен в высококонсервативном стволовом участке HA2. В более конкретном варианте осуществления антитело или его связывающий фрагмент связываются с конформационным эпитопом в высококонсервативном стволовом участке HA2. В одном варианте осуществления эпитоп содержит одну или несколько аминокислот, выбранных из: положений 18, 19, 42, 45 в стволовом участке HA2 (положения пронумерованы в соответствии с системой нумерации H3, как описано в Weiss et al., J. Mol. Biol. (1990) 212, 737-761 (1990)), в качестве контактных остатков. В более конкретном варианте осуществления эпитоп содержит одну или несколько аминокислот, выбранных из положений 18, 19, 42 и 45 в стволовом участке HA2, в качестве контактных остатков. В дополнительном варианте осуществления эпитоп содержит аминокислоты 18, 19, 42 и 45 в стволовом участке HA2 в качестве контактных остатков. В еще одном дополнительном варианте осуществления эпитоп содержит аминокислоты 18, 19 и 42 в стволовом участке HA2 в качестве контактных остатков.

Эпитоп или эпитопы, распознаваемые антителом или его связывающим фрагментом по настоящему изобретению, могут иметь множество путей применения. Например, эпитоп в очищенной или синтетической форме можно применять для усиления иммунных ответов (т.е. в качестве вакцины, или для выработки антител для других вариантов применения) или для скрининга сывороток на антитела, иммунореактивных в отношении эпитопа. В одном варианте осуществления эпитоп, распознаваемый антителом или его связывающим фрагментом по настоящему изобретению, или антиген, имеющий такой эпитоп, можно применять в качестве вакцины для усиления иммунного ответа. В другом варианте осуществления антитела и их связывающие фрагменты по настоящему изобретению можно применять для отслеживания качества вакцин, например, с помощью определения того, содержит ли антиген в вакцине надлежащий иммуногенный эпитоп в надлежащей конформации.

Вариабельные участки

Как используется в данном документе, выражение "исходное антитело" относится к антителу, которое кодируется аминокислотной последовательностью, применяемой для получения варианта или производного, определенных в данном документе. Исходный полипептид может содержать нативную последовательность антитела (т.е. встречающуюся в природе, в том числе встречающийся в природе аллельный вариант) или последовательность антитела с ранее существовавшими модификациями аминокислотной последовательности (такими как другие вставки, делеции и/или замены) во встречающейся в природе последовательности. Исходное антитело может быть гуманизированным антителом или человеческим антителом. В конкретных вариантах осуществления антитела по настоящему изобретению являются вариантами исходного антитела. Как используется в данном документе, выражение "вариант" относится к антителу, которое отличается по аминокислотной последовательности от аминокислотной последовательности "исходного" антитела вследствие добавления, делеции и/или замены одного или нескольких аминокислотных остатков в последовательности исходного антитела.

Антигенсвязывающая часть антитела содержит один или несколько фрагментов антитела, которые сохраняют способность специфично связываться с антигеном. Было показано, что антигенсвязывающая функция антитела может осуществляться с помощью фрагментов антитела полной длины. Примеры связывающих фрагментов, охватываемых выражением "антигенсвязывающая часть" антитела, включают (i) Fab-фрагмент, моновалентный фрагмент, состоящий из доменов VL, VH, CL и CH1; (ii) F(аb')2-фрагмент, бивалентный фрагмент, содержащий два Fab-фрагмента, связанных дисульфидным мостиком в шарнирном участке; (iii) Fd-фрагмент, состоящий из доменов VH и СН1; (iv) Fv-фрагмент, состоящий из доменов VL и VH одного плеча антитела, (v) dAb-фрагмент (Ward et al., (1989) Nature 341:544-546), который состоит из домена VH; и (vi) выделенный участок, определяющий комплементарность (CDR). Более того, несмотря на то, что два домена Fv-фрагмента, VL и VH, кодируются отдельными генами, их можно соединить с применением рекомбинантных способов с помощью синтетического линкера, который позволяет получить их в виде единой белковой цепи, в которой участки VL и VH соединяются попарно с образованием моновалентных молекул (известных как одноцепочечные Fv (scFv), см., например, Bird et al. (1988) Science 242:423-426 и Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Подразумевается, что такие одноцепочечные антитела также охвачены выражением "антигенсвязывающая часть" антитела. Такие фрагменты антител получают с помощью традиционных методик, известных специалистам в данной области, и фрагменты проверяют на пригодность таким же образом, как и интактные антитела. Антигенсвязывающие части можно получить с помощью методик рекомбинантной ДНК или с помощью ферментативного или химического расщепления интактных иммуноглобулинов.

Антитела по настоящему изобретению содержат по меньшей мере один антигенсвязывающий домен, содержащий домены VH и VL, описанные в данном документе.

В определенных вариантах осуществления очищенные антитела содержат VH и/или VL, который характеризуется определенным процентом идентичности по меньшей мере с одной из последовательностей VH и/или VL, раскрытых в таблице 1. Как используется в данном документе, выражение "процент (%) идентичности последовательности", также включающее "гомологию", определяется как процентная доля аминокислотных остатков или нуклеотидов в последовательности-кандидате, которые идентичны аминокислотным остаткам или нуклеотидам в эталонных последовательностях, таких как последовательность исходного антитела, после выравнивания последовательностей и введения гэпов, при необходимости, для достижения максимального процента идентичности последовательностей, и не учитывает какие-либо консервативные замены как часть идентичности последовательностей. Оптимальное выравнивание последовательностей для сравнения можно выполнить, кроме как ручным способом, с помощью алгоритма поиска локальной гомологии Смита-Уотермана, 1981, Ads App. Math. 2, 482, с помощью алгоритма поиска локальной гомологии Нидлмана-Вунша, 1970, J. Mol. Biol. 48, 443, с помощью способа поиска подобия Липмана-Пирсона, 1988, Proc. Natl Acad. Sci. USA 85, 2444, или с помощью компьютерных программ, в которых применяются эти алгоритмы (GAP, BESTFIT, FASTA, BLAST P, BLAST N и TFASTA в пакете программного обеспечения Wisconsin Genetics, Genetics Computer Group, 575 Science Drive, Мэдисон, Висконсин).

Антитела по настоящему изобретению могут содержать аминокислотную последовательность VH, по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или на 100% идентичную аминокислотным последовательностям VH, описанным в данном документе. Антитела могут иметь аминокислотную последовательность VH, по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или на 100% идентичную аминокислотной последовательности из аминокислотных последовательностей VH, описанных в данном документе.

Антитела по настоящему изобретению могут содержать аминокислотную последовательность VL, по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или на 100% идентичную аминокислотным последовательностям VL, описанным в данном документе. Антитела могут иметь аминокислотную последовательность VL, по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или на 100% идентичную аминокислотным последовательностям VL, описанным в данном документе.

Антитела в объеме настоящего изобретения способны к нейтрализации одного или нескольких подтипов группы 1 или одного или нескольких подтипов группы 2 вируса гриппа А, как описано в данном документе.

Участки, определяющие комплементарность (CDR)

Несмотря на то, что вариабельный домен (VH и VL) содержит антигенсвязывающий участок, вариабельность распределяется по вариабельным доменам антител неравномерно. Она сосредоточена в сегментах, называемых участками, определяющими комплементарность (CDR), в вариабельных доменах как легкой цепи (VL или VK), так и тяжелой цепи (VH). Более высококонсервативные части вариабельных доменов называются каркасными областями (FR). Каждый из вариабельных доменов нативной тяжелой и легкой цепей содержит четыре FR, по большей части принимающих конфигурацию β-листа, соединенных тремя CDR, которые образуют петли, объединяющие структуру β-листа и в некоторых случаях образующие ее часть. CDR в каждой цепи удерживаются в непосредственной близости друг с другом с помощью FR и вместе с CDR из другой цепи участвуют в образовании антигенсвязывающего участка антител (см. Kabat et al., выше). Три CDR тяжелой цепи обозначают CDR-H1, CDR-H2 и CDR-H3, а три CDR легкой цепи обозначают CDR-L1, CDR-L2 и CDR-L3. В данном документе применяется система нумерации по Kabat. Соответственно, CDR-H1 начинается примерно с аминокислоты 31 (т.е. примерно через 9 остатков от первого цистеинового остатка), содержит примерно 5-7 аминокислот и заканчивается на следующем тирозиновом остатке. CDR-H2 начинается с пятнадцатого остатка от конца CDR-H1, содержит примерно 16-19 аминокислот и заканчивается на следующем аргининовом или лизиновом остатке. CDR-H3 начинается примерно с тридцать третьего аминокислотного остатка от конца CDR-H2; содержит 3-25 аминокислот и заканчивается на последовательности W-G-X-G, где X представляет собой любую аминокислоту. CDR-L1 начинается примерно с остатка 24 (т.е. после цистеинового остатка), содержит примерно 10-17 остатков и заканчивается на следующем тирозиновом остатке. CDR-L2 начинается примерно с шестнадцатого остатка от конца CDR-L1 и содержит примерно 7 остатков. CDR-L3 начинается примерно с тридцать третьего остатка от конца CDR-L2, содержит примерно 7-11 остатков и заканчивается на последовательности F-G-X-G, где X представляет собой любую аминокислоту. Следует отметить, что CDR значительно изменяются от антитела к антителу (и по определению не будут проявлять гомологию с консенсусными последовательностями по Kabat).

Настоящее изобретение охватывает нейтрализующие антитела к вирусу гриппа A, связывающееся со "стволом" HA, содержащие аминокислоты в последовательности, которая фактически является такой же, как аминокислотная последовательность, описанная в данном документе. Аминокислотные последовательности, которые являются фактически такими же, как последовательности, описанные в данном документе, включают в себя последовательности, содержащие консервативные замены аминокислот, а также делеции и/или вставки аминокислот в аминокислотной последовательности, например, антитела 11, антитела 12, антитела 13, антитела 14 или антитела 15, или в аминокислотной последовательности, представленной под SEQ ID NO: 102, 112, 122, 132 или 142. Консервативная замена аминокислоты относится к замещению первой аминокислоты второй аминокислотой, которая имеет химические и/или физические свойства (например, заряд, структуру, полярность, гидрофобность/гидрофильность), аналогичные таковым первой аминокислоты. Консервативные замены включают замещение одной аминокислоты другой в пределах следующих групп: лизин (K), аргинин (R) и гистидин (H); аспартат (D) и глутамат (E); аспарагин (N), глутамин (Q), серин (S), треонин (T), тирозин (Y), K, R, H, D и E; аланин (A), валин (V), лейцин (L), изолейцин (I), пролин (P), фенилаланин (F), триптофан (W), метионин (M), цистеин (C) и глицин (G); F, W и Y; C, S и T.

Каркасные области

Каждый из вариабельных доменов тяжелой и легкой цепей содержит четыре каркасные области (FR1, FR2, FR3, FR4), которые являются более высококонсервативными частями вариабельных доменов. Четыре FR тяжелой цепи обозначают FR-H1, FR-H2, FR-H3 и FR-H4, а четыре FR легкой цепи обозначают FR-L1, FR-L2, FR-L3 и FR-L4. В данном документе используется система нумерации по Kabat, см. таблицу 1, Kabat et al, выше. Соответственно, FR-H1 начинается в положении 1 и заканчивается примерно на аминокислоте 30, FR-H2 расположен примерно от аминокислоты 36 до 49, FR-H3 расположен примерно от аминокислоты 66 до 94, и FR-H4 расположен примерно от аминокислоты 103 до 113. FR-L1 начинается с аминокислоты 1 и заканчивается примерно на аминокислоте 23, FR-L2 расположен примерно от аминокислоты 35 до 49, FR-L3 расположен примерно от аминокислоты 57 до 88, и FR-L4 расположен примерно от аминокислоты 98 до 107. В определенных вариантах осуществления каркасные области могут содержать замены в соответствии с системой нумерации по Kabat, например, вставку в 106A в FR-L1. Кроме встречающихся в природе замен, в антитело по настоящему изобретению также можно ввести одно или несколько изменений (например, замен) остатков FR, при условии, что оно сохранит нейтрализующую способность. В определенных вариантах осуществления они приводят к улучшению или оптимизации аффинности связывания антитела в отношении "ствола" HA вируса гриппа А. Примеры остатков каркасных областей, подлежащих модификации, включают таковые, которые непосредственно нековалентно связывают антиген (Amit et al., Science, 233:747-753 (1986)); взаимодействуют с CDR/влияют на его конформацию (Chothia et al., J. Mol. Biol., 196:901-917 (1987)) и/или участвуют в образовании области контакта VL-VH (патент США № 5225539).

В другом варианте осуществления FR может содержать одно или несколько аминокислотных изменений с целью "приведения в соответствие с зародышевым типом". Например, аминокислотные последовательности тяжелой и легкой цепей выбранного антитела сравнивают с аминокислотными последовательностями тяжелой и легкой цепей зародышевого типа, и в случаях, где определенные остатки каркасных областей выбранных VL и/или VH цепей отличаются от конфигурации зародышевого типа (например, в результате соматической мутации генов иммуноглобулина, применяемых для получения фаговой библиотеки), может быть желательно "подвергнуть обратной мутации" измененные остатки каркасных областей выбранных антител до конфигурации зародышевого типа (т.е. изменить аминокислотные последовательности каркасных областей выбранных антител так, чтобы они были такими же, как аминокислотные последовательности каркасных областей зародышевого типа). Такую "обратную мутацию" (или "приведение в соответствие с зародышевым типом") остатков каркасных областей можно осуществить с помощью стандартных способов молекулярной биологии для внедрения специфических мутаций (например, сайт-направленного мутагенеза; ПЦР-опосредованного мутагенеза и т.п.).

Нуклеотидные последовательности, кодирующие антитела по настоящему изобретению

Кроме аминокислотных последовательностей, описанных выше, настоящее изобретение дополнительно предусматривает нуклеотидные последовательности, соответствующие аминокислотным последовательностям и кодирующие человеческие антитела по настоящему изобретению. В одном варианте осуществления настоящее изобретение предусматривает полинуклеотиды, содержащие нуклеотидную последовательность, кодирующую антитело, описанное в данном документе, или его фрагменты. Они включают, без ограничения, нуклеотидные последовательности, которые кодируют упомянутые выше аминокислотные последовательности. Таким образом, настоящее изобретение также предусматривает нуклеотидные последовательности, кодирующие каркасные области VH и VL, в том числе CDR и FR антител, описанных в данном документе, а также векторы экспрессии для их эффективной экспрессии в клетках (например, клетках млекопитающих). Способы получения антител с применением полинуклеотидов более подробно описаны ниже.

Настоящее изобретение также охватывает полинуклеотиды, которые гибридизируются в жестких условиях или условиях низкой жесткости гибридизации, например, как определено в данном документе, с полинуклеотидами, кодирующими антитело по настоящему изобретению, описанное в данном документе. Выражение "жесткость", как используется в данном документе, относится к экспериментальным условиям (например, температуре и концентрации солей) эксперимента по гибридизации для обозначения степени гомологии между зондом и связанной на фильтре нуклеиновой кислотой; чем выше жесткость, тем выше процент гомологии между зондом и связанной на фильтре нуклеиновой кислотой.

Жесткие условия гибридизации включают, без ограничения, гибридизацию связанной на фильтре ДНК в 6X хлориде натрия/цитрате натрия (SSC) при приблизительно 45°C, за которой следует одна или несколько промывок в 0,2X SSC/0,1% SDS при приблизительно 50-65°C, условия высокой жесткости, такие как гибридизация связанной на фильтре ДНК в 6X SSC при приблизительно 45°C, за которой следует одна или несколько промывок в 0,1X SSC/0,2% SDS при приблизительно 65°C, или любые другие жесткие условия гибридизации, известные специалисту в данной области (см., например, Ausubel, F.M. et al., eds. 1989 Current Protocols in Molecular Biology, vol. 1, Green Publishing Associates, Inc. и John Wiley and Sons, Inc., NY, на страницах 6.3.1-6.3.6 и 2.10.3).

Фактически идентичные последовательности могут быть полиморфными последовательностями, т.е. альтернативными последовательностями или аллелями в популяции. Различие между аллелями может составлять до одной пары оснований. Фактически идентичные последовательности могут также содержать подвергнутые мутагенезу последовательности, в том числе последовательности, содержащие молчащие мутации. Мутация может включать изменения одного или нескольких остатков, делецию одного или нескольких остатков или вставку одного или нескольких дополнительных остатков.

С помощью любого способа, известного из уровня техники, можно получить полинуклеотиды и можно определить нуклеотидную последовательность полинуклеотидов. Например, если известна нуклеотидная последовательность для антитела, полинуклеотид, кодирующий антитело, можно собрать из химически синтезированных олигонуклеотидов (например, как описано в Kutmeier et al., BioTechniques 17:242 (1994)), что, вкратце, включает синтез перекрывающихся олигонуклеотидов, содержащих части последовательности, кодирующей антитело, отжиг и лигирование этих олигонуклеотидов и затем амплификацию лигированных олигонуклеотидов с помощью ПЦР.

Полинуклеотид, кодирующий антитело, можно также получить из нуклеиновой кислоты из подходящего источника. Если клон, содержащий нуклеиновую кислоту, кодирующую конкретное антитело, недоступен, а последовательность молекулы антитела известна, нуклеиновую кислоту, кодирующую иммуноглобулин, можно химически синтезировать или получить из подходящего источника (например, библиотеки кДНК антител, или библиотеки кДНК, полученной из, или нуклеиновой кислоты, предпочтительно поли(A)+ РНК, выделенной из любой ткани или клеток, экспрессирующих антитело, таких как клетки гибридомы, выбранные для экспрессии антитела) с помощью ПЦР-амплификации с применением синтетических праймеров, гибридизируемых с 3'- и 5'-концами последовательности, или с помощью клонирования с применением олигонуклеотидного зонда, специфичного в отношении конкретной последовательности гена, подлежащей идентификации, например, клона кДНК из библиотеки кДНК, кодирующего антитело. Амплифицированные нуклеиновые кислоты, полученные с помощью ПЦР, можно затем клонировать в реплицируемые клонирующие векторы с помощью любого способа, хорошо известного из уровня техники.

Когда нуклеотидная последовательность и соответствующая аминокислотная последовательность антитела определены, с этой нуклеотидной последовательностью для антитела можно производить манипуляции с помощью хорошо известных из уровня техники способов манипуляции с нуклеотидными последовательностями, например, методик рекомбинантных ДНК, сайт-направленного мутагенеза, ПЦР и т.д. (см., например, методики, описанные в Sambrook et al., 1990, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. и Ausubel et al., eds., 1998, Current Protocols in Molecular Biology, John Wiley & Sons, NY) с образованием антител, имеющих отличающуюся аминокислотную последовательность, например, чтобы произвести замены, делеции и/или вставки аминокислот.

Характеристики связывания

Как описано выше, антитела к вирусу гриппа A, связывающееся со "стволом" HA, по настоящему изобретению иммуноспецифично связывают по меньшей мере один определенный эпитоп или антигенные детерминанты белка, пептида, субъединицы, фрагмента, части "ствола" HA вируса гриппа А или любой их комбинации исключительно или преимущественно по отношению к другим полипептидам. Выражение "эпитоп" или "антигенная детерминанта", как используется в данном документе, относится к белковой детерминанте, способной связываться с антителом, где выражение "связывание" в данном документе предпочтительно относится к специфическому связыванию. Эти белковые детерминанты или эпитопы обычно состоят из химически активных поверхностных групп молекул, таких как аминокислоты или боковые цепи сахаров, и обычно обладают специфическими характеристиками трехмерной структуры, а также специфическими характеристиками заряда. Конформационные и неконформационные эпитопы отличаются тем, что связывание с первыми, но не с последними утрачивается в присутствии денатурирующих растворителей. Выражение "прерывистый эпитоп", как используется в данном документе, относится к конформационному эпитопу на белковом антигене, который образован по меньшей мере из двух разделенных участков в первичной последовательности белка.

Взаимодействия между антигенами и антителами являются такими же, как и другие нековалентные белок-белковые взаимодействия. В целом, между антигенами и антителами существуют четыре типа связывающих взаимодействий: (i) водородные связи, (ii) дисперсионные силы, (iii) электростатические силы между кислотами Льюиса и основаниями Льюиса и (iv) гидрофобные взаимодействия. Гидрофобные взаимодействия являются основной движущей силой для взаимодействия антитела и антигена и основаны на отталкивании воды неполярными группами, а не на притяжении молекул (Tanford, 1978). Однако, определенные физические силы также способствуют связыванию антигена и антитела, например, совместимость или комплементарность форм эпитопов и различных связывающих участков антител. Кроме того, другие материалы и антигены могут перекрестно реагировать с антителом, конкурируя, таким образом, за доступное свободное антитело.

Измерение константы аффинности и специфичности связывания между антигеном и антителом часто является основным элементом при определении эффективности профилактических, терапевтических, диагностических и исследовательских способов, в которых применяются антитела по настоящему изобретению. "Аффинность связывания" в целом относится к силе суммы всех нековалентных взаимодействий между одним связывающим участком молекулы (например, антитела) и его партнером по связыванию (например, антигеном). Если не указано иное, как используется в данном документе, "аффинность связывания" относится к присущей аффинности связывания, которая отражает взаимодействие 1:1 между членами связывающейся пары (например, антителом и антигеном). Аффинность молекулы X к ее партнеру Y в целом можно представить равновесной константой диссоциации (Kd), которую рассчитывают в виде соотношения koff/kon. См., например, Chen, Y., et al., (1999) J. Mol Biol 293:865-881. Аффинность можно измерить с помощью общеизвестных способов из уровня техники, в том числе описанных и проиллюстрированных в данном документе. Пример коммерчески доступной системы для получения кинетических характеристик включает семейство приборов OCTET®. Антитела с низкой аффинностью, как правило, связывают антиген медленно и проявляют тенденцию к легкой диссоциации, тогда как антитела с высокой аффинностью, как правило, связывают антиген быстрее и проявляют тенденцию к тому, чтобы оставаться связанными дольше. Из уровня техники известен ряд способов измерения аффинности связывания, любой из которых можно применять для целей настоящего изобретения.

Определение аффинности связывания можно измерить с использованием конкретных методик, описанных дополнительно в разделе "Примеры", и способов, хорошо известных из уровня техники. Один такой способ включает измерение константы диссоциации "Kd" с помощью анализа связывания меченного радиоактивным изотопом антигена (RIA), проводимого с Fab-вариантом антитела, представляющего интерес, и его антигеном, как описано в следующем анализе, в котором измеряют аффинность связывания Fab в растворе в отношении антигена путем уравновешивания Fab минимальной концентрацией (125I)-меченного антигена при наличии серии титрований немеченого антигена с последующим захватом связанного антигена на планшете, покрытом антителом к Fab (Chen, et al., (1999) J. Mol Biol 293:865-881). Чтобы установить условия для анализа, титрационные микропланшеты (Dynex) покрывают в течение ночи 5 мкг/мл захватывающего антитела к Fab (Cappel Labs) в 50 мМ карбонате натрия (pH 9,6) и затем блокируют 2% (вес/объем) бычьим сывороточным альбумином в PBS в течение двух-пяти часов при комнатной температуре (примерно 23°C). В планшете без адсорбента (Nunc № 269620), 100 пM или 26 пM [125I]-меченного антигена смешивают с серийными разведениями Fab, представляющего интерес (например, в соответствии с оценкой антитела к VEGF, Fab-12, в Presta et al., (1997) Cancer Res. 57:4593-4599). Представляющий интерес Fab затем инкубируют в течение ночи; однако, инкубирование можно продолжать в течение более длительного периода (например, 65 часов) для того, чтобы гарантировать достижение равновесия. После этого смеси переносят в планшет для захвата для инкубирования при комнатной температуре (например, в течение одного часа). Затем раствор удаляют, и планшет промывают восемь раз с помощью 0,1% Tween-20 в PBS. После высушивания планшетов добавляют 150 мкл/лунка сцинтиллятора (MicroScint-20; Packard), и в планшетах производят подсчет на счетчике гамма-излучения Topcount (Packard) в течение десяти минут. Концентрации каждого Fab, которые дают связывание, меньшее или равное 20% от максимального связывания, отбирают для применения в анализах конкурентного связывания.

В другом случае значение Kd можно измерить с помощью анализов поверхностного плазмонного резонанса с применением BIAcore™-2000 или BIAcore™-3000 (BIAcore, Inc., Пискатауэй, Нью-Джерси) при 25°C с чипами CM5 с иммобилизованным антигеном при ˜10 единицах ответа (RU). Вкратце, биосенсорные чипы на основе карбоксиметилированного декстрана (CM5, BIAcore Inc.) активируют гидрохлоридом N-этил-N′-(3-диметиламинопропил)-карбодиимида (EDC) и N-гидроксисукцинимидом (NHS) согласно инструкциям поставщика. Антиген разводят 110 мМ ацетатом натрия, pH 4,8 до 5 мкг/мл (˜0,2 мкМ) перед вводом со скоростью потока 5 мкл/минута для получения примерно 10 единиц ответа (RU) для связанного белка. После ввода антигена вводят 1M этаноламин для блокирования непрореагировавших групп. Для кинетических измерений двукратные серийные разведения Fab (от 0,78 нМ до 500 нМ) вводят в PBS с 0,05% Tween 20 (PBST) при 25°C со скоростью потока примерно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) рассчитывают с использованием простой ленгмюровской модели связывания в соотношении один к одному (программное обеспечение для оценки BIAcore Evaluation Software, версия 3.2) путем одновременной подгонки сенсограмм ассоциации и диссоциации.

Если скорость прямой реакции превышает 106M−1 с−1 на основании указанного выше анализа поверхностного плазмонного резонанса, то скорость прямой реакции можно определить путем применения методики гашения флуоресценции, в которой измеряют повышение или понижение интенсивности излучения флуоресценции (возбуждение=295 нм; излучение=340 нм, полоса пропускания 16 нм) при 25°C 20 нМ антитела к антигену (Fab-форма) в PBS, pH 7,2, в присутствии возрастающих концентраций антигена, что измеряют на спектрометре, таком как оборудованный устройством для остановки потока спектрофотометр (Aviv Instruments) или спектрофотометр SLM-Aminco серии 8000 (ThermoSpectronic) с кюветой с перемешиванием. "Скорость прямой реакции", или "скорость ассоциации", или "kon" в соответствии с настоящим изобретением можно также определить с помощью той же методики поверхностного плазмонного резонанса, описанной выше, с применением BIAcore™-2000 или BIAcore™-3000 (BIAcore, Inc., Пискатауэй, Нью-Джерси), как описано выше.

Способы и реактивы, подходящие для определения характеристик связывания антитела по настоящему изобретению или его измененного/мутантного производного (обсуждаемого ниже), известны из уровня техники и/или коммерчески доступны (патенты США №№ 6849425; 6632926; 6294391; 6143574). Кроме того, коммерчески доступно оборудование и программное обеспечение, предназначенное для таких кинетических анализов (например, приборы Biacore® A100 и Biacore® 2000; Biacore International AB, Уппсала, Швеция).

В одном варианте осуществления антитела по настоящему изобретению, в том числе их связывающие фрагменты или варианты, также могут быть описаны или определены с точки зрения их аффинности связывания с полипептидами вируса гриппа A. Обычно антитела с высокой аффинностью имеют Kd менее 10-7 M. В одном варианте осуществления антитела или их связывающие фрагменты связывают полипептиды вируса гриппа A или их фрагменты или варианты с константой диссоциации Kd, меньшей или равной 5×10−7M, 10−7M, 5×10−8M, 10−8M, 5×10−9M, 10−9M, 5×10−10M, 10−10M, 5×10−11M, 10−11M, 5×10−12M, 10−12M, 5×10−13M, 10−13M, 5×10−14M, 10−14M, 5×10−15M или 10−15 M. Полипептиды вируса гриппа A могут включать в себя полипептиды HA. В более конкретном варианте осуществления антитела или их связывающие фрагменты связывают полипептиды вируса гриппа A или их фрагменты или варианты с константой диссоциации Kd, меньшей или равной 5×10−10M, 10−10M, 5×10−11M, 10−11M, 5×10−12M или 10−12M. Настоящее изобретение охватывает антитела, которые связывают полипептиды вируса гриппа A с константой диссоциации или Kd, которая находится в диапазоне между любыми из отдельных упомянутых значений.

В другом варианте осуществления антитела или их связывающие фрагменты по настоящему изобретению связывают полипептиды вируса гриппа A или их фрагменты или варианты со скоростью диссоциации (koff), меньшей или равной 5×10−2 с−1, 10−2 с−1, 5×10−3 с−1 или 10−3 с−1, 5×10−4 с−1, 10−4 с−1, 5×10−5 с−1 или 10−5 с−1, 5×10−6 с−1, 10−6 с−1, 5×10−7 с−1 или 10−7 с−1. В более конкретном варианте осуществления антитела или их связывающие фрагменты по настоящему изобретению связывают полипептиды вируса гриппа А или их фрагменты или варианты со скоростью диссоциации (koff), меньшей или равной 5×10-4 с-1, 10-4 с-1, 5×10-5 с-1 или 10-5 с-1, 5×10-6 с-1, 10-6 с-1, 5×10-7 с-1 или 10-7 с-1. Настоящее изобретение также охватывает антитела, которые связывают полипептиды вируса гриппа A со скоростью диссоциации (koff), которая находится в диапазоне между любыми из отдельных упомянутых значений.

В другом варианте осуществления антитела или их связывающие фрагменты по настоящему изобретению связывают полипептиды вируса гриппа A или их фрагменты или варианты со скоростью прямой реакции (kon), большей или равной 103 M−1 с−1, 5×103 M−1 с−1, 104 M−1 с−1, 5×104 M−1 с−1, 105 M−1 с−1, 5×105 M−1 с−1, 106 M−1 с-1, 5×106 M−1 с−1, 107 M−1 с-1 или 5×107 M−1 с−1. В более конкретном варианте осуществления антитела или их связывающие фрагменты по настоящему изобретению связывают полипептиды вируса гриппа A или их фрагменты или варианты со скоростью прямой реакции (kon), большей или равной 105 M−1 с−1, 5×105 M−1 с−1, 106 M−1 с−1, 5×106 M−1 с−1, 107 M−1 с−1 или 5×107 M−1 с−1. Настоящее изобретение охватывает антитела, которые связывают полипептиды вируса гриппа A со скоростью прямой реакции (kon), которая находится в диапазоне между любыми из отдельных упомянутых значений.

В одном варианте осуществления анализ связывания можно проводить в виде анализов прямого связывания или в виде анализов конкурентного связывания. Связывание можно выявить с применением стандартных анализов ELISA или стандартных анализов по методу проточной цитометрии. В анализе прямого связывания антитело-кандидат исследуют в отношении связывания с его когнатным антигеном. В анализе конкурентного связывания, с другой стороны, оценивают способность антитела-кандидата конкурировать с известным антителом или другим соединением, которое связывается со "стволом" HA вируса гриппа А. В целом, любой способ, который позволяет выявить связывание антитела со "стволом" HA вируса гриппа А, включен в объем настоящего изобретения для выявления и измерения характеристик связывания антител. Специалисту в данной области понятны эти хорошо известные способы, и по этой причине они не представлены подробно в данном документе. Эти способы также используются для скрининга панели антител с выявлением обеспечивающих желаемые характеристики.

Антитело по настоящему изобретению иммуноспецифично связывается со стволом HA вируса гриппа A и способно к нейтрализации инфекции, вызванной вирусом гриппа А. Анализы нейтрализации можно проводить, как описано в данном документе в разделе "Примеры", или с помощью других способов, известных из уровня техники. Выражение "50% ингибирующая концентрация" (сокращенно "IC50") представляет концентрацию ингибитора (например, антитела по настоящему изобретению), которая требуется для 50% нейтрализации вируса гриппа A. Специалисту в данной области будет понятно, что более низкое значение IC50 соответствует более эффективному ингибитору.

В одном варианте осуществления антитело или его связывающий фрагмент в соответствии с настоящим изобретением обладают эффективностью нейтрализации, выраженной в виде 50% ингибирующей концентрации (IC50, мкг/мл), в диапазоне от приблизительно 0,01 мкг/мл до приблизительно 50 мкг/мл, или в диапазоне от приблизительно 0,01 мкг/мл до приблизительно 5 мкг/мл антитела, или в диапазоне от приблизительно 0,01 мкг/мл до приблизительно 0,1 мкг/мл антитела для нейтрализации вируса гриппа A в анализе микронейтрализации. Наибольшая концентрация антитела, применяемая в анализе микронейтрализации, описанном в данном документе, составляла 50 мкг/мл. Высокая эффективность антител по настоящему изобретению означает, что для достижения 50% нейтрализации вируса гриппа A можно применять более низкие концентрации антитела.

В определенных вариантах осуществления антитела по настоящему изобретению могут индуцировать гибель клеток. Антитело, которое "индуцирует гибель клеток", приводит к тому, что жизнеспособная клетка становится нежизнеспособной. Гибель клеток in vitro может быть определена в отсутствие системы комплемента и иммунных эффекторных клеток, чтобы различить гибель клеток, индуцированную антителозависимой клеточноопосредованной цитотоксичностью (ADCC) или комплементзависимой цитотоксичностью (CDC). Таким образом, анализ гибели клеток можно выполнить с применением термоинактивированной сыворотки (т.е. в отсутствие системы комплемента) и в отсутствие иммунных эффекторных клеток. Чтобы определить, способно ли антитело индуцировать гибель клеток, можно оценить потерю целостности мембран, определяемую с помощью поглощения йодида пропидия (PI), трипанового синего (см. Moore et al. Cytotechnology 17:1-11 (1995)), 7AAD или других способов, хорошо известных из уровня техники, в сравнении с необработанными клетками.

В конкретных вариантах осуществления антитела по настоящему изобретению могут индуцировать гибель клеток путем апоптоза. Антитело, которое "индуцирует апоптоз", индуцирует программируемую гибель клеток, определяемую по связыванию аннексина V, фрагментации ДНК, сжатию клеток, расширению эндоплазматического ретикулума, фрагментации клеток и/или образованию мембранных пузырьков (называемых апоптозными тельцами). Для оценки клеточных событий, связанных с апоптозом, доступны различные способы. Например, транслокацию фосфатидилсерина (PS) можно измерить по связыванию аннексина; фрагментацию ДНК можно оценить с помощью электрофоретической картины расщепления ДНК; и конденсацию ядерного хроматина наряду с фрагментацией ДНК можно оценить по какому-либо увеличению количества гиподиплоидных клеток. Предпочтительно, антитело, которое индуцирует апоптоз, приводит к приблизительно 2-50-кратной, предпочтительно приблизительно 5-50-кратной и наиболее предпочтительно приблизительно 10-50-кратной индукции связывания аннексина по сравнению с необработанной клеткой в анализе связывания аннексина.

В другом конкретном варианте осуществления антитела по настоящему изобретению могут индуцировать гибель клеток посредством антителозависимой клеточной цитотоксичности (ADCC), и/или комплементзависимой клеточноопосредованной цитотоксичности (CDC), и/или антителозависимого клеточноопосредованного фагоцитоза (ADCP). Проявление ADCC-активности и CDC-активности человеческих антител подкласса IgG1, как правило, включает связывание Fc-участка антитела с рецептором для антитела (далее в данном документе называемого "FcγR"), присутствующим на поверхности эффекторных клеток, таких как клетки-киллеры, естественные клетки-киллеры или активированные макрофаги. Могут быть связанными различные компоненты системы комплемента. В отношении связывания было высказано предположение, что важными являются несколько аминокислотных остатков в шарнирном участке и втором домене C-участка (далее называемом "Cγ2-доменом") антитела (Eur. J. Immunol., 23, 1098 (1993), Immunology, 86, 319 (1995), Chemical Immunology, 65, 88 (1997)) и что важной также является сахарная цепь в Cγ2-домене (Chemical Immunology, 65, 88 (1997)).

Для оценки ADCC-активности антитела, представляющего интерес, можно использовать анализ ADCC in vitro, такой как описанный в патенте США № 5500362. Анализ также можно проводить с применением коммерчески доступного набора, например, CytoTox 96 ® (Promega). Подходящие эффекторные клетки для таких анализов включают, без ограничения, мононуклеарные клетки периферической крови (PBMC), естественные клетки-киллеры (NK) и линии клеток NK. Линии клеток NK, экспрессирующие трансгенный Fc-рецептор (например, CD16) и соответствующий сигнальный полипептид (например, FCεRI-γ), могут также выполнять роль эффекторных клеток (WO 2006/023148). Например, можно определить способность любого конкретного антитела опосредовать лизис с помощью активации системы комплемента и/или ADCC. Клетки, представляющие интерес, выращивают и метят in vitro; антитело добавляют к культуре клеток в комбинации с иммунными клетками, которые могут быть активированы комплексами антиген-антитело, т.е., эффекторными клетками, участвующими в ADCC-ответе. Антитело также можно исследовать в отношении активации системы комплемента. В любом случае цитолиз выявляют по высвобождению метки из лизированных клеток. Степень лизиса клеток может быть также определена путем выявления высвобождения цитоплазматических белков (например, LDH) в надосадочную жидкость. Фактически, антитела можно подвергать скринингу с применением собственной сыворотки пациента в качестве источника системы комплемента и/или иммунных клеток. Антитела, которые способны опосредовать ADCC у человека в тесте in vitro, затем можно применять с терапевтической целью у этого конкретного пациента. Может быть также проведена оценка ADCC-активности молекулы, представляющей интерес, in vivo, например, в животной модели, такой как раскрытая в Clynes et al., Proc. Natl. Acad. Sci. (USA) 95:652-656 (1998). Кроме того, методики для модулирования (т.е. увеличения или уменьшения) уровня ADCC, и, необязательно, CDC-активности антитела хорошо известны из уровня техники (например, патенты США №№ 5624821; 6194551; 7317091). Антитела по настоящему изобретению могут быть способны или могли быть модифицированы с получением способности к индукции ADCC и/или CDC. Анализы для определения ADCC-функции можно выполнять с применением человеческих эффекторных клеток для оценки ADCC-функции у человека. Такие анализы могут также включать те, которые направлены на скрининг антител, которые индуцируют, опосредуют, усиливают, блокируют гибель клеток с помощью механизмов некроза и/или апоптоза. Такие способы, включающие анализы, в которых используются прижизненные красители, способы выявления и анализа каспаз, а также анализы, в которых измеряют разрывы ДНК, можно применять для оценки апоптотической активности клеток, культивируемых in vitro с антителом, представляющим интерес.

Получение антител

Далее описаны иллюстративные методики получения антител, пригодных в настоящем изобретении.

Моноклональные антитела

Моноклональные антитела можно получать при помощи широкого разнообразия методик, известных из уровня техники, включающих применение гибридомной (Kohler et al., Nature, 256:495 (1975); Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al., в Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981), рекомбинантной методик и методики фагового дисплея или их комбинации. Выражение "моноклональное антитело", как используется в данном документе, относится к антителу, получаемому из популяции фактически однородных или выделенных антител, например, отдельные антитела, составляющие популяцию, являются идентичными, за исключением возможных встречающихся в природе мутаций, которые могут присутствовать в незначительных количествах. Моноклональные антитела являются высокоспецифичными, будучи направленными на один антигенный участок. Более того, в отличие от препаратов поликлональных антител, которые включают разные антитела, направленные на разные детерминанты (эпитопы), каждое моноклональное антитело направлено на одну и ту же детерминанту на антигене. Кроме своей специфичности, моноклональные антитела являются преимущественными в том, что их можно синтезировать незагрязненными другими антителами. Модификатор "моноклональное" не следует понимать как требующий получения антитела каким-либо конкретным способом. Далее следует описание иллюстративных способов получения моноклональных антител, которое не предназначено быть ограничивающим и может быть использовано для получения, например, моноклональных антител млекопитающих, химерных, гуманизированных, человеческих, доменных антител, диател, вакцинных антител, линейных и полиспецифических антител.

Гибридомные методики

Способы получения и скрининга в отношении специфических антител с использованием гибридомной технологии являются обычными и хорошо известными из уровня техники. В гибридомном способе мышей или других подходящих животных-хозяев, таких как хомяк, иммунизируют, как описано выше, чтобы получить лимфоциты, которые вырабатывают или способны вырабатывать антитела, которые будут специфично связываться с антигеном, применяемым для иммунизации. Альтернативно, лимфоциты можно иммунизировать in vitro. После иммунизации лимфоциты выделяют и затем сливают с линией миеломных клеток с применением подходящего фактора, вызывающего слияние клеток, или партнера по слиянию, такого как полиэтиленгликоль, с образованием клетки гибридомы (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)). В определенных вариантах осуществления выбранные миеломные клетки сливаются эффективно, поддерживают стабильный высокий уровень выработки антитела выбранными антителообразующими клетками и являются чувствительными к селективной среде, с помощью которой проводят отбор, направленный против неслившихся исходных клеток. В одном аспекте линиями миеломных клеток являются мышиные миеломные линии, как, например, происходящие от мышиных опухолей MOPC-21 и MPC-11, доступные от Центра распределения клеток при Институте Солка, Сан-Диего, Калифорния, США, а также SP-2 и происходящие от нее линии, например, клетки X63-Ag8-653, доступные от Американской коллекции типовых культур, Роквилл, Мэриленд, США. Человеческие миеломные и мышиные/человеческие гетеромиеломные линии клеток также были описаны в отношении выработки человеческих моноклональных антител (Kozbor, J. Immunol., 133:3001 (1984); и Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp.51-63 (Marcel Dekker, Inc., New York, 1987)).

Непосредственно после идентификации клеток гибридомы, которые вырабатывают антитела с желаемой специфичностью, аффинностью и/или активностью, клоны можно пересевать с помощью процедур предельного разведения и выращивать с помощью стандартных способов (Goding, выше). Подходящие культуральные среды для этой цели включают, например, среду D-MEM или RPMI-1640. Кроме того, клетки гибридомы можно выращивать in vivo в виде асцитных опухолей у животных, например, путем i.p. инъекции клеток мышам.

Моноклональные антитела, секретируемые очередным пассажем, подходящим образом отделяют от культуральной среды, асцитической жидкости или сыворотки с помощью стандартных процедур очистки антител, таких как, например, аффинная хроматография (например, с применением белка A или белка G-сефарозы) или ионообменная хроматография, аффинное мечение, хроматография на гидроксиапатите, гель-электрофорез, диализ и т.д. Иллюстративные способы очистки более подробно описаны ниже.

Методики рекомбинантных ДНК

Способы получения и скрининга в отношении специфических антител с применением технологии рекомбинантных ДНК являются обычными и хорошо известными из уровня техники (например, патент США № 4816567). ДНК, кодирующую моноклональные антитела, можно легко выделить и/или секвенировать с применением стандартных процедур (например, путем применения олигонуклеотидных зондов, которые способны к специфическому связыванию с генами, кодирующими тяжелую и легкую цепи мышиных антител). Непосредственно после выделения ДНК можно поместить в векторы экспрессии, которые затем трансфицируют в клетки-хозяева, такие как клетки E. coli, клетки COS обезьяны, клетки яичника китайского хомячка (CHO) или миеломные клетки, которые в других случаях не вырабатывают белковое антитело, для достижения синтеза моноклональных антител в рекомбинантных клетках-хозяевах. Обзорные статьи по рекомбинантной экспрессии у бактерий ДНК, кодирующей антитело, включают Skerra et al., Curr. Opinion in Immunol., 5:256-262 (1993) и Pluckthun, Immunol. Revs., 130:151-188 (1992). Как описано ниже для антител, получаемых с помощью фагового дисплея и гуманизации антител, ДНК или генетический материал для рекомбинантных антител можно получить из отличного(отличных) от гибридом источника(источников) с тем, чтобы получить антитела по настоящему изобретению.

Рекомбинантная экспрессия антитела или его варианта, как правило, требует конструирования вектора экспрессии, содержащего полинуклеотид, который кодирует антитело. Настоящее изобретение, таким образом, предусматривает реплицируемые векторы, содержащие нуклеотидную последовательность, кодирующую молекулу антитела, тяжелую или легкую цепь антитела, вариабельный домен тяжелой цепи или легкой цепи антитела или его часть или CDR тяжелой или легкой цепи, функционально связанную с промотором. Такие векторы могут содержать нуклеотидную последовательность, кодирующую константный участок молекулы антитела (см., например, патенты США №№ 5981216; 5591639; 5658759 и 5122464), а вариабельный домен антитела можно клонировать в такой вектор для экспрессии полной тяжелой, полной легкой цепи или полных как тяжелой, так и легкой цепей.

Непосредственно после переноса вектора экспрессии в клетку-хозяина с помощью традиционных методик трансфицированные клетки затем культивируют с помощью традиционных методик с получением антитела. Таким образом, настоящее изобретение включает клетки-хозяева, содержащие полинуклеотид, кодирующий антитело по настоящему изобретению или его фрагменты, или его тяжелую или легкую цепи или их часть, или одноцепочечное антитело по настоящему изобретению, функционально связанный с гетерологичным промотором. В определенных вариантах осуществления для экспрессии антител с двумя цепями векторы, кодирующие как тяжелую, так и легкую цепи, можно совместно экспрессировать в клетке-хозяине для экспрессии целой молекулы иммуноглобулина, как подробно описано ниже.

Линии клеток млекопитающих, доступные в качестве хозяев для экспрессии рекомбинантных антител, хорошо известны из уровня техники и включают многие иммортализованные линии клеток, доступные от Американской коллекции типовых культур (ATCC), в том числе, без ограничения, клетки яичника китайского хомячка (CHO), клетки HeLa, клетки почки новорожденного хомячка (BHK), клетки почки обезьяны (COS), клетки гепатоцеллюлярной карциномы человека (например, Hep G2), клетки почечного эпителия человека 293 и ряд других линий клеток. Разные клетки-хозяева имеют характерные и конкретные механизмы посттрансляционного процессинга и модификации белков и продуктов генов. Подходящие линии клеток или системы-хозяева можно выбрать для того, чтобы обеспечить правильную модификацию и процессинг экспрессируемого антитела или его части. В связи с этим можно применять эукариотические клетки-хозяева, которые обладают клеточным аппаратом для надлежащего процессинга первичного транскрипта, гликозилирования и фосфорилирования продукта гена. Такие клетки-хозяева млекопитающих включают, без ограничения, клетки CHO, VERY, BHK, HeLa, COS, MDCK, 293, 3T3, W138, BT483, Hs578T, HTB2, BT2O и T47D, NS0 (линия клеток мышиной миеломы, которая не вырабатывает эндогенно каких-либо функциональных цепей иммуноглобулинов), SP20, CRL7O3O и HsS78Bst. Линии клеток человека, разработанные путем иммортализации человеческих лимфоцитов, можно применять для рекомбинантного получения моноклональных антител. Линию клеток человека PER.C6. (Crucell, Нидерланды) можно применять для рекомбинантного получения моноклональных антител.

Дополнительные линии клеток, которые можно применять в качестве хозяев для экспрессии рекомбинантных антител, включают, без ограничения, клетки насекомых (например, Sf21/Sf9, Bti-Tn5b1-4 Trichoplusia ni) или клетки дрожжей (например, S. cerevisiae, Pichia, US7326681 и т.д.), растительные клетки (US20080066200) и куриные клетки (WO2008142124).

В определенных вариантах осуществления антитела по настоящему изобретению экспрессируются в линии клеток со стабильной экспрессией антитела. Стабильную экспрессию можно применять для длительного высокопродуктивного получения рекомбинантных белков. Например, можно создать линии клеток, стабильно экспрессирующих молекулу антитела. Клетки-хозяева можно трансформировать подходящим образом сконструированным вектором, содержащим элементы контроля экспрессии (например, промотор, энхансер, терминаторы транскрипции, сайты полиаденилирования и т.д.) и ген селектируемого маркера. После внедрения чужеродной ДНК клеткам можно позволить расти в течение 1-2 суток на обогащенной среде, и затем их переводят на селективную среду. Селектируемый маркер в рекомбинантной плазмиде придает устойчивость к отбору и позволяет клеткам со стабильно интегрированной плазмидой в их хромосомах расти и образовывать фокусы, которые, в свою очередь, можно клонировать и наращивать с получением линий клеток. Способы получения стабильных линий клеток с высокой продуктивностью хорошо известны из уровня техники, и реактивы, как правило, являются коммерчески доступными.

В определенных вариантах осуществления антитела по настоящему изобретению экспрессируются в линии клеток с транзиентной экспрессией антитела. Транзиентная трансфекция представляет собой процесс, при котором нуклеиновая кислота, внедряемая в клетку, не интегрируется в геномную или хромосомную ДНК такой клетки. Она фактически сохраняется в виде внехромосомного элемента, например, в виде эписомы, в клетке. Процессы транскрипции нуклеиновой кислоты эписомы не затрагиваются, и вырабатывается белок, кодируемый нуклеиновой кислотой эписомы.

Линию клеток, подвергнутую стабильной или транзиентной трансфекции, поддерживают в среде для культивирования клеток и условиях, хорошо известных из уровня техники, что приводит к экспрессии и выработке моноклональных антител. В определенных вариантах осуществления в основе среды для культивирования клеток млекопитающих лежат коммерчески доступные составы сред, в том числе, например, DMEM или среды Хэма F12. В других вариантах осуществления среду для культивирования клеток модифицируют для поддержки как роста клеток, так и биологической экспрессии белка. Как используется в данном документе, выражения "среда для культивирования клеток", "культуральная среда" и "состав среды" относятся к питательному раствору для поддержания, роста, размножения или наращивания клеток в искусственном окружении in vitro вне многоклеточного организма или ткани. Среду для культивирования клеток можно оптимизировать для применения в конкретной культуре клеток, в том числе, например, ростовую среду для культивирования клеток, которая составлена для стимуляции клеточного роста, или продуктивную среду для культивирования клеток, которая составлена для стимуляции выработки рекомбинантного белка. Выражения "питательное вещество", "ингредиент" и "компонент", используемые в данном документе взаимозаменяемо, относятся к составляющим, которые образуют среду для культивирования клеток.

В одном варианте осуществления линии клеток поддерживают с применением способа периодического культивирования с подпиткой. Как используется в данном документе, "способ периодического культивирования с подпиткой" относится к способу, при котором подпитываемую культуру клеток дополняют дополнительными питательными веществами после первоначального инкубирования с базовой средой. Например, способ периодического культивирования с подпиткой может включать добавление среды с добавками в соответствии с определенным питательным режимом в течение определенного периода времени. Таким образом, "подпитываемая культура клеток" относится к культуре клеток, где в сосуд для культивирования изначально добавляют клетки, обычно млекопитающего, и культуральную среду, и дополнительные питательные вещества для культуры подаются непрерывно или пошагово в культуру во время культивирования с периодическим сбором или без периодического сбора клеток и/или продукта до завершения культивирования.

Применяемая среда для культивирования клеток и питательные вещества, содержащиеся в ней, известны специалисту в данной области. В одном варианте осуществления среда для культивирования клеток содержит базовую среду и по меньшей мере один гидролизат, например, гидролизат на основе сои, гидролизат на основе дрожжей или комбинацию двух типов гидролизатов, дающую в результате модифицированную базовую среду. В другом варианте осуществления дополнительные питательные вещества могут включать только базовую среду, такую как концентрированная базовая среда, или могут включать только гидролизаты или концентрированные гидролизаты. Подходящие базовые среды включают, без ограничения, среду Игла в модификации Дульбекко (DMEM), DME/F12, минимальную питательную среду (MEM), базовую среду Игла (BME), RPMI 1640, F-10, F-12, минимальную питательную среду α (α-MEM), минимальную питательную среду Глазго (G-MEM), PF CHO (см., например, не содержащую белков среду для CHO (Sigma) или не содержащую белков бессывороточную среду для клеток CHO EX-CELL™ 325 PF CHO (SAFC Bioscience)) и среду Дульбекко в модификации Искова. Другие примеры базовых сред, которые можно применять в настоящем изобретении, включают базовую среду BME (Gibco-Invitrogen; см. также Eagle, H (1965) Proc. Soc. Exp. Biol. Med. 89, 36); среду Игла в модификации Дульбекко (DMEM, порошок) (Gibco-Invitrogen (№ 31600); см. также Dulbecco and Freeman (1959) Virology 8, 396; Smith et al. (1960) Virology 12, 185. Tissue Culture Standards Committee, In Vitro 6:2, 93); среду CMRL 1066 (Gibco-Invitrogen (№ 11530); см. также Parker R. C. et al (1957) Special Publications, N.Y. Academy of Sciences, 5, 303).

Базовая среда может быть бессывороточной, что означает, что среда не содержит сыворотки (например, фетальной бычьей сыворотки (FBS), лошадиной сыворотки, козьей сыворотки или сыворотки, полученной от любого другого животного, известной специалисту в данной области), или средой, не содержащей животных белков, или средой с определенным химическим составом.

Базовую среду можно модифицировать с целью удаления определенных компонентов, не являющихся питательными веществами, находящихся в стандартной базовой среде, таких как разнообразные неорганические и органические буферы, поверхностно-активное(поверхностно-активные) вещество(вещества) и хлорид натрия. Удаление таких компонентов из базовой среды для клеток позволяет повысить концентрацию остальных питательных компонентов и может улучшить общий рост клеток и экспрессию белка. Кроме того, изъятые компоненты можно добавить обратно в среду для культивирования клеток, содержащую модифицированную базовую среду для клеток, в соответствии с требованиями условий культивирования клеток. В определенных вариантах осуществления среда для культивирования клеток содержит модифицированную базовую среду для клеток и по меньшей мере одно из следующих питательных веществ: источника железа, рекомбинантного фактора роста; буфера; поверхностно-активного вещества; регулятора осмолярности; источника энергии и гидролизатов неживотного происхождения. Кроме того, модифицированная базовая среда для клеток может необязательно содержать аминокислоты, витамины или комбинацию как аминокислот, так и витаминов. В другом варианте осуществления модифицированная базовая среда дополнительно содержит глутамин, например, L-глутамин, и/или метотрексат.

Получение антител может проводиться в большом количестве с помощью процессов в биореакторе с использованием способов периодического культивирования с подпиткой, периодического культивирования в биореакторе, культивирования в перфузионном биореакторе или биореакторе с непрерывной подачей, известных из уровня техники. Крупномасштабные биореакторы имеют емкость, составляющую по меньшей мере 1000 литров, предпочтительно емкость, составляющую приблизительно 1000-100000 литров. В этих биореакторах могут применяться лопастные мешалки для распределения кислорода и питательных веществ. Биореакторы небольшого масштаба относятся, как правило, к культивированию клеток в рабочем объеме, составляющем не более чем примерно 100 литров, который может варьировать от приблизительно 1 литра до приблизительно 100 литров. Альтернативно, биореакторы одноразового применения (SUB) можно использовать для крупномасштабного либо мелкомасштабного культивирования.

Температура, pH, перемешивание, аэрация и плотность посева будут изменяться в зависимости от применяемых клеток-хозяев и рекомбинантных белков, которые нужно экспрессировать. Например, культуру клеток с рекомбинантным белком можно поддерживать при температуре от 30 до 45oC. pH культуральной среды можно отслеживать в ходе процесса культивирования так, чтобы pH оставался на оптимальном уровне, который для определенных клеток-хозяев может находиться в пределах диапазона pH от 6,0 до 8,0. Осуществляемое лопастной мешалкой смешивание можно применять для таких способов культивирования для перемешивания. Скорость вращения лопастной мешалки может быть окружной скоростью концов лопастей, составляющей примерно 50-200 см/с, но можно применять другие аэролифтные или другие системы перемешивания/аэрации, известные из уровня техники, в зависимости от типа культивируемых клеток-хозяев. Достаточная аэрация обеспечивается для поддержания концентрации растворенного кислорода при насыщении культуры воздухом примерно от 20% до 80%, опять-таки в зависимости от выбранного типа культивируемых клеток-хозяев. Альтернативно, биореактор может барботировать воздух или кислород непосредственно в культуральную среду. Существуют другие способы подачи кислорода, включающие системы беспузырьковой аэрации, в которых используются аэраторы с мембраной из полых волокон.

Методики фагового дисплея

Моноклональные антитела или фрагменты антител могут быть выделены из фаговых библиотек антител, полученных с помощью методик, описанных в McCafferty et al., Nature, 348:552-554 (1990). Clackson et al., Nature, 352:624-628 (1991) и Marks et al., J. Mol. Biol., 222:581-597 (1991). В таких способах антитела могут быть выделены путем скрининга рекомбинантной комбинаторной библиотеки антител, предпочтительно, фаг-дисплейной библиотеки scFv, полученной с использованием человеческих кДНК VL и VH, полученных из мРНК, происходящей из человеческих лимфоцитов. Методы получения и скрининга таких библиотек известны из уровня техники. Кроме коммерчески доступных наборов для получения фаг-дисплейных библиотек (например, системы фаговых рекомбинантных антител Pharmacia, номер по каталогу 27-9400-01; и набора для фагового дисплея SurfZAPTM от Stratagene, номер по каталогу 240612), примеры способов и реактивов, особенно пригодных для применения в получении и скрининге дисплейных библиотек антител, можно найти, например, в патентах США №№ 6248516; US 6545142; 6291158; 6291159; 6291160; 6291161; 6680192; 5969108; 6172197; 6806079; 5885793; 6521404; 6544731; 6555313; 6593081; 6582915; 7195866. Таким образом, эти методики являются эффективными альтернативами традиционным гибридомным методикам получения моноклональных антител для получения и выделения моноклональных антител.

В способах фагового дисплея функциональные домены антител представлены на поверхности фаговых частиц, которые несут последовательности полинуклеотидов, кодирующие их. В конкретном варианте осуществления такой фаг можно использовать для представления антиген-связывающих доменов, экспрессируемых в репертуаре или комбинаторной библиотеке антител (например, человеческих или мышиных). Фаг, экспрессирующий антигенсвязывающий домен, который связывается с антигеном, представляющим интерес, можно отобрать или идентифицировать с помощью антигена, например, с помощью меченого антигена или антигена, связанного с твердой поверхностью или гранулой или зафиксированного на них. Фаг, применяемый в этих способах, обычно является нитчатым фагом, содержащим связывающие домены fd и M13, экспрессируемые в фаге с доменами антитела Fab, Fv или Fv, стабилизированными дисульфидными связями, слитыми рекомбинантным путем с белком гена III или гена VIII фага.

Как описано в указанных выше источниках, после отбора фага участки, кодирующие антитело, из фага можно выделять и применять для получения целых антител, в том числе человеческих антител, гуманизированных антител, или любого другого предпочтительного антигенсвязывающего фрагмента и экспрессировать у любого желаемого хозяина, в том числе в клетках млекопитающих, клетках насекомых, растительных клетках, у дрожжей и бактерий, например, как подробно описано ниже. Например, также можно использовать методики рекомбинантного получения Fab-, Fab'- и F(ab')2-фрагментов, применяя способы, известные из уровня техники, такие как раскрытые в PCT-публикации WO 92/22324; Mullinax et al, BioTechniques 12(6):864-869 (1992); и Better et al., Science 240:1041-1043 (1988).

Примеры методик, которые можно применять для получения одноцепочечных Fv и антител, включают описанные в патентах США №№ 4946778 и 5258498. Таким образом, методики, описанные выше, и таковые, хорошо известные из уровня техники, можно применять для получения рекомбинантных антител, где связывающий домен, например, scFv, был выделен из фаг-дисплейной библиотеки.

Очистка и выделение антител

Непосредственно после получения молекулы антитела путем рекомбинантной или гибридомной экспрессии ее можно очистить любым способом, известным из уровня техники, для очистки молекулы иммуноглобулина, например, с помощью хроматографии (например, ионообменной, аффинной, в частности, по аффинности к специфическим антигенам белку A или белку G, и колоночной хроматографией размеров), центрифугирования, дифференциальной растворимости или любой другой стандартной методики очистки белков. Кроме того, антитела по настоящему изобретению или их фрагменты могут быть слиты с гетерологичными полипептидными последовательностями (называемыми в данном документе "метками") для облегчения очистки.

При применении рекомбинантных методик антитело может быть получено внутриклеточно, в периплазматическом пространстве или непосредственно секретировано в среду. Если антитело получено внутриклеточно, в качестве первого этапа удаляют частицы дебриса, клетки-хозяева или лизированные фрагменты, например, путем центрифугирования или ультрафильтрации. В Carter et al., Bio/Technology, 10:163-167 (1992) описана процедура выделения антител, которые секретируются в периплазматическое пространство E. coli. Если антитело секретируется в среду, надосадочные жидкости из таких систем экспрессии, как правило, вначале концентрируют с помощью коммерчески доступного фильтра для концентрирования белка, например, ультрафильтрационного блока Amicon или Millipore Pellicon. Ингибитор протеаз, такой как PMSF, может быть включен в любой из последующих этапов для ингибирования протеолиза, и антибиотики могут быть включены для предупреждения роста случайных загрязнителей.

Композицию антитела, полученную из клеток, можно очистить с помощью, например, хроматографии на гидроксиапатите, хроматографии гидрофобных взаимодействий, ионообменной хроматографии, гель-электрофореза, диализа и/или аффинной хроматографии в отдельности или в комбинации с другими этапами очистки. Пригодность белка A в качестве аффинного лиганда зависит от вида и изотипа любого домена Fc иммуноглобулина, который присутствует в антителе, и будет понятна специалисту в данной области. Матрицей, к которой прикрепляется аффинный лиганд, чаще всего является агароза, но доступны и другие матрицы. Механически стабильные матрицы, такие как стекло с контролируемым размером пор или поли(стиролдивинил)бензол, обеспечивают более высокие скорости потока и меньшее время обработки, чем можно получить с агарозой. Если антитело содержит домен CH3, для очистки полезна смола Bakerbond ABX (J.T. Baker, Филипсбург, Нью-Джерси). Также доступны другие методики для очистки белка, такие как фракционирование на ионообменной колонке, осаждение этанолом, обращенно-фазовая HPLC, хроматография на силикагеле, хроматография на гепарине, хроматография с использованием сефарозы на анионо- или катионообменной смоле (как, например, на колонке с полиаспарагиновой кислотой), хроматофокусирование, SDS-PAGE и осаждение сульфатом аммония, в зависимости от антитела, которое подлежит извлечению.

После любого(любых) этапа(этапов) предварительной очистки смесь, содержащую антитело, представляющее интерес, и загрязнители можно подвергнуть хроматографии гидрофобных взаимодействий при низком pH с применением элюирующего буфера при pH приблизительно 2,5-4,5, проводимой при низких концентрациях солей (например, приблизительно 0-0,25М соли).

Таким образом, в определенных вариантах осуществления представлены антитела по настоящему изобретению, которые являются фактически очищенными/выделенными. В одном варианте осуществления эти выделенные/очищенные рекомбинантно экспрессируемые антитела можно вводить пациенту с тем, чтобы опосредовать профилактический или терапевтический эффект. Профилактика представляет собой использование лекарственных препаратов или лечение, разработанное и применяемое для предупреждения возникновения заболевания, нарушения или инфекции. Терапевтическое средство связано определенным образом с лечением конкретного заболевания, нарушения или инфекции. Терапевтическая доза представляет собой количество, необходимое для лечения конкретного заболевания, нарушения или инфекции. В другом варианте осуществления эти выделенные/очищенные антитела можно применять для диагностики инфекции, вызванной вирусом гриппа А.

Человеческие антитела

Человеческие антитела могут быть получены с помощью способов, хорошо известных из уровня техники. Человеческие антитела лишены некоторых проблем, связанных с антителами, которые содержат мышиные или крысиные вариабельные и/или константные участки. Присутствие таких полученных от мыши или крысы белков может приводить к быстрому выведению антител или может приводить к формированию иммунного ответа на антитело у пациента.

Человеческие антитела могут быть получены с помощью способов in vitro. Подходящие примеры включают, без ограничения, фаговый дисплей (MedImmune (ранее CAT), Morphosys, Dyax, Biosite/Medarex, Xoma, Symphogen, Alexion (ранее Proliferon), Affimed), рибосомный дисплей (MedImmune (ранее CAT)), дрожжевой дисплей и т.п. Технология фагового дисплея (см., например, патент США № 5969108) может применяться для получения человеческих антител и фрагментов антител in vitro из репертуаров генов вариабельных (V) доменов иммуноглобулинов от неиммунизированных доноров. В соответствии с этой методикой, гены V-доменов антител клонируют внутрирамочно в ген основного либо минорного оболочечного белка нитчатого бактериофага, такого как M13 или fd, и представляют в качестве функциональных фрагментов антител на поверхности фаговой частицы. Поскольку нитевидная частица содержит копию одноцепочечной ДНК фагового генома, отборы на основе функциональных свойств антитела также приводят к отбору гена, кодирующего антитело, проявляющее эти свойства. Таким образом, фаг имитирует некоторые из свойств B-клетки. Фаговый дисплей может быть выполнен во множестве форматов, описанных в обзорах в, например, Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3:564-571 (1993). Для фагового дисплея можно применять некоторые источники V-сегментов генов. Clackson et al., Nature, 352:624-628 (1991), выделили неоднородную совокупность антител к оксазолону из небольшой произвольной комбинаторной библиотеки V-генов, полученных из селезенок иммунизированных мышей. Может быть сконструирован репертуар V-генов от неиммунизированных доноров-людей, и антитела к неоднородной совокупности антигенов (в том числе собственных антигенов) могут быть выделены преимущественно в соответствии со следующими методиками, описанными Marks et al., J. Mol. Biol. 222:581-597 (1991), или Griffith et al., EMBO J. 12:725-734 (1993). См. также патенты США №№ 5565332 и 5573905.

Как обсуждается выше, человеческие антитела также могут вырабатываться активированными in vitro B-клетками (см. патенты США №№ 5567610 и 5229275).

Гены иммуноглобулинов претерпевают различные модификации при развитии иммунного ответа, в том числе рекомбинацию между сегментами генов V, D и J, переключение изотипов и гипермутацию в вариабельных участках. Рекомбинация и соматическая гипермутация являются основанием для формирования разнообразия антител и созревания аффинности, но они также могут приводить к формированию факторов неустойчивости последовательностей, которые могут осложнить коммерческое получение таких иммуноглобулинов в качестве терапевтических средств или повысить риск иммуногенности антитела. Как правило, мутации в CDR-участках, вероятно, способствуют улучшению аффинности и функции, тогда как мутации в каркасных областях могут повышать риск иммуногенности. Этот риск может быть снижен путем возвращения мутантных участков каркасных областей к зародышевому типу при обеспечении того, что активность антитела не подвергается неблагоприятному влиянию. Благодаря процессам внесения разнообразия также могут формироваться некоторые факторы структурной неустойчивости, или эти факторы структурной неустойчивости могут существовать в последовательностях зародышевого типа, участвующих в образовании вариабельных доменов тяжелой и легкой цепи. Независимо от источника, может быть желательным устранение потенциальных факторов структурной неустойчивости, которые могут приводить к нестабильности, агрегации, неоднородности продукта или повышению иммуногенности. Примеры нежелательных факторов неустойчивости включают неспаренные цистеиновые остатки (которые могут обуславливать перестановку дисульфидных связей или образование неодинаковых сульфгидрильных аддуктов), сайты N-сцепленного гликозилирования (обуславливающие неоднородность структуры и активности), а также сайты дезамидирования (например, NG, NS), изомеризации (DG), окисления (доступный метионин) и гидролиза (DP).

Следовательно, для снижения риска иммуногенности и улучшения фармацевтических свойств антител может быть желательным возвращение последовательности каркасной области к зародышевому типу, возвращение CDR к зародышевому типу и/или устранение структурной неустойчивости.

Таким образом, в одном варианте осуществления, если конкретное антитело отличается от его соответствующей последовательности зародышевого типа на аминокислотном уровне, последовательность антитела можно подвергнуть обратной мутации в последовательность зародышевого типа. Такие корректирующие мутации могут происходить в одном, двух, трех или более положениях или в комбинации каких-либо из мутантных положений с применением стандартных методик молекулярной биологии.

Фрагменты антител

В определенных вариантах осуществления антитела по настоящему изобретению являются фрагментами антител или антителами, содержащими такие фрагменты. Фрагмент антитела содержит часть антитела полной длины, которая, как правило, является его антигенсвязывающим или вариабельным участком. Примеры фрагментов антител включают Fab-, Fab'-, F(ab')2-, Fd- и Fv-фрагменты, диатела, линейные антитела (патент США № 5641870) и одноцепочечные молекулы антител.

Традиционно, эти фрагменты получали путем протеолитического расщепления интактных антител с применением методик, хорошо известных из уровня техники. Однако, эти фрагменты теперь могут быть получены в данном документе непосредственно с помощью рекомбинантных клеток-хозяев. Все Fab-, Fv- и scFv-фрагменты антител могут экспрессироваться и секретироваться E. coli, что, таким образом, обеспечивает легкое получение больших количеств этих фрагментов. В одном варианте осуществления фрагменты антител могут быть выделены из обсуждаемых выше фаговых библиотек антител. Альтернативно, Fab'-SH-фрагменты также могут быть непосредственно извлечены из E. coli и химически соединены с образованием F(ab')2-фрагментов (Carter et al., Bio/Technology, 10:163-167 (1992)). В соответствии с другим подходом F(ab')2-фрагменты могут быть выделены непосредственно из культуры рекомбинантных клеток-хозяев. Другие методики получения фрагментов антител будут очевидны практикующему специалисту. В других вариантах осуществления выбранное антитело представляет собой одноцепочечный Fv-фрагмент (scFv). В определенных вариантах осуществления антителом не является Fab-фрагмент. Fv и scFv являются единственными молекулами с интактными антигенсвязывающими активными центрами, которые лишены константных участков; таким образом, они являются подходящими для ослабленного неспецифического связывания во время применения in vivo. Гибридные белки scFv могут быть сконструированы с получением слияния эффекторного белка с амино- или карбоксильным концом scFv.

В определенных вариантах осуществления антитела в соответствии с настоящим изобретением являются доменными антителами, например, антителами, содержащими небольшие функциональные связывающие единицы антител, соответствующие вариабельным участкам тяжелой (VH) или легкой (VL) цепей человеческих антител. Примеры доменных антител включают, без ограничения, антитела Domantis (см., например, WO04/058821; WO04/081026; WO04/003019; WO03/002609; патенты США №№ 6291158; 6582915; 6696245 и 6593081).

В определенных вариантах осуществления настоящего изобретения антителами по настоящему изобретению являются линейные антитела. Линейные антитела содержат пару тандемных сегментов Fd (VH-CH1-VH-CH1), которые образуют пару антигенсвязывающих участков. См. Zapata et al., Protein Eng., 8(10):1057-1062 (1995).

Другие модификации аминокислотных последовательностей

Кроме описанных выше человеческих, гуманизированных и/или химерных антител, настоящее изобретение также охватывает дополнительные модификации, а также варианты и фрагменты антител по настоящему изобретению, содержащие одну или несколько замен, добавлений и/или делеций аминокислотных остатков и/или полипептидов в вариабельном домене легкой цепи (VL), и/или вариабельном домене тяжелой цепи (VH), и/или Fc-участке и посттрансляционных модификаций. Такие модификации включают конъюгаты антител, где антитело ковалентно присоединено к компоненту. Компоненты, подходящие для присоединения к антителам, включают, без ограничения, белки, пептиды, лекарственные средства, метки и цитотоксины. Эти изменения антител могут быть выполнены для изменения или точной регулировки характеристик (биохимических, связывающих и/или функциональных) антител как подходящих для лечения и/или диагностики инфекции, вызванной вирусом гриппа А. Способы образования конъюгатов, осуществления аминокислотных и/или полипептидных изменений и посттрансляционных модификаций хорошо известны из уровня техники, причем некоторые из них подробно описаны ниже.

Аминокислотные изменения антител неизбежно приводят к образованию последовательностей, менее чем на 100% идентичным определенным выше последовательностям антител или последовательности исходного антитела. В определенных вариантах осуществления в данном контексте антитела могут характеризоваться идентичностью последовательности с аминокислотной последовательностью вариабельного домена тяжелой либо легкой цепи антитела, описанного в данном документе, составляющей от приблизительно 25% до приблизительно 95%. Таким образом, в одном варианте осуществления модифицированное антитело может иметь аминокислотную последовательность по меньшей мере с 25%, 35%, 45%, 55%, 65%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичностью или подобием аминокислотной последовательности с аминокислотной последовательностью вариабельного домена тяжелой либо легкой цепи антитела, описанного в данном документе. В другом варианте осуществления измененное антитело может иметь аминокислотную последовательность по меньшей мере с 25%, 35%, 45%, 55%, 65%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичностью или подобием аминокислотной последовательности с аминокислотной последовательностью CDR1, CDR2 или CDR3 тяжелой либо легкой цепи антитела, описанного в данном документе. В другом варианте осуществления измененное антитело может иметь аминокислотную последовательность по меньшей мере с 25%, 35%, 45%, 55%, 65%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичностью или подобием аминокислотной последовательности с аминокислотной последовательностью FR1, FR2, FR3 или FR4 тяжелой либо легкой цепи антитела, описанного в данном документе.

В определенных вариантах осуществления измененные антитела получают с помощью одного или нескольких аминокислотных изменений (например, замен, делеций и/или добавлений), введенных в один или несколько вариабельных участков антитела. В другом варианте осуществления аминокислотные изменения вводят в каркасные области. Одно или несколько изменений остатков каркасных областей могут приводить к улучшению аффинности связывания антитела по отношению к антигену. Это особенно может быть справедливым, если такие изменения выполняют для гуманизированных антител, где каркасная область и CDR-участки могут происходить от разных видов. Примеры остатков каркасных областей, подлежащих модификации, включают таковые, которые непосредственно нековалентно связывают антиген (Amit et al., Science, 233:747-753 (1986)); взаимодействуют с CDR/влияют на его конформацию (Chothia et al., J. Mol. Biol., 196:901-917 (1987)) и/или участвуют в образовании области контакта VL-VH (патенты США №№ 5225539 и 6548640). В одном варианте осуществления могут быть изменены от приблизительно одного до приблизительно пяти остатков каркасных областей. Иногда этого может быть достаточно для получения мутантного антитела, подходящего для применения в доклинических испытаниях, даже если не был изменен ни один остаток гипервариабельного участка. Обычно, однако, измененное антитело будет содержать дополнительное(дополнительные) изменение(изменения) гипревариабельного участка.

Одна подходящая процедура для получения измененных антител называется "аланин-сканирующий мутагенез" (Cunningham and Wells, Science, 244:1081-1085 (1989)). В этом способе один или несколько остатков гипервариабельного участка замещаются аланиновым(аланиновыми) или полиаланиновым(полиаланиновыми) остатком(остатками) для изменения взаимодействия аминокислот с целевым антигеном. Этот(эти) остаток(остатки) гипервариабельного участка, демонстрирующий(демонстрирующие) функциональную чувствительность к заменам, затем улучшают путем введения дополнительных или других мутаций в сайтах или вместо сайтов замены. Таким образом, хотя сайт для введения варианта аминокислотной последовательности устанавливается предварительно, нет необходимости в предварительном определении природы мутации как таковой. Ala-мутанты, получаемые таким путем, подвергают скринингу в отношении их биологической активности, как описано в данном документе.

В определенных вариантах осуществления вариант с заменой предусматривает замену одного или нескольких остатков гипревариабельного участка исходного антитела (например, гуманизированного или человеческого антитела). Как правило, полученный(полученные) вариант(варианты), выбранный(выбранные) для дополнительной разработки, будет(будут) обладать улучшенными биологическими свойствами относительно исходного антитела, из которого они получены. Удобный способ для получения таких вариантов с заменами включает созревание аффинности с применением фагового дисплея (Hawkins et al., J. Mol. Biol., 254:889-896 (1992) и Lowman et al., Biochemistry, 30(45):10832-10837 (1991)). Вкратце, несколько сайтов гипервариабельного участка (например, 6-7 сайтов) подвергают мутации с образованием всех возможных замен аминокислот в каждом сайте. Мутантные антитела, полученные таким образом, представляют в одновалентной форме на частицах нитевидного фага в виде гибридов с продуктом гена III M13, упакованных в каждой частице. Фаг-дисплейных мутантов затем подвергают скринингу в отношении их биологической активности (например, аффинности связывания), как раскрыто в данном документе.

Мутации в последовательностях антител могут включать замены, делеции, в том числе внутренние делеции, добавления, в том числе добавления, обуславливающие получение гибридных белков, или консервативные замены аминокислотных остатков в аминокислотной последовательности и/или рядом с ней, которые, однако, приводят к "молчащему" изменению в том смысле, что изменение дает функционально эквивалентное антитело. Консервативные замены аминокислот могут быть выполнены на основе сходства полярности, заряда, растворимости, гидрофобности, гидрофильности и/или амфипатической природы включенных остатков. Например, неполярные (гидрофобные) аминокислоты включают аланин, лейцин, изолейцин, валин, пролин, фенилаланин, триптофан и метионин; полярные нейтральные аминокислоты включают глицин, серин, треонин, цистеин, тирозин, аспарагин и глутамин; положительно заряженные (основные) аминокислоты включают аргинин, лизин и гистидин; а отрицательно заряженные (кислые) аминокислоты включают аспарагиновую кислоту и глутаминовую кислоту. Кроме того, глицин и пролин являются остатками, которые могут влиять на ориентацию цепи. Неконсервативные замены повлекут за собой замену члена одного из этих классов членом другого класса. Более того, если желательно, неклассические аминокислоты или химические аналоги аминокислот могут быть введены в последовательность антитела в виде замены или добавления. Неклассические аминокислоты включают, без ограничения, D-изомеры стандартных аминокислот, α-аминоизомасляную кислоту, 4-аминомасляную кислоту, Abu, 2-аминомасляную кислоту, γ-Abu, ε-Ahx, 6-аминогексановую кислоту, Aib, 2-аминоизомасляную кислоту, 3-аминопропионовую кислоту, орнитин, норлейцин, норвалин, гидроксипролин, саркозин, цитруллин, цистеиновую кислоту, трет-бутилглицин, трет-бутилаланин, фенилглицин, циклогексилаланин, β-аланин, фторсодержащие аминокислоты, искусственные аминокислоты, такие как β-метиламинокислоты, Cα-метиламинокислоты, Nα-метиламинокислоты и аналоги аминокислот, как правило.

В другом варианте осуществления любой цистеиновый остаток, не участвующий в поддержании надлежащей конформации антитела, также может быть замещен, как правило, серином, для улучшения устойчивости к окислению молекулы и предупреждения аномального сшивания. Наоборот, цистеиновая(цистеиновые) связь(связи) может(могут) быть добавлена(добавлены) к антителу для улучшения его стабильности (особенно если антитело представляет собой фрагмент антитела, такой как Fv-фрагмент).

Варианты Fc-участков

Известно, что варианты Fc-участка (например, замены, и/или добавления, и/или делеции аминокислот) усиливают или ослабляют эффекторную функцию антитела (см., например, патенты США №№ 5624821; 5885573; 6538124; 7317091; 5648260; 6538124; WO 03/074679; WO 04/029207; WO 04/099249; WO 99/58572; публикации заявок на патенты США №№ 2006/0134105; 2004/0132101; 2006/0008883) и могут изменять фармакокинетические свойства (например, период полувыведения) антитела (см. патенты США 6277375 и 7083784). Таким образом, в определенных вариантах осуществления антитела по настоящему изобретению содержат измененный Fc-участок (также называемый в данном документе "вариантом Fc-участка"), в котором одно или несколько изменений были осуществлены в Fc-участке для изменения функциональных и/или фармакокинетических свойств антител. Подобные изменения могут приводить к ослаблению или усилению связывания Clq и комплементзависимой цитотоксичности (CDC) или связывания FcγR для IgG и антителозависимой клеточной цитотоксичности (ADCC) или антителозависимого клеточноопосредованного фагоцитоза (ADCP). Настоящее изобретение охватывает антитела, описанные в данном документе, с вариантами Fc-участков, где изменения были осуществлены для точной регулировки эффекторной функции, усиления или ослабления, и обеспечения необходимой эффекторной функции. Соответственно, антитела по настоящему изобретению содержат вариант Fc-участка (т.е. Fc-участки, которые были изменены, как обсуждается ниже). Антитела по настоящему изобретению, содержащие вариант Fc-участка, также называются в данном документе "антителами с вариантами Fc". Как используется в данном документе, "нативный" относится к немодифицированной исходной последовательности, и антитело, содержащее нативный Fc-участок, называется в данном документе "антителом с нативным Fc". Антитела с вариантами Fc могут быть получены при помощи многочисленных способов, хорошо известных специалисту в данной области. Неограничивающие примеры включают выделение участков, кодирующих антитело (например, из гибридомы), и осуществление одной или нескольких необходимых замен в Fc-участке выделенного участка, кодирующего антитело. Альтернативно, антигенсвязывающую часть (например, вариабельные участки) антитела можно субклонировать в вектор, кодирующий вариант Fc-участка. В одном варианте осуществления вариант Fc-участка характеризуется сходным уровнем индукции эффекторной функции по сравнению с нативным Fc-участком. В другом варианте осуществления вариант Fc-участка характеризуется более высокой индукцией эффекторной функции по сравнению с нативным Fc. Некоторые конкретные варианты осуществления вариантов Fc-участков подробно описаны ниже. Способы измерения эффекторной функции хорошо известны из уровня техники.

Эффекторную функцию антитела модифицируют путем изменений в Fc-участке, в том числе, без ограничения, замен аминокислот, добавлений аминокислот, делеций аминокислот и изменений по типу посттрансляционных модификаций аминокислот в Fc (например, гликозилирования). Способы, описанные ниже, можно применять для точной регулировки эффекторной функции антитела по настоящему изобретению, соотношения свойств связывания Fc-участка для FcR (например, аффинности и специфичности), что приводит к образованию терапевтического антитела с необходимыми свойствами.

Следует понимать, что Fc-участок, как используется в данном документе, включает в себя полипептиды, содержащие константный участок антитела за исключением первого домена константного участка иммуноглобулина. Таким образом, Fc относится к последним двум доменам константного участка иммуноглобулинов IgA, IgD и IgG и последним трем доменам константного участка иммуноглобулинов IgE и IgM, а также гибкому шарнирному участку на N-конце этих доменов. В случае IgA и IgM Fc может включать в себя J-цепь. В случае IgG Fc содержит домены иммуноглобулина C-гамма-2 и C-гамма-3 (Cγ2 и Cγ3) и шарнирную область между C-гамма-1 (Cγ1) и C-гамма-2 (Cγ2). Несмотря на то, что границы Fc-участка могут варьировать, Fc-участок тяжелой цепи человеческого IgG обычно определяется как содержащий остатки C226 или P230 на его карбоксильном конце, где нумерация приведена согласно EU-индексу, как изложено у Kabat. Fc может относиться к этому выделенному участку или этому участку в контексте антитела, фрагмента антитела или гибридного белка на основе Fc. Наблюдались полиморфизмы в ряде различных положений Fc, в том числе, без ограничения, в положениях 270, 272, 312, 315, 356 и 358, пронумерованным согласно EU-индексу, и, следовательно, могут существовать незначительные различия между представленной последовательностью и последовательностями из уровня техники.

В одном варианте осуществления антитела с вариантами Fc проявляют измененную аффинность связывания в отношении одного или нескольких Fc-рецепторов, в том числе, без ограничения, FcRn, FcγRI (CD64), в том числе изоформ FcγRIA, FcγRIB и FcγRIC; FcγRII (CD32, в том числе изоформ FcγRIIA, FcγRIIB и FcγRIIC) и FcγRIII (CD16, в том числе изоформ FcγRIIIA и FcγRIIIB), по сравнению с антителом с нативным Fc.

В одном варианте осуществления антитело с вариантом Fc характеризуется повышенным связыванием с одним или нескольким лигандами Fc по сравнению с антителом c нативным Fc. В другом варианте осуществления антитело с вариантом Fc характеризуется повышенной или пониженной аффинностью в отношении лиганда Fc, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 7 раз, или по меньшей мере в 10 раз, или по меньшей мере в 20 раз, или по меньшей мере в 30 раз, или по меньшей мере в 40 раз, или по меньшей мере в 50 раз, или по меньшей мере в 60 раз, или по меньшей мере в 70 раз, или по меньшей мере в 80 раз, или по меньшей мере в 90 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз большей или меньшей, чем у антитела c нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются значениями аффинности в отношении лиганда Fc, по меньшей мере на 90%, по меньшей мере на 80%, по меньшей мере на 70%, по меньшей мере на 60%, по меньшей мере на 50%, по меньшей мере на 40%, по меньшей мере на 30%, по меньшей мере на 20%, по меньшей мере на 10% или по меньшей мере на 5% большими или меньшими, чем у антитела c нативным Fc. В определенных вариантах осуществления антитело с вариантом Fc характеризуется повышенной аффинностью в отношении лиганда Fc. В других вариантах осуществления антитело с вариантом Fc характеризуется пониженной аффинностью в отношении лиганда Fc.

В конкретном варианте осуществления антитело с вариантом Fc характеризуется повышенным связыванием с Fc-рецептором FcγRIIIA. В другом конкретном варианте осуществления антитело с вариантом Fc характеризуется повышенным связыванием с Fc-рецептором FcγRIIB. В дополнительном конкретном варианте осуществления антитело с вариантом Fc характеризуется повышенным связыванием с Fc-рецепторами как FcγRIIIA, так и FcγRIIB. В определенных вариантах осуществления антитела c вариантами Fc, характеризующиеся повышенным связыванием с FcγRIIIA, не характеризуются при этом повышенным связыванием с рецептором FcγRIIB по сравнению с антителом c нативным Fc. В конкретном варианте осуществления антитело с вариантом Fc характеризуется пониженным связыванием с Fc-рецептором FcγRIIIA. В дополнительном конкретном варианте осуществления антитело с вариантом Fc характеризуется пониженным связыванием с Fc-рецептором FcγRIIB. В еще одном конкретном варианте осуществления антитело с вариантом Fc, проявляющее измененную аффинность в отношении FcγRIIIA и/или FcγRIIB, характеризуется повышенным связыванием с Fc-рецептором FcRn. В еще одном конкретном варианте осуществления антитело с вариантом Fc, проявляющее измененную аффинность в отношении FcγRIIIA и/или FcγRIIB, характеризуется измененным связыванием с C1q по сравнению с антителом c нативным Fc.

В одном варианте осуществления антитела c вариантами Fc характеризуются значениями аффинности в отношении рецептора FcγRIIIA, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 7 раз, или по меньшей мере в 10 раз, или по меньшей мере в 20 раз, или по меньшей мере в 30 раз, или по меньшей мере в 40 раз, или по меньшей мере в 50 раз, или по меньшей мере в 60 раз, или по меньшей мере в 70 раз, или по меньшей мере в 80 раз, или по меньшей мере в 90 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз большими или меньшими, чем у антитела c нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются значениями аффинности в отношении FcγRIIIA, по меньшей мере на 90%, по меньшей мере на 80%, по меньшей мере на 70%, по меньшей мере на 60%, по меньшей мере на 50%, по меньшей мере на 40%, по меньшей мере на 30%, по меньшей мере на 20%, по меньшей мере на 10% или по меньшей мере на 5% большими или меньшими, чем у антитела c нативным Fc.

В некоторых вариантах осуществления антитела c вариантами Fc характеризуются значениями аффинности в отношении рецептора FcγRIIB, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 7 раз, или по меньшей мере в 10 раз, или по меньшей мере в 20 раз, или по меньшей мере в 30 раз, или по меньшей мере в 40 раз, или по меньшей мере в 50 раз, или по меньшей мере в 60 раз, или по меньшей мере в 70 раз, или по меньшей мере в 80 раз, или по меньшей мере в 90 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз большими или меньшими, чем у антитела c нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются значениями аффинности в отношении FcγRIIB, по меньшей мере на 90%, по меньшей мере на 80%, по меньшей мере на 70%, по меньшей мере на 60%, по меньшей мере на 50%, по меньшей мере на 40%, по меньшей мере на 30%, по меньшей мере на 20%, по меньшей мере на 10% или по меньшей мере на 5% большими или меньшими, чем у антитела c нативным Fc.

В одном варианте осуществления антитела c вариантами Fc характеризуются повышенными или пониженными значениями аффинности в отношении C1q по сравнению с антителом с нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются значениями аффинности в отношении рецептора C1q, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 7 раз, или по меньшей мере в 10 раз, или по меньшей мере в 20 раз, или по меньшей мере в 30 раз, или по меньшей мере в 40 раз, или по меньшей мере в 50 раз, или по меньшей мере в 60 раз, или по меньшей мере в 70 раз, или по меньшей мере в 80 раз, или по меньшей мере в 90 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз большими или меньшими, чем у антитела c нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются значениями аффинности в отношении C1q, по меньшей мере на 90%, по меньшей мере на 80%, по меньшей мере на 70%, по меньшей мере на 60%, по меньшей мере на 50%, по меньшей мере на 40%, по меньшей мере на 30%, по меньшей мере на 20%, по меньшей мере на 10% или по меньшей мере на 5% большими или меньшими, чем у антитела c нативным Fc. В еще одном конкретном варианте осуществления антитело с вариантом Fc, проявляющее измененную аффинность в отношении C1q, характеризуется повышенным связыванием с Fc-рецептором FcRn. В еще одном конкретном варианте осуществления антитело с вариантом Fc, проявляющее измененную аффинность в отношении C1q, характеризуется измененным связыванием с FcγRIIIA и/или FcγRIIB по сравнению с антителом c нативным Fc.

Хорошо известно из уровня техники, что антитела способны к управлению атакой и разрушением посредством нескольких процессов, в совокупности известных из уровня техники как эффекторные функции антител. Один из этих процессов, известный как "антителозависимая клеточноопосредованная цитотоксичность" или "ADCC", относится к форме цитотоксичности, при которой секретируемый Ig, связываемый с Fc-рецепторами (FcR), представленными на определенных цитотоксических клетках (например, естественных клетках-киллерах (NK), нейтрофилах и макрофагах), дает возможность данным цитотоксическим эффекторным клеткам специфично связываться с клетками, несущими антиген, и затем уничтожать клетки с помощью цитотоксинов. Специфические высокоаффинные антитела IgG, направленные на поверхность клеток, "активизируют" цитотоксические клетки и требуются для такого уничтожения. Лизис клетки является внеклеточным, требует непосредственного межклеточного контакта и не вовлекает систему комплемента.

Другим процессом, охватываемым выражением "эффекторная функция", является комплементзависимая цитотоксичность (далее в данном документе называемая "CDC"), которая относится к биохимическому явлению разрушения клетки с помощью системы комплемента. Система комплемента представляет собой сложную систему белков, обнаруживаемых в нормальной плазме крови, которая в сочетании с антителами разрушает патогенные бактерии и другие чужеродные клетки.

Еще одним процессом, охватываемым выражением "эффекторная функция", является антителозависимый клеточноопосредованный фагоцитоз (ADCP), который относится к клеточноопосредованной реакции, где неспецифические цитотоксические клетки, которые экспрессируют один или несколько эффекторных лигандов, распознают связанное антитело на клетке и затем вызывают фагоцитоз клетки.

Предполагается, что характеристики антител с вариантами Fc получают при помощи функциональных анализов in vitro для определения одной или нескольких эффекторных клеточных функций, опосредованных FcγR. В определенных вариантах осуществления антитела c вариантами Fc в моделях in vivo (таких как описанные и раскрытые в данном документе) характеризуются свойствами связывания и эффекторными клеточными функциями, сходными с таковыми в анализах in vitro. Однако, настоящее изобретение не исключает антитела c вариантами Fc, которые не проявляют желаемый фенотип в анализах in vitro, но проявляют желаемый фенотип in vivo.

В определенных вариантах осуществления антитело, содержащее вариант Fc, характеризуется повышенной цитотоксичностью или фагоцитарной активностью (например, ADCC, CDC и ADCP) по сравнению с антителом, содержащим нативный Fc-участок. В конкретном варианте осуществления антитело с вариантом Fc характеризуется цитотоксичностью или фагоцитарной активностью, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 10 раз, или по меньшей мере в 50 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз большей, чем у антитела c нативным Fc. Альтернативно, антитело с вариантом Fc характеризуется пониженной цитотоксичностью или фагоцитарной активностью по сравнению с антителом c нативным Fc. В конкретном варианте осуществления антитело с вариантом Fc характеризуется цитотоксичностью или фагоцитарной активностью, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 10 раз, или по меньшей мере в 50 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз меньшей, чем у антитела c нативным Fc.

В определенных вариантах осуществления антитела c вариантами Fc характеризуются пониженными значениями ADCC-активности по сравнению с антителом c нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются значениями ADCC-активности, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 10 раз, или по меньшей мере в 50 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз меньшими, чем у антитела c нативным Fc. В еще одном варианте осуществления антитела c вариантами Fc характеризуются значениями ADCC-активности, сниженными по меньшей мере на 10%, или по меньшей мере на 20%, или по меньшей мере на 30%, или по меньшей мере на 40%, или по меньшей мере на 50%, или по меньшей мере на 60%, или по меньшей мере на 70%, или по меньшей мере на 80%, или по меньшей мере на 90%, или по меньшей мере на 100%, или по меньшей мере на 200%, или по меньшей мере на 300%, или по меньшей мере на 400%, или по меньшей мере на 500% по сравнению с антителом c нативным Fc. В определенных вариантах осуществления антитела c вариантами Fc не характеризуются выявляемой ADCC-активностью. В конкретных вариантах осуществления снижение и/или устранение ADCC-активности может быть объяснено сниженной аффинностью, которую антитела c вариантами Fc проявляют по отношению к лигандам и/или рецепторам Fc.

В альтернативном варианте осуществления антитела c вариантами Fc характеризуются повышенными значениями ADCC-активности по сравнению с антителом c нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются значениями ADCC-активности, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 10 раз, или по меньшей мере в 50 раз, или по меньшей мере в 100 раз большими, чем у антитела c нативным Fc. В еще одном варианте осуществления антитела c вариантами Fc характеризуются значениями ADCC-активности, повышенными по меньшей мере на 10%, или по меньшей мере на 20%, или по меньшей мере на 30%, или по меньшей мере на 40%, или по меньшей мере на 50%, или по меньшей мере на 60%, или по меньшей мере на 70%, или по меньшей мере на 80%, или по меньшей мере на 90%, или по меньшей мере на 100%, или по меньшей мере на 200%, или по меньшей мере на 300%, или по меньшей мере на 400%, или по меньшей мере на 500% по сравнению с антителом c нативным Fc. В конкретных вариантах осуществления повышение ADCC-активности может быть объяснено повышенной аффинностью, которую антитела c вариантами Fc проявляют по отношению к лигандам и/или рецепторам Fc.

В конкретном варианте осуществления антитело с вариантом Fc характеризуется повышенным связыванием с Fc-рецептором FcγRIIIA и характеризуется повышенной ADCC-активностью по сравнению с антителом c нативным Fc. В других вариантах осуществления антитело с вариантом Fc характеризуется как повышенной ADCC-активностью, так и увеличенным периодом полувыведения из сыворотки по сравнению с антителом c нативным Fc. В другом конкретном варианте осуществления антитело с вариантом Fc характеризуется пониженным связыванием с Fc-рецептором FcγRIIIA и характеризуется пониженной ADCC-активностью по сравнению с антителом c нативным Fc. В других вариантах осуществления антитело с вариантом Fc характеризуется как пониженной ADCC-активностью, так и увеличенным периодом полувыведения из сыворотки по сравнению с антителом c нативным Fc.

В определенных вариантах осуществления цитотоксичность опосредована CDC, при этом антитело с вариантом Fc характеризуется повышенной либо пониженной CDC-активностью по сравнению с антителом c нативным Fc. Путь активации системы комплемента инициируется связыванием первого компонента системы комплемента (C1q) с молекулой, например, антителом, образующим комплекс с когнатным антигеном. Для оценки активации системы комплемента можно проводить анализ CDC, например, как описано в Gazzano-Santoro et al., 1996, J.Immunol. Methods, 202:163.

В одном варианте осуществления антитела по настоящему изобретению характеризуются повышенной CDC-активностью по сравнению с антителом c нативным Fc. В другом варианте осуществления антитела c вариантами Fc характеризуются CDC-активностью, по меньшей мере в 2 раза, или по меньшей мере в 3 раза, или по меньшей мере в 5 раз, или по меньшей мере в 10 раз, или по меньшей мере в 50 раз, или по меньшей мере в 100 раз, или по меньшей мере в 200 раз, или в от 2 раз до 10 раз, или в от 5 раз до 50 раз, или в от 25 раз до 100 раз, или в от 75 раз до 200 раз, или в от 100 раз до 200 раз большей, чем у антитела c нативным Fc. В еще одном варианте осуществления антитела c вариантами Fc характеризуются CDC-активностью, повышенной по меньшей мере на 10%, или по меньшей мере на 20%, или по меньшей мере на 30%, или по меньшей мере на 40%, или по меньшей мере на 50%, или по меньшей мере на 60%, или по меньшей мере на 70%, или по меньшей мере на 80%, или по меньшей мере на 90%, или по меньшей мере на 100%, или по меньшей мере на 200%, или по меньшей мере на 300%, или по меньшей мере на 400%, или по меньшей мере на 500% по сравнению с антителом c нативным Fc. В конкретных вариантах осуществления повышение CDC-активности может быть объяснено повышенной аффинностью, которую антитела c вариантами Fc проявляют по отношению к C1q.

Антитела по настоящему изобретению могут характеризоваться повышенной CDC-активностью по сравнению с антителом c нативным Fc благодаря технологии COMPLEGENT® (Kyowa Hakko Kirin Co., Ltd.), которая усиливает один из основных механизмов действия антитела, CDC. С использованием подхода, называемого изотипическим химеризмом, в котором части IgG3, изотипа антитела, вводят в соответствующие участки IgG1, стандартного изотипа для терапевтических антител, технология COMPLEGENT® значительно повышает CDC-активность с превышением таковой как у IgG1, так и у IgG3, при этом сохраняя желаемые характеристики IgG1, такие как ADCC, PK-профиль и связывание белка А. Кроме того, ее можно применять вместе с технологией POTELLIGENT®, создавая терапевтическое mAb еще более высокого качества (ACCRETAMAB®) с повышенными значениями ADCC- и CDC-активности.

Антитело с вариантом Fc по настоящему изобретению может характеризоваться повышенной ADCC-активностью и увеличенным периодом полувыведения из сыворотки по сравнению с антителом c нативным Fc.

Антитело с вариантом Fc по настоящему изобретению может характеризоваться повышенной CDC-активностью и увеличенным периодом полувыведения из сыворотки по сравнению с антителом c нативным Fc.

Антитело с вариантом Fc по настоящему изобретению может характеризоваться повышенной ADCC-активностью, повышенной CDC-активностью и увеличенным периодом полувыведения из сыворотки по сравнению с антителом c нативным Fc.

Период полувыведения из сыворотки белков, содержащих Fc-участки, можно увеличить путем повышения аффинности связывания Fc-участка с FcRn. Выражение "период полувыведения антитела", используемое в данном документе, означает фармакокинетическое свойство антитела, которое представляет собой меру среднего времени жизни молекул антител после их введения. Период полувыведения антитела можно выразить как время, необходимое для выведения 50 процентов известного количества иммуноглобулина из организма пациента (или другого млекопитающего) или его определенного компартмента, например, измеренное в сыворотке крови, т.е. период полувыведения из кровотока, или других тканях. Период полувыведения может различаться среди разных иммуноглобулинов или классов иммуноглобулинов. Как правило, увеличение периода полувыведения антитела приводит к увеличению среднего времени удержания (MRT) введенного антитела в кровотоке.

Увеличение периода полувыведения позволяет уменьшить количество лекарственного средства, даваемого пациенту, а также снизить частоту введения. Для увеличения периода полувыведения антитела из сыворотки в состав антитела (в частности, фрагмента антитела) может быть введен эпитоп, связывающийся с рецептором реутилизации, как описано, например, в патенте США № 5739277. Как используется в данном документе, выражение "эпитоп, связывающийся с рецептором реутилизации" относится к эпитопу Fc-участка молекулы IgG (например, IgG1, IgG2, IgG3 или IgG4), который отвечает за увеличение периода полувыведения из сыворотки молекулы IgG in vivo.

Альтернативно, антитела по настоящему изобретению с увеличенным периодом полувыведения можно получить с помощью модификации аминокислотных остатков, идентифицированных как вовлеченные во взаимодействие между Fc и FcRn-рецептором (см., например, патенты США №№ 6821505 и 7083784; а также WO 09/058492). Кроме того, период полувыведения антител по настоящему изобретению можно увеличить путем конъюгирования с PEG или альбумином при помощи методик, широко используемых в данной области техники. В некоторых вариантах осуществления антитела, содержащие варианты Fc-участков, по настоящему изобретению характеризуются периодом полувыведения, увеличенным приблизительно на 5%, приблизительно на 10%, приблизительно на 15%, приблизительно на 20%, приблизительно на 25%, приблизительно на 30%, приблизительно на 35%, приблизительно на 40%, приблизительно на 45%, приблизительно на 50%, приблизительно на 60%, приблизительно на 65%, приблизительно на 70%, приблизительно на 80%, приблизительно на 85%, приблизительно на 90%, приблизительно на 95%, приблизительно на 100%, приблизительно на 125%, приблизительно на 150% или более по сравнению с антителом, содержащим нативный Fc-участок. В некоторых вариантах осуществления антитела, содержащие варианты Fc-участков, характеризуются периодом полувыведения, увеличенным приблизительно в 2 раза, приблизительно в 3 раза, приблизительно в 4 раза, приблизительно в 5 раз, приблизительно в 10 раз, приблизительно в 20 раз, приблизительно в 50 раз или более, или в от 2 раз до 10 раз, или в от 5 раз до 25 раз, или в от 15 раз до 50 раз по сравнению с антителом, содержащим нативный Fc-участок.

В одном варианте осуществления настоящее изобретение предусматривает варианты Fc, где Fc-участок содержит модификацию (например, замены аминокислот, вставки аминокислот, делеции аминокислот) в одном или нескольких положениях, выбранных из группы, состоящей из 221, 225, 228, 234, 235, 236, 237, 238, 239, 240, 241, 243, 244, 245, 247, 250, 251, 252, 254, 255, 256, 257, 262, 263, 264, 265, 266, 267, 268, 269, 279, 280, 284, 292, 296, 297, 298, 299, 305, 308, 313, 316, 318, 320, 322, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 339, 341, 343, 370, 373, 378, 392, 416, 419, 421, 428, 433, 434, 435, 436, 440 и 443 согласно нумерации с помощью EU-индекса, как изложено у Kabat. Необязательно, Fc-участок может содержать модификацию в дополнительных и/или альтернативных положениях, известных специалисту в данной области (см., например, патенты США 5624821; 6277375; 6737056; 7083784; 7317091; 7217797; 7276585; 7355008; 2002/0147311; 2004/0002587; 2005/0215768; 2007/0135620; 2007/0224188; 2008/0089892; WO 94/29351 и WO 99/58572). Дополнительные подходящие положения и конкретные замены аминокислот приведены в качестве примеров в таблицах 2 и 6-10 US 6737056; таблицах, представленных на фигуре 41 US 2006/024298; таблицах, представленных на фигурах 5, 12 и 15 US 2006/235208; таблицах, представленных на фигурах 8, 9 и 10 US 2006/0173170, и таблицах, представленных на фигурах 8-10, 13 и 14 WO 09/058492.

В конкретном варианте осуществления настоящее изобретение предусматривает вариант Fc, где Fc-участок содержит по меньшей мере одну замену, выбранную из группы, состоящей из 221K, 221Y, 225E, 225K, 225W, 228P, 234D, 234E, 234N, 234Q, 234T, 234H, 234Y, 234I, 234V, 234F, 235A, 235D, 235R, 235W, 235P, 235S, 235N, 235Q, 235T, 235H, 235Y, 235I, 235V, 235E, 235F, 236E, 237L, 237M, 237P, 239D, 239E, 239N, 239Q, 239F, 239T, 239H, 239Y, 240I, 240A, 240T, 240M, 241W, 241L, 241Y, 241E, 241R, 243W, 243L, 243Y, 243R, 243Q, 244H, 245A, 247L, 247V, 247G, 250E, 250Q, 251F, 252L, 252Y, 254S, 254T, 255L, 256E, 256F, 256M, 257C, 257M, 257N, 262I, 262A, 262T, 262E, 263I, 263A, 263T, 263M, 264L, 264I, 264W, 264T, 264R, 264F, 264M, 264Y, 264E, 265A, 265G, 265N, 265Q, 265Y, 265F, 265V, 265I, 265L, 265H, 265T, 266I, 266A, 266T, 266M, 267Q, 267L, 268E, 269H, 269Y, 269F, 269R, 270E, 280A, 284M, 292P, 292L, 296E, 296Q, 296D, 296N, 296S, 296T, 296L, 296I, 296H, 296G, 297S, 297D, 297E, 298A, 298H, 298I, 298T, 298F, 299I, 299L, 299A, 299S, 299V, 299H, 299F, 299E, 305I, 308F, 313F, 316D, 318A, 318S, 320A, 320S, 322A, 322S, 325Q, 325L, 325I, 325D, 325E, 325A, 325T, 325V, 325H, 326A, 326D, 326E, 326G, 326M, 326V, 327G, 327W, 327N, 327L, 328S, 328M, 328D, 328E, 328N, 328Q, 328F, 328I, 328V, 328T, 328H, 328A, 329F, 329H, 329Q, 330K, 330G, 330T, 330C, 330L, 330Y, 330V, 330I, 330F, 330R, 330H, 331G, 331A, 331L, 331M, 331F, 331W, 331K, 331Q, 331E, 331S, 331V, 331I, 331C, 331Y, 331H, 331R, 331N, 331D, 331T, 332D, 332S, 332W, 332F, 332E, 332N, 332Q, 332T, 332H, 332Y, 332A, 333A, 333D, 333G, 333Q, 333S, 333V, 334A, 334E, 334H, 334L, 334M, 334Q, 334V, 334Y, 339T, 370E, 370N, 378D, 392T, 396L, 416G, 419H, 421K, 428L, 428F, 433K, 433L, 434A, 424F, 434W, 434Y, 436H, 440Y и 443W согласно нумерации с помощью EU-индекса, как изложено у Kabat. Необязательно, Fc-участок может содержать дополнительные и/или альтернативные замены аминокислот, известные специалисту в данной области, в том числе, без ограничения, приведенные в качестве примеров в таблицах 2 и 6-10 US 6737056; таблицах, представленных на фигуре 41 US 2006/024298; таблицах, представленных на фигурах 5, 12 и 15 US 2006/235208; таблицах, представленных на фигурах 8, 9 и 10 US 2006/0173170, и таблицах, представленных на фигурах 8, 9 и 10 WO 09/058492.

В конкретном варианте осуществления настоящее изобретение предусматривает антитело с вариантом Fc, где Fc-участок содержит по меньшей мере одну модификацию (например, замены аминокислот, вставки аминокислот, делеции аминокислот) в одном или нескольких положениях, выбранных из группы, состоящей из 228, 234, 235 и 331 согласно нумерации с помощью EU-индекса, как изложено у Kabat. В одном варианте осуществления модификация представляет собой по меньшей мере одну замену, выбранную из группы, состоящей из 228P, 234F, 235E, 235F, 235Y и 331S согласно нумерации с помощью EU-индекса, как изложено у Kabat.

В другом конкретном варианте осуществления настоящее изобретение предусматривает антитело с вариантом Fc, где Fc-участок представляет собой Fc-участок IgG4 и содержит по меньшей мере одну модификацию в одном или нескольких положениях, выбранных из группы, состоящей из 228 и 235 согласно нумерации с помощью EU-индекса, как изложено у Kabat. В еще одном конкретном варианте осуществления Fc-участок представляет собой Fc-участок IgG4, а не встречающиеся в природе аминокислоты выбраны из группы, состоящей из 228P, 235E и 235Y согласно нумерации с помощью EU-индекса, как изложено у Kabat.

В другом конкретном варианте осуществления настоящее изобретение предусматривает вариант Fc, где Fc-участок содержит по меньшей мере одну не встречающуюся в природе аминокислоту в одном или нескольких положениях, выбранных из группы, состоящей из 239, 330 и 332 согласно нумерации с помощью EU-индекса, как изложено у Kabat. В одном варианте осуществления модификация представляет собой по меньшей мере одну замену, выбранную из группы, состоящей из 239D, 330L, 330Y и 332E согласно нумерации с помощью EU-индекса, как изложено у Kabat.

В конкретном варианте осуществления настоящее изобретение предусматривает антитело с вариантом Fc, где Fc-участок содержит по меньшей мере одну не встречающуюся в природе аминокислоту в одном или нескольких положениях, выбранных из группы, состоящей из 252, 254 и 256 согласно нумерации с помощью EU-индекса, как изложено у Kabat. В одном варианте осуществления модификация представляет собой по меньшей мере одну замену, выбранную из группы, состоящей из 252Y, 254T и 256E согласно нумерации с помощью EU-индекса, как изложено у Kabat. В особо предпочтительных антителах по настоящему изобретению модификация представляет собой три замены 252Y, 254T и 256E согласно нумерации с помощью EU-индекса, как изложено у Kabat (известные как "YTE"), см. U.S. 7083784.

В определенных вариантах осуществления эффекторные функции, проявляемые антителами IgG, в значительной степени зависят от углеводного компонента, соединенного с Fc-участком белка (Claudia Ferrara et al., 2006, Biotechnology and Bioengineering 93:851-861). Таким образом, гликозилирование Fc-участка можно модифицировать, чтобы усилить или ослабить эффекторную функцию (см., например, Umana et al., 1999, Nat. Biotechnol 17:176-180; Davies et al., 2001, Biotechnol Bioeng 74:288-294; Shields et al., 2002, J Biol Chem 277:26733-26740; Shinkawa et al., 2003, J Biol Chem 278:3466-3473; патенты США №№ 6602684; 6946292; 7064191; 7214775; 7393683; 7425446; 7504256; публикации США №№ 2003/0157108; 2003/0003097; 2009/0010921; технологию Potelligent™ (Biowa, Inc. Принстон, Нью-Джерси); инженерную технологию гликозилирования GlycoMAb™ (GLYCART Biotechnology AG, Цюрих, Швейцария)). Соответственно, в одном варианте осуществления Fc-участки антител по настоящему изобретению имеют измененное гликозилирование аминокислотных остатков. В другом варианте осуществления измененное гликозилирование аминокислотных остатков приводит к ослаблению эффекторной функции. В другом варианте осуществления измененное гликозилирование аминокислотных остатков приводит к усилению эффекторной функции. В конкретном варианте осуществления Fc-участок характеризуется пониженным фукозилированием. В другом варианте осуществления Fc-участок является нефукозилированным (см., например, публикацию заявки на патент США № 2005/0226867). В одном аспекте эти антитела с усиленной эффекторной функцией, например, ADCC, полученные в клетках-хозяевах (например, клетках CHO, Lemna minor), сконструированных для выработки антитела с высокой степенью дефукозилирования, имеющего более чем в 100 раз повышенную ADCC по сравнению с антителом, вырабатываемым исходными клетками (Mori et al., 2004, Biotechnol Bioeng 88:901-908; Cox et al., 2006, Nat Biotechnol., 24:1591-7).

Добавление сиаловой кислоты к олигосахаридам на молекулах IgG может усиливать их противовоспалительную активность и изменяет их цитотоксичность (Keneko et al., Science, 2006, 313:670-673; Scallon et al., Mol. Immuno. 2007 Mar;44(7):1524-34). Исследования, упомянутые выше, показывают, что молекулы IgG с повышенным сиалированием обладают противовоспалительными свойствами, тогда как молекулы IgG с пониженным сиалированием обладают усиленными иммуностимулирующими свойствами (например, повышают ADCC-активность). Таким образом, антитело можно модифицировать с помощью подходящего профиля сиалирования для конкретного терапевтического применения (публикация США № 2009/0004179 и международная публикация № WO 2007/005786).

В одном варианте осуществления Fc-участки антител по настоящему изобретению имеют измененный профиль сиалирования по сравнению с нативным Fc-участком. В одном варианте осуществления Fc-участки антител по настоящему изобретению имеют профиль повышенного сиалирования по сравнению с нативным Fc-участком. В другом варианте осуществления Fc-участки антител по настоящему изобретению имеют профиль пониженного сиалирования по сравнению с нативным Fc-участком.

В одном варианте осуществления варианты Fc по настоящему изобретению можно комбинировать с другими известными вариантами Fc, такими как раскрытые в Ghetie et al., 1997, Nat Biotech. 15:637-40; Duncan et al., 1988, Nature 332:563-564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al., 1992, Mol Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al., 1995, Proc Natl. Acad Sci USA 92:11980-11984; Jefferis et al., 1995, Immunol Lett. 44:111-117; Lund et al., 1995, Faseb J 9:115-119; Jefferis et al., 1996, Immunol Lett 54:101-104; Lund et al., 1996, J Immunol 157:4963-4969; Armour et al., 1999, Eur J Immunol 29:2613-2624; Idusogie et al., 2000, J Immunol 164:4178-4184; Reddy et al., 2000, J Immunol 164:1925-1933; Xu et al., 2000, Cell Immunol 200:16-26; Idusogie et al., 2001, J Immunol 166:2571-2575; Shields et al., 2001, J Biol Chem 276:6591-6604; Jefferis et al, 2002, Immunol Lett 82:57-65; Presta et al., 2002, Biochem Soc Trans 30:487-490); патентах США №№ 5624821; 5885573; 5677425; 6165745; 6277375; 5869046; 6121022; 5624821; 5648260; 6528624; 6194551; 6737056; 7122637; 7183387; 7332581; 7335742; 7371826; 6821505; 6180377; 7317091; 7355008; 2004/0002587; а также WO 99/58572. Другие модификации, и/или замены, и/или добавления, и/или делеции в Fc-домене будут абсолютно очевидны специалисту в данной области.

Гликозилирование

Кроме способности гликозилирования изменять эффекторную функцию антитела, модифицированное гликозилирование в вариабельном участке может изменять аффинность антитела к антигену. В одном варианте осуществления паттерн гликозилирования в вариабельном участке антител по настоящему изобретению является модифицированным. Например, можно создать негликозилированное антитело (т.е. антитело, у которого отсутствует гликозилирование). Гликозилирование можно изменить, например, с тем, чтобы повысить аффинность антитела к антигену. Таких углеводных модификаций можно достичь при помощи, например, изменения одного или нескольких сайтов гликозилирования в пределах последовательности антитела. Например, можно провести одну либо несколько замен аминокислот, которые приводят к удалению одного или нескольких сайтов гликозилирования в каркасной области вариабельного участка с устранением, таким образом, гликозилирования в этом сайте. Такое гликозилирование может повышать аффинность антитела к антигену. Такой подход более подробно описан в патентах США №№ 5714350 и 6350861. Также могут быть получены одна или несколько замен аминокислот, результатом чего является удаление сайта гликозилирования, представленного в Fc-участке (например, аспарагина 297 IgG). Более того, негликозилированные антитела можно получать в бактериальных клетках, которые не имеют необходимого аппарата гликозилирования.

Конъюгаты антител

В определенных вариантах осуществления антитела по настоящему изобретению являются конъюгированными или ковалентно связанными с веществом с использованием способов, хорошо известных из уровня техники. В одном варианте осуществления присоединенное вещество представляет собой терапевтическое средство, детектируемую метку (также называемую в данном документе репортерной молекулой) или твердую подложку. Подходящие вещества для присоединения к антителам включают, без ограничения, аминокислоту, пептид, белок, полисахарид, нуклеозид, нуклеотид, олигонуклеотид, нуклеиновую кислоту, гаптен, лекарственное средство, гормон, липид, ансамбль липидов, синтетический полимер, полимерную микрочастицу, биологическую клетку, вирус, флуорофор, хромофор, краситель, токсин, гаптен, фермент, антитело, фрагмент антитела, радиоактивный изотоп, твердые матрицы, полутвердые матрицы и их комбинации. Способы конъюгирования или ковалентного присоединения другого вещества к антителу хорошо известны из уровня техники.

В определенных вариантах осуществления антитела по настоящему изобретению конъюгированы с твердой подложкой. Антитела могут быть конъюгированы с твердой подложкой в качестве части способа скрининга, и/или очистки, и/или производства. Альтернативно, антитела могут быть конъюгированы с твердой подложкой в качестве части способа или композиции для диагностики. Твердая подложка, подходящая для применения в настоящем изобретении, обычно фактически нерастворима в жидких фазах. Специалисту в данной области доступно и известно большое число подложек. Таким образом, твердые подложки включают твердые и полутвердые матрицы, такие как аэрогели и гидрогели, смолы, гранулы, биочипы (в том числе биочипы с тонкопленочным покрытием), микрожидкостный чип, кремниевый чип, многолуночные планшеты (также называемые титрационными микропланшетами или микропланшетами), мембраны, проводящие и непроводящие металлы, стекло (в том числе предметные стекла) и намагниченные подложки. Более конкретные примеры твердых подложек включают силикагели, полимерные мембраны, частицы, дериватизированные полимерные пленки, стеклянные бусы, хлопок, полимерные гранулы, алюмогели, полисахариды, такие как сефароза, поли(акрилат), полистирол, поли(акриламид), полиол, агарозу, агар, целлюлозу, декстран, крахмал, фиколл, гепарин, гликоген, амилопектин, маннан, инулин, нитроцеллюлозу, диазоцеллюлозу, поливинилхлорид, полипропилен, полиэтилен (в том числе поли(этиленгликоль)), нейлон, латексную гранулу, магнитную гранулу, парамагнитную гранулу, суперпарамагнитную гранулу, крахмал и т.п.

В некоторых вариантах осуществления твердая подложка может содержать реакционноспособную функциональную группу, в том числе, без ограничения, гидроксил, карбоксил, амино, тиол, альдегид, галоген, нитро, циано, амидо, мочевину, карбонат, карбамат, изоцианат, сульфон, сульфонат, сульфонамид, сульфоксид и т.д., для присоединения антител по настоящему изобретению.

Подходящая твердофазная подложка может быть выбрана, исходя из желаемого конечного применения и пригодности для различных протоколов синтеза. Например, если образование амидной связи желательно для присоединения антител по настоящему изобретению к твердой подложке, можно использовать смолы, обычно применимые в синтезе пептидов, такие как полистирол (например, PAM-смола, получаемая из Bachem Inc., Peninsula Laboratories и др.), смола POLYHIPE™ (получаемая из Aminotech, Канада), полиамидная смола (получаемая из Peninsula Laboratories), полистирольная смола с привитым полиэтиленгликолем (TentaGel™, Rapp Polymere, Тюбинген, Германия), полидиметилакриламидная смола (доступная от Milligen/Biosearch, Калифорния) или гранулы PEGA (получаемые из Polymer Laboratories).

В определенных вариантах осуществления антитела по настоящему изобретению конъюгируют с метками с целью диагностики и других анализов, где антитело и/или его соответствующий лиганд могут быть выявлены. Метка, конъюгированная с антителом и применяемая в способах и композициях по настоящему изобретению, описанных в данном документе, представляет собой любой химический компонент, органический или неорганический, который характеризуется максимумом поглощения при длинах волн более 280 нм и сохраняет свои спектральные свойства при ковалентном присоединении к антителу. Метки включают, без ограничения, хромофор, флуорофор, флуоресцентный белок, фосфоресцентный краситель, тандемный краситель, частицу, гаптен, фермент и радиоактивный изотоп.

В определенных вариантах осуществления антитела конъюгированы с флуорофором. Соответственно, флуорофоры, применяемые для мечения антител по настоящему изобретению, включают, без ограничения, пирен (в том числе любое из соответствующих производных соединений, раскрытых в патенте США 5132432), антрацен, нафталин, акридин, стильбен, индол или бензиндол, оксазол или бензоксазол, тиазол или бензотиазол, 4-амино-7-нитробенз-2-окса-1,3-диазол (NBD), цианин (в том числе любые соответствующие соединения из патентов США №№ 6977305 и 6974873), карбоцианин (в том числе любые соответствующие соединения из заявки на патент США с регистрационным номером 09/557275; патентов США №№ 4981977; 5268486; 5569587; 5569766; 5486616; 5627027; 5808044; 5877310; 6002003; 6004536; 6008373; 6043025; 6127134; 6130094; 6133445 и публикаций WO 02/26891, WO 97/40104, WO 99/51702, WO 01/21624; EP 1065250 A1), карбостирил, порфирин, салицилат, антранилат, азулен, перилен, пиридин, хинолин, бораполиазаиндацен (в том числе любые соответствующие соединения, раскрытые в патентах США №№ 4774339; 5187288; 5248782; 5274113 и 5433896), ксантен (в том числе любые соответствующие соединения, раскрытые в патентах США №№ 6162931; 6130101; 6229055; 6339392; 5451343; 5227487; 5442045; 5798276; 5846737; 4945171; заявках на патенты США с регистрационным номером 09/129015 и 09/922333), оксазин (в том числе любые соответствующие соединения, раскрытые в патенте США № 4714763) или бензоксазин, карбазин (в том числе любые соответствующие соединения, раскрытые в патенте США №4810636), феналенон, кумарин (в том числе любые соответствующие соединения, раскрытые в патентах №№ 5696157; 5459276; 5501980 и 5830912), бензофуран (в том числе любые соответствующие соединения, раскрытые в патентах США №№ 4603209 и 4849362) и бензфеналенон (в том числе любые соответствующие соединения, раскрытые в патенте США № 4812409) и их производные. Как используется в данном документе, оксазины включают резоруфины (в том числе любые соответствующие соединения, раскрытые в 5242805), аминооксазиноны, диаминооксазины и их бензозамещенные аналоги.

В конкретном варианте осуществления флуорофоры, конъюгированные с антителами, описанными в данном документе, включают ксантен (родол, родамин, флуоресцеин и их производные), кумарин, цианин, пирен, оксазин и бораполиазаиндацен. В других вариантах осуществления такие флуорофоры представляют собой сульфированные ксантены, фторированные ксантены, сульфированные кумарины, фторированные кумарины и сульфированные цианины. Также включены красители, продаваемые под торговыми марками, и, как правило, известные как ALEXA FLUOR®, DyLight, красители CY®, BODIPY®, OREGON GREEN®, PACIFIC BLUE™, IRDYE®, FAM, FITC и ROX™.

Выбор флуорофора, присоединяемого к антителу, будет определять свойства поглощения и испускания флуоресценции конъюгированного антитела. Физические свойства флуорофорной метки, которую можно применять для антитела и связываемых антителом лигандов, включают, без ограничения, спектральные характеристики (поглощение, испускание и стоксов сдвиг), интенсивность, длительность, поляризацию флуоресценции и скорость обесцвечивания или их комбинацию. Все эти физические свойства можно применять для того, чтобы отличить один флуорофор от другого, и, таким образом, способствовать мультиплексному анализу. В определенных вариантах осуществления флуорофор имеет максимум поглощения при длинах волн более 480 нм. В других вариантах осуществления флуорофор поглощает при 488 нм - 514 нм или вблизи этих значений (что особенно подходит для возбуждения излучением аргонового ионного лазерного источника возбуждения) или вблизи 546 нм (что особенно подходит для возбуждения ртутной дуговой лампой). В другом варианте осуществления флуорофор может испускать в NIR (ближней инфракрасной области) для применения в тканях или во всем организме. Другие желаемые свойства флуоресцентной метки могут включать клеточную проницаемость и низкую токсичность, например, если мечение антитела необходимо проводить в клетке или организме (например, живом животном).

В определенных вариантах осуществления фермент представляет собой метку и конъюгирован с антителом, как описано в данном документе. Ферменты являются желательными метками, поскольку можно получить усиление детектируемого сигнала, приводящее к повышению чувствительности анализов. Сам фермент не вызывает детектируемый ответ, а действует путем разрушения субстрата при контакте с подходящим субстратом, так что превращаемый субстрат испускает флуоресцентный, колориметрический или люминесцентный сигнал. Ферменты усиливают детектируемый сигнал, поскольку один фермент в метящем реактиве может приводить к превращению нескольких субстратов в детектируемый сигнал. Субстрат для фермента выбирают так, чтобы получить предпочтительный измеримый продукт, например, колориметрический, флуоресцентный или хемилюминесцентный. Такие субстраты широко применяются в данной области техники и хорошо известны специалисту в данной области.

В одном варианте осуществления в комбинации колориметрического или флуорогенного субстрата и фермента применяются оксидоредуктазы, такие как пероксидаза хрена, и субстрат, такой как 3,3'-диаминобензидин (DAB) и 3-амино-9-этилкарбазол (AEC), которые дают отличительный цвет (коричневый и красный, соответственно). Другие колориметрические субстраты оксидоредуктаз, которые дают детектируемые продукты, включают, без ограничения: 2,2-азино-бис(3-этилбензотиазолин-6-сульфоновую кислоту) (ABTS), o-фенилендиамин (OPD), 3,3',5,5'-тетраметилбензидин (TMB), o-дианизидин, 5-аминосалициловую кислоту, 4-хлор-1-нафтол. Флуорогенные субстраты включают, без ограничения, гомованилиновую кислоту или 4-гидрокси-3-метоксифенилуксусную кислоту, восстановленные феноксазины и восстановленные бензотиазины, в том числе, реактив Amplex® Red и его варианты (патент США № 4384042) и восстановленные дигидроксантены, в том числе дигидрофлуоресцеины (патент США № 6162931) и дигидрородамины, в том числе дигидрородамин 123. Субстраты пероксидазы, которыми являются тирамиды (патенты США №№ 5196306; 5583001 и 5731158) представляют уникальный класс субстратов пероксидазы, поскольку по своей природе они могут быть выявлены до действия фермента, но под действием пероксидазы "фиксируются на месте" в процессе, описанном как тирамидное усиление сигнала (TSA). Эти субстраты широко используются для мечения антигена в образцах, которыми являются клетки, ткани или монослои, для их последующего выявления с помощью микроскопии, проточной цитометрии, оптического сканирования и флуорометрии.

В другом варианте осуществления в комбинации колориметрического (и в некоторых случаях флуорогенного) субстрата и фермента применяется фермент фосфатаза, такой как кислая фосфатаза, щелочная фосфатаза или рекомбинантный вариант такой фосфатазы, в комбинации с колориметрическим субстратом, таким как 5-бром-6-хлор-3-индолилфосфат (BCIP), 6-хлор-3-индолилфосфат, 5-бром-6-хлор-3-индолилфосфат, п-нитрофенилфосфат или o-нитрофенилфосфат, или с флуорогенным субстратом, таким как 4-метилумбеллиферилфосфат, 6,8-дифтор-7-гидрокси-4-метилкумаринилфосфат (DiFMUP, патент США № 5830912), флуоресцеиндифосфат, 3-O-метилфлуоресцеинфосфат, резоруфинфосфат, 9H-(1,3-дихлор-9,9-диметилакридин-2-он-7-ил)фосфат (DDAO-фосфат) или ELF 97, ELF 39 или родственные фосфаты (патенты США №№ 5316906 и 5443986).

Гликозидазы, в частности, бета-галактозидаза, бета-глюкуронидаза и бета-глюкозидаза, являются дополнительными подходящими ферментами. Подходящие колориметрические субстраты включают, без ограничения, 5-бром-4-хлор-3-индолил-бета-D-галактопиранозид (X-gal) и подобные индолилгалактозиды, глюкозиды и глюкурониды, o-нитрофенил-бета-D-галактопиранозид (ONPG) и п-нитрофенил-бета-D-галактопиранозид. В одном варианте осуществления флуорогенные субстраты включают резоруфин-бета-D-галактопиранозид, флуоресцеиндигалактозид (FDG), флуоресцеиндиглюкуронид и их структурные варианты (патенты США №№ 5208148; 5242805; 5362628; 5576424 и 5773236), 4-метилумбеллиферил-бета-D-галактопиранозид, карбоксиумбеллиферил-бета-D-галактопиранозид и фторированные кумарин-бета-D-галактопиранозиды (патент США № 5830912).

Дополнительные ферменты включают, без ограничения, гидролазы, такие как холинэстеразы и пептидазы, оксидазы, такие как глюкозооксидаза и цитохромоксидазы, и редуктазы, для которых известны подходящие субстраты.

Ферменты и их соответствующие субстраты, которые дают хемилюминесценцию, являются предпочтительными для некоторых анализов. Они включают, без ограничения, природные и рекомбинантные формы люцифераз и экворинов. Дополнительно подходят дающие хемилюминесценцию субстраты фосфатаз, гликозидаз и оксидаз, как, например, содержащие стабильные диоксетаны, люминол, изолюминол и сложные эфиры акридиния.

В другом варианте осуществления гаптены, такие как биотин, также используются в качестве меток. Биотин является подходящим, поскольку он может функционировать в ферментной системе для дополнительного усиления детектируемого сигнала, и он может функционировать в качестве метки для применения в аффинной хроматографии с целью выделения. В целях выявления применяют конъюгат фермента, который характеризуется аффинностью к биотину, такой как авидин-HRP. Затем добавляют субстрат пероксидазы для получения детектируемого сигнала.

Гаптены также включают гормоны, встречающиеся в природе и синтетические лекарственные средства, загрязнители, аллергены, эффекторные молекулы, факторы роста, хемокины, цитокины, лимфокины, аминокислоты, пептиды, промежуточные химические соединения, нуклеотиды и т.п.

В определенных вариантах осуществления флуоресцентные белки могут быть конъюгированы с антителами в качестве метки. Примеры флуоресцентных белков включают зеленый флуоресцентный белок (GFP) и фикобилипротеины и их производные. Флуоресцентные белки, в частности, фикобилипротеин, особенно полезны для получения метящих реактивов на основе тандемных красителей. Эти тандемные красители содержат флуоресцентный белок и флуорофор с целью получения большего стоксового сдвига, где спектр испускания дальше смещен от длины волны спектра поглощения флуоресцентного белка. Это является особенно преимущественным для выявления небольшого количества антигена в образце, где испускаемый флуоресцентный свет максимально оптимизирован, другими словами, испускаемый свет повторно поглощается флуоресцентным белком в незначительном количестве или совсем не поглощается. С этой целью флуоресцентный белок и флуорофор функционируют в качестве пары для переноса энергии, при этом флуоресцентный белок испускает при длине волны, при которой флуорофор поглощает, а затем флуорофор испускает при длине волны, смещенной относительно флуоресцентных белков дальше, чем можно было бы получить с помощью только флуоресцентного белка. Особенно подходящей комбинацией является фикобилипротеины, раскрытые в патентах США №№ 4520110; 4859582; 5055556, и сульфородаминовые флуорофоры, раскрытые в патенте США № 5798276, или сульфированные цианиновые флуорофоры, раскрытые в патентах США №№ 6977305 и 6974873; или сульфированные производные ксантена, раскрытые в патенте США № 6130101, и их комбинации, раскрытые в патенте США № 4542104. Альтернативно, флуорофор функционирует в качестве донора энергии, а флуоресцентный белок является акцептором энергии.

В определенных вариантах осуществления меткой является радиоактивный изотоп. Примеры подходящих радиоактивных материалов включают, без ограничения, йод (121I, 123I, 125I, 131I), углерод (14C), серу (35S), тритий (3H), индий (111In, 112In, 113mIn, 115mIn), технеций (99Tc, 99mTc), таллий (201Ti), галлий (68Ga, 67Ga), палладий (103Pd), молибден (99Mo), ксенон (135Xe), фтор (18F), 153Sm, 177Lu, 159Gd, 149Pm, 140La, 175Yb, 166Ho, 90Y, 47Sc, 186Re, 188Re, 142Pr, 105Rh и 97Ru.

Способы медицинского лечения и пути применения

Антитела и их связывающие фрагменты по настоящему изобретению и их варианты можно применять для лечения инфекции, вызванной вирусом гриппа А, для предупреждения инфекции, вызванной вирусом гриппа А, и/или для выявления, диагностики и/или прогнозирования течения инфекции, вызванной вирусом гриппа А.

Способы диагностики могут включать приведение антитела или фрагмента антитела в контакт с образцом. Такими образцами могут быть образцы тканей, полученные, например, из носовых ходов, околоносовых пазух, слюнных желез, легкого, печени, поджелудочной железы, почки, уха, глаза, плаценты, пищеварительного канала, сердца, яичников, гипофиза, надпочечников, щитовидной железы, головного мозга или кожи. Способы выявления, диагностики и/или прогнозирования могут также включать выявление комплекса антиген/антитело.

В одном варианте осуществления настоящее изобретение предусматривает способ лечения субъекта путем введения субъекту эффективного количества антитела или его связывающего фрагмента в соответствии с настоящим изобретением или фармацевтической композиции, которая содержит антитело или его связывающий фрагмент. В одном варианте осуществления антитело или его связывающий фрагмент являются фактически очищенными (т.е. фактически не содержащими соединений, которые ограничивают их эффект или вызывают нежелательные побочные эффекты). В одном варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению вводят после воздействия, или после того, как субъект претерпел воздействие вируса гриппа А или был инфицирован вирусом гриппа A. В другом варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению вводят до воздействия, или субъекту, который еще не претерпел воздействие вируса гриппа А или еще не был инфицирован вирусом гриппа A. В одном варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению вводят субъекту, который является серонегативным по одному или нескольким подтипам вируса гриппа A. В другом варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению вводят субъекту, который является серопозитивным по одному или нескольким подтипам вируса гриппа A. В одном варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению вводят субъекту в рамках периода 1, 2, 3, 4, 5 дней после появления инфекции или симптома. В другом варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению можно вводить субъекту через 1, 2, 3, 4, 5, 6 или 7 дней, или в рамках периода 2, 3, 4, 5, 6, 7, 8, 9 или 10 дней после появления инфекции или симптома.

В одном варианте осуществления с помощью способа ослабляют инфекцию, вызванную вирусом гриппа А, у субъекта. В другом варианте осуществления с помощью способа предупреждают инфекцию, вызванную вирусом гриппа А, снижают риск ее развития или замедляют ее развитие у субъекта. В одном варианте осуществления субъектом является млекопитающее. В более конкретном варианте осуществления субъектом является человек. В одном варианте осуществления субъект включает, без ограничения, того, кто в особенности имеет риск развития инфекции, вызванной вирусом гриппа А, или восприимчив к ней, в том числе, например, субъекта с ослабленным иммунитетом.

Лечение может проходить по схеме введения однократной дозы или по схеме введения многократных доз, и антитело или его связывающий фрагмент по настоящему изобретению можно применять в пассивной иммунизации.

В одном варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению вводят субъекту в комбинации с одним или несколькими противовирусными лекарственными препаратами. В одном варианте осуществления антитело или его связывающий фрагмент по настоящему изобретению вводят субъекту в комбинации с одним или несколькими низкомолекулярными противовирусными лекарственными препаратами. Низкомолекулярные противовирусные лекарственные препараты включают ингибиторы нейраминидазы, такие как озельтамивир (TAMIFLU®), занамивир (RELENZA®), и адамантаны, такие как амантадин и римантадин.

В другом варианте осуществления настоящее изобретение предусматривает композицию для применения в качестве лекарственного препарата для предупреждения или лечения инфекции, вызванной вирусом гриппа А. В другом варианте осуществления настоящее изобретение предусматривает применение антитела или его связывающего фрагмента по настоящему изобретению и/или белка, содержащего эпитоп, с которым связываются антитело или его связывающий фрагмент по настоящему изобретению, в производстве лекарственного препарата для лечения субъекта и/или диагностики у субъекта.

Антитела и их фрагменты, как описано в настоящем изобретении, можно также применять в наборе для диагностики инфекции, вызванной вирусом гриппа А. Кроме того, эпитопы, способные к связыванию антитела по настоящему изобретению, можно применять в наборе для отслеживания эффективности процедур вакцинации по выявлению наличия защитных антител к вирусу гриппа A. Антитела, фрагменты антител или их варианты и производные, как описано в настоящем изобретении, можно также применять в наборе для отслеживания производства вакцин с желаемой иммуногенностью.

Настоящее изобретение предусматривает способ получения фармацевтической композиции, который включает этап смешивания моноклонального антитела с одним или несколькими фармацевтически приемлемыми носителями, при этом антитело представляет собой моноклональное антитело в соответствии с настоящим изобретением, описанное в данном документе.

Для введения антитела или его связывающего фрагмента по настоящему изобретению известны и могут применяться различные системы доставки, в том числе, без ограничения, инкапсулирование в липосомы, микрочастицы, микрокапсулы, рекомбинантные клетки, способные к экспрессии антитела или фрагмента антитела, опосредованный рецепторами эндоцитоз, конструирование нуклеиновой кислоты как части ретровирусного или другого вектора, доставка "оголенных" нуклеиновых кислот с использованием технологии доставки путем электропорации (как описано в Muthumani et al., PLoS One. 2013 Dec 31;8(12):e84234. doi: 10.1371/journal.pone.0084234. eCollection 2013 и т.д.). Способы введения включают, без ограничения, внутрикожные, внутримышечные, внутрибрюшинные, внутривенные, подкожные, интраназальные, эпидуральные и пероральные пути. Композиции можно вводить любым удобным путем, например, путем инфузии или болюсной инъекции, путем всасывания через эпителиальные или кожно-слизистые покровы (например, слизистую оболочку ротовой полости, слизистую оболочку прямой кишки и кишечника и т.д.), и их можно вводить совместно с другими биологически активными средствами, в том числе, без ограничения, низкомолекулярными противовирусными композициями. Введение может быть системным или местным. Также можно использовать легочное введение, например, путем применения ингалятора или распылителя и состава с аэрозольным средством. В еще одном варианте осуществления композиция может доставляться в системе с контролируемым высвобождением.

Настоящее изобретение также предусматривает фармацевтические композиции. Такие композиции содержат терапевтически эффективное количество антитела или его связывающего фрагмента по настоящему изобретению, и фармацевтически приемлемый носитель. Выражение "фармацевтически приемлемый", как используется в данном документе, означает одобренный регулирующим ведомством федерального правительства или правительства штата или указанный в Фармакопее США или другой общепризнанной фармакопее как применяемый у животных и более конкретно у людей. Выражение "носитель" относится к разбавителю, вспомогательному средству, наполнителю или основе, с которыми вводят терапевтическое средство. Такие фармацевтические носители могут быть стерильными жидкостями, такими как вода и масла, в том числе нефтяного, животного, растительного или синтетического происхождения, такими как арахисовое масло, соевое масло, минеральное масло, кунжутное масло и т.п. Вода является предпочтительным носителем, если фармацевтическую композицию вводят внутривенно. Солевые растворы и водные растворы декстрозы и глицерина также можно использовать в качестве жидких носителей, в частности, для растворов для инъекций. Подходящие фармацевтические наполнители включают крахмал, глюкозу, лактозу, сахарозу, желатин, солод, рис, муку, мел, силикагель, стеарат натрия, моностеарат глицерина, тальк, хлорид натрия, сухое обезжиренное молоко, глицерин, пропиленгликоль, воду, этанол и т.п. Композиция при желании также может содержать незначительные количества смачивающих или эмульгирующих веществ или рН-буферных средств. Эти композиции могут иметь форму растворов, суспензий, эмульсии, таблеток, пилюль, капсул, порошков, составов с замедленным высвобождением и т.п. Композицию также можно составить в виде суппозитория с традиционными связывающими средствами и носителями, такими как триглицериды. Состав для перорального применения может содержать стандартные носители, такие как маннит, лактоза, крахмал, стеарат магния, сахарин натрия, целлюлоза, карбонат магния фармацевтической степени чистоты и т.д. В одном варианте осуществления фармацевтическая композиция содержит терапевтически эффективное количество антитела или его связывающего фрагмента, предпочтительно в очищенной форме, вместе с количеством носителя, подходящим для того, чтобы придать форму для надлежащего введения пациенту. Состав должен соответствовать способу введения.

Обычно для терапевтических средств на основе антител доза, вводимая пациенту, составляет от приблизительно 0,1 мг/кг до 100 мг/кг веса тела пациента.

Перечень фигур

На фигуре 1A представлено связывание антитела 3 и антитела 12 с экспрессируемым на поверхности белком HA подтипов H11, H12, H13, H16, H17, H4, H10, H14 и H15. На гистограммах изображена зависимость числа клеток от интенсивности флуоресценции антитела, связывающегося с трансфицированными HA клетками - белым цветом или ложнотрансфицированными клетками - серым цветом. На фигуре 1B представлен процент ингибирования индуцированного низким рН слияния куриных эритроцитов и A/Пуэрто-Рико/8/34 в присутствии антитела 3, антитела 12 или MPE8v3 (нерелевантного антитела к вирусному белку, обеспечивающему слияние) (Corti D et al., 2013, Nature 501). На фигурах 1C и 1D представлены иммуноблоты нерасщепленного (HA0), рекомбинантного HA H1 после расщепления трипсином в течение 5, 10 или 20 минут. Реакционные смеси для расщепления содержали HA в отдельности (исходный компонент) либо HA, предварительно обработанный FI6v4 (раскрыто в WO2013/011347A1), антителом 3, FE17.23 (mAb, специфичным к глобулярной головке) (Corti D et al., 2010, J Clin Invest 120) или нерелевантным контрольным антителом (контрольный IgG), на 1C, и HA в отдельности (исходный компонент) либо HA, предварительно обработанный антителом 3, антителом 12, антителом 14 или нерелевантным контрольным антителом (контрольный IgG), на 1D.

На фигуре 2 представлен процент опосредованного клетками NK уничтожения клеток MDCK, инфицированных A/HK/8/68, в присутствии возрастающего количества антитела 3, антитела 11, антитела 12 и антитела 14.

На фигуре 3 представлен процент макрофагов, которые подвергали фагоцитозу клетки-мишени MDCK, экспрессирующие HAA/HK/8/68, в присутствии возрастающего количества антитела 3, антитела 11, антитела 12 и антитела 14 или нерелевантного изотипического контроля (контрольный IgG).

На фигуре 4 представлен процент комплементзависимого уничтожения клеток MDCK, инфицированных A/PR/8/34, в присутствии возрастающего количества антитела 3, антитела 11, антитела 12 и антитела 14.

На фигуре 5 представлен процент выживших животных в каждой группе исследования, где мышам вводили различные концентрации антитела 3 и нерелевантного контрольного антитела (контрольный IgG) за 4 часа до инфицирования смертельной дозой вируса гриппа H1N1.

На фигуре 6 представлен процент выживших животных в каждой группе исследования, в которой мышам вводили различные концентрации антитела 3 и нерелевантного контрольного антитела (контрольный IgG) за 4 часа до инфицирования смертельной дозой вируса гриппа H3.

На фигуре 7 представлен процент выживших животных в каждой группе, где мышей инфицировали смертельной дозой вируса гриппа H1N1 и обрабатывали в различные моменты времени (через 1 и 2 дня после инфицирования) 30 мг/кг антитела 3 или нерелевантного контрольного антитела (контрольный IgG).

На фигуре 8 представлен процент выживших животных в каждой группе исследования, в которой мышей инфицировали смертельной дозой вируса гриппа H3 и обрабатывали в различные моменты времени (через 3, 4 и 5 дней после инфицирования) 30 мг/кг антитела 3 или нерелевантного контрольного антитела (контрольный IgG).

На фигуре 9 представлен процент выживших животных в каждой группе исследования, в которой мышей инфицировали смертельной дозой вируса гриппа H1N1 и обрабатывали через 1 день после инфицирования 2 мг/кг антитела 3, антитела 11, антитела 12, антитела 14 или нерелевантного контрольного антитела (контрольный IgG).

На фигуре 10 представлен процент выживших животных в каждой группе исследования, в которой мышей инфицировали смертельной дозой вируса гриппа H3 и обрабатывали через 2 дня после инфицирования 3 мг/кг антитела 3, антитела 11, антитела 12, антитела 14 или нерелевантного контрольного антитела (контрольный IgG).

На фигуре 11 представлен процент выживших животных в каждой группе исследования, в которой мышей инфицировали смертельной дозой вируса гриппа H1N1, и обработку с помощью 25 мг/кг озельтамивира BID в течение 5 дней, 10 мг/кг антитела 12 или 10 мг/кг нерелевантного контрольного антитела (контрольный IgG) начинали в различные моменты времени (за 4 часа до, через 1 день после или через 2 дня после инфицирования).

На фигуре 12 представлен процент выживших животных в каждой группе исследования, в которой мышей инфицировали смертельной дозой вируса гриппа H3, и обработку с помощью 25 мг/кг озельтамивира для перорального применения BID в течение 5 дней или однократной дозы 10 мг/кг антитела 12 или 10 мг/кг нерелевантного контрольного антитела (контрольный IgG) начинали в различные моменты времени (через 1, 2, 3 или 4 дня после инфицирования).

На фигуре 13 представлен процент выживших животных в каждой группе исследования, где мышей инфицировали смертельной дозой вируса гриппа H3 и обрабатывали через 2 дня после инфицирования антителом 12 в однократной дозе 2,5 мг/кг или 0,3 мг/кг, озельтамивиром при 25 мг/кг BID в течение 5 дней или комбинацией антитела 12 при 2,5 мг/кг или 0,3 мг/кг и озельтамивира при 25 мг/кг BID в течение 5 дней.

На фигуре 14 представлен процент выживших хорьков в каждой группе исследования после инфицирования смертельной дозой вируса гриппа H5N1 и обработки с помощью антитела 12 в однократной дозе 25 мг/кг, 25 мг/кг озельтамивира BID в течение 5 дней или нерелевантного контрольного антитела (контрольный IgG) через 1, 2 или 3 дня после инфицирования.

На фигуре 15 представлено выравнивание последовательностей белка HA2 различных штаммов вируса гриппа A, применяемых при выборе MARM.

Примеры

Пример 1. Конструирование и оптимизация человеческих моноклональных антител, выделенных из B-клеток памяти

CD22+ IgG+ B-клетки отсортировывали от криоконсервированных мононуклеарных клеток периферической крови (PBMC) донора, выбранного по высоким титрам гетеросубтипических антител, и иммортализировали по 3 клетки/лунка с использованием вируса Эпштейна-Барр (EBV) и олигодезоксинуклеотида CpG 2006, а также питающих клеток. Надосадочные жидкости культур, содержащие антитела, собирали через 14 дней и подвергали скринингу с помощью анализа связывания ELISA для определения активности связывания с гемагглютинином (HA) H5 (A/Вьетнам/1203/04) и H7 (A/NLD/03), соответственно. Было обнаружено, что четыре клона B-клеток (антитело 1, антитело 4, антитело 7 и антитело 9) специфично связываются с обоими HA, и поэтому они были собраны. Гены VH и VL этих клонов были секвенированы, и было обнаружено, что в соответствии с анализом гомологии, проведенным на V-, D- и J-фрагментах VH и VL с использованием базы данных Kabat, они являются клонально родственными. Следует отметить, что VH антитела 4, как было обнаружено, имеет вырожденный нуклеотидный сайт в HCDR3, который кодирует валин (кодируемый в антителе 5) либо глутамат (кодируемый в антителе 6). Гены VH и VL четырех антител клонировали в векторы экспрессии IgG1 (незначительные модификации последовательностей с целью облегчения клонирования и/или оптимизации кодонов привели к образованию пяти антител: антитела 3, антитела 5, антитела 6, антитела 8 и антитела 10, применяемых в следующих примерах), и рекомбинантные антитела получали с помощью транзиентной трансфекции линий клеток млекопитающих, происходящих из клеток HEK или CHO. Надосадочные жидкости культур трансформированных клеток собирали через 7-10 дней после культивирования, и IgG подвергали аффинной очистке путем хроматографии с белком А и диализу против PBS. Антитело 3 дополнительно оптимизировали с получением вариантов, в которых находящиеся в каркасных областях соматические мутации, кодируемые в конфигурации, отличной от конфигурации зародышевого типа, заменяли на аминокислоту, кодируемую в конфигурации зародышевого типа, а участки CDR подвергали экономному мутагенезу. Полные конструкции IgG, содержащие различные мутации, экспрессировали, как описано выше, и неочищенные надосадочные жидкости подвергали скринингу с помощью ELISA с целью выбора клонов, которые характеризовались повышенной активностью связывания с белками HA H3 и H1. ELISA выполняли с применением покрывающего кроличьего антитела к человеческому IgG в концентрации 0,15 мкг/мл для захвата и нормализации IgG из образцов надосадочной жидкости, а затем добавляли 0,5 мкг/мл биотинилированного HA подтипа H1 (A/Калифорния/7/04 (H1N1)) или подтипа H3 (A/Перт/16/09 (H3N2)) и инкубировали в течение часа. Связывание выявляли с помощью добавления конъюгата стрептавидин-HRP (1:5000), и поглощение, необходимое для проявления, считывали при 450 нм. Полезные одиночные мутации, обеспечивающие более эффективное связывание, объединяли и клонировали в комбинаторную библиотеку, которую экспрессировали и подвергали скринингу с помощью ELISA, как описано выше. Этот библиотечный подход привел к созданию 5 дополнительных вариантов антитела 3, которые были охарактеризованы дополнительно (антитела 11-15).

Пример 2. Нейтрализующее антитело (nAb) к HA связывается с различными подтипами HA

Для того, чтобы исследовать, является ли эпитоп для антител к HA консервативным среди HA различных подтипов, проводили анализ связывания ELISA в отношении перекрестной реактивности к HA. 384-луночный планшет для ELISA Maxisorb (Nunc) покрывали на ночь при 4°C 0,5 мкг/мл рекомбинантного HA (rHA), подтипа H1 (A/Калифорния/7/09 (H1N1)), подтипа H2 (A/свинья/MO/06 (H2N3)), подтипа H3 (A/Перт/16/09 (H3N2)), подтипа H5 (A/Вьетнам/1203/04(H5N1)), подтипа H6 (A/чирок/HK/W312/97(H6N1)), подтипа H7 (A/Нидерланды/219/03(H7N7)) и подтипа H9 (A/курица/HK/G9/97(H9N2)) в PBS. Планшет промывали с помощью PBS, содержащего 0,1% объем/объем Tween-20, с удалением непокрытого белка, а затем добавляли блокирующий раствор, содержащий 1% (вес/объем) казеина (Thermo Scientific), и инкубировали в течение 1 ч. при комнатной температуре. Блокирующий раствор сливали, и добавляли антитела к HA в 3-кратном серийном разведении в блокирующем растворе (казеин-PBS (Thermo Scientific)) и инкубировали в течение 1 ч. при комнатной температуре. Планшет промывали три раза, и связанные антитела выявляли с помощью конъюгированного с пероксидазой мышиного антитела к человеческому IgG (Jackson). Активность связывания антитела рассчитывали путем измерения хемилюминесцентного сигнала после добавления субстрата Supersignal Pico (Thermo Scientific) либо путем измерения изменения цвета при 450 нм после инкубирования с однокомпонентным субстратом тетраметилбензидином (TMB) (KPL) с последующим добавлением 2 н. серной кислоты для остановки реакции.

Таблица 1
Связывание с rHA с использованием ELISA (EC50, мкг/мл)
H1 A/CA/
7/09
H2 A/
свинья/
MO/06
H5 A/VN/
1203/
04
H6 A/HK/
W312/
97
H9 A/HK/G9/
97
H3 A/
Перт/
16/
09
H7 A/NLD/
219/
03
Антитело 3 0,026 0,028 0,022 0,043 0,012 0,019 0,020
Антитело 5 0,045 0,048 0,041 0,047 >6 0,030 0,024
Антитело 6 0,311 0,213 0,256 0,214 >6 0,064 0,116
Антитело 8 0,069 0,058 0,044 0,091 >6 0,067 0,015
Антитело 10 0,073 0,075 0,058 0,097 2,699 0,049 0,034

В таблице 1 показано, что все исследуемые антитела IgG к HA связывались с рекомбинантным HA подтипов H1, H2, H3, H5, H6, H9 и H7. Рекомбинантный HA подтипа H9 распознавался антителом 3 и антителом 10, но не антителом 5, антителом 6 и антителом 8 при наибольшей концентрации исследуемого антитела (6 мкг/мл). Это указывает на то, что эпитопы для большинства из этих антител IgG к HA являются консервативными среди молекул HA различных подтипов.

Таблица 2
Связывание с rHA с использованием ELISA (EC50, мкг/мл)
H1 A/CA/
7/09
H2 A/свинья/
MO/06
H5 A/VN/
1203/
04
H6 A/HK/
W312/
97
H9 A/HK/
G9/97
H3 A/Перт/
16/09
H7 A/NLD/
219/
03
Антитело 3 0,045 0,095 0,099 0,072 0,171 0,129 0,258
Антитело 11 0,085 0,126 0,168 0,129 0,164 0,176 0,553
Антитело 12 0,059 0,088 0,084 0,083 0,098 0,028 0,061
Антитело 13 0,050 0,062 0,080 0,097 0,161 0,023 0,049
Антитело 14 0,048 0,079 0,061 0,073 0,095 0,030 0,064
Антитело 15 0,028 0,042 0,035 0,043 0,065 0,032 0,035

В таблице 2 показано, что все исследуемые антитела IgG к HA связывались с рекомбинантным HA подтипов H1, H2, H5, H6 и H9 группы 1 со сходными значениями EC50. Все варианты связывались с белками HA группы 2 (H3 и H7), однако, антитело 11 и антитело 3 характеризовались пониженной активностью при повышенных значениях EC50 по сравнению с антителами 12-15.

Чтобы расширить эти результаты исследования связывания для включения более разнообразных подтипов HA, были проведены дополнительные исследования связывания с применением связывания с трансфицированными НА клетками на основе проточной цитометрии. В этом анализе клетки HEK подвергали транзиентной трансфекции плазмидами, экспрессирующими НА дикого типа полной длины подтипа H4 (A/утка/Чехословакия/56 (H4N6)), подтипа H10 (A/курица/Германия/N49 (H10N7)), подтипа H11 (A/утка/Мемфис/546/74 (H11N9)), подтипа H12 (A/утка/Альберта/60/76 (H12N5)), подтипа H13 (A/чайка/Мэриленд/704/77 (H13N6)), подтипа H14 (A/кряква/Астрахань/263/82 (H14N5)), подтипа H15 (A/буревестник/Западная Австралия/2576/79 (H15N9)), подтипа H16 (A/озерная чайка/Швеция/2/99 (H16N3)) и подтипа H17 (A/малый желтоплечий листонос/Гватемала/164/2009 (H17N10)). Через сорок восемь часов после трансфекции клетки отделяли с помощью трипсина и инкубировали с 5 мкг/мл антитела 3 или антитела 12 на льду в течение 1 часа. После инкубирования в течение часа антитело, связанное с белком HA, экспрессируемым на клеточной поверхности, затем окрашивали козьим антителом к человеческому IgG DyLight 649 (Jackson ImmunoResearch) и выявляли с помощью проточной цитометрии. На фигуре 1A представлен сдвиг интенсивности флуоресценции в том случае, когда антитело связано с клетками, экспрессирующими HA каждого из подтипов (белым цветом), в сравнении с ложнотрансфицированными клетками (серым цветом). Антитело 3 связывалось со всеми исследуемыми HA, за исключением H12, тогда как антитело 12 связывалось со всеми исследуемыми HA из обеих групп (H11, H12, H13, H16 и H17 в группе 1 и H4, H10, H14 и H15 в группе 2).

Пример 3. Получение кинетических характеристик связывания HA с антителом 3 и антителом 5 IgG1 с применением Octet

Измерения аффинности проводили с помощью кинетического анализатора ForteBio Octet QK 384 (Менло-Парк, Калифорния) в 384-луночных планшетах со скошенными краями. Все реактивы разбавляли в буфере для кинетического анализа Octet (ForteBio). His-меченный HA различных подтипов: подтипа H1 (A/Калифорния/7/04 (H1N1)) и подтипа H3 (A/Перт/16/09 (H3N2)) иммобилизовали на сенсорах на основе антител к His при 10 мкг/мл. Ассоциацию/диссоциацию mAb к НА затем отслеживали в 2-кратных разведениях от 100 нМ, также использовали нулевое контрольное mAb.

В первичные данные по ассоциации и диссоциации затем вносили поправку на любое смещение в нулевых контрольных mAb, и затем их экспортировали в GraphPad Prism (Сан-Диего, Калифорния) для аппроксимации кривой аффинности. Аппроксимацию данных проводили с применением глобальной аппроксимации данных об ассоциации/диссоциации с заданным пределом > 5×10-6 с-1. Как показано в таблице 3, оба антитела характеризуются очень высокой аффинностью связывания с H1 на уровне пM и низкой скоростью диссоциации ниже предела выявления. Сходные Kon, Koff и Kd обеих антител наблюдали для тримера H3 на суб-нM уровне.

Таблица 3
Кинетический анализ связывания панспецифических mAb к вирусу гриппа A с rHA с использованием Octet
H1 A/CA/7/09 H3 A/Перт/16/09
Kon
(e5 M-1с-1)
Koff
(e-6с-1)
Kd (пM) Kon
(e5 M-1с-1)
Koff
(e-6с-1)
Kd (пM)
Антитело 3 5,3 <5 11 3,3 62 188
Антитело 5 10 <5 5 2,6 88 338

Пример 4. Нейтрализующая активность перекрестно реагирующих антител IgG1 к HA in vitro в отношении различных подтипов вируса

Анализ микронейтрализации (MNA) представлял собой модификацию ранее описанного анализа ускоренного ингибирования вируса с применением активности нейраминидазы (NA) в качестве регистрируемого показателя (Hassantoufighi, A. et al. 2010, Vaccine 28:790). Вкратце, MNA проводили на клетках MDCK, которые культивировали в среде MEM (Invitrogen), дополненной антибиотиками, глутамином (полная среда MEM) и 10% (объем/объем) фетальной бычьей сывороткой. 60 TCID50 (50% инфицирующих доз для культуры тканей) вируса добавляли к антителу в трехкратных разведениях в 384-луночном планшете в полной среде MEM, содержащей 0,75 мкг/мл трипсина (Worthington) в дублирующих лунках, после инкубирования в течение 30 минут при комнатной температуре в планшет добавляли 2×104 клеток/лунка. После инкубирования при 33oC в инкубаторе с 5% CO2 в течение примерно 40 ч. активность NA измеряли путем добавления флуоресцентно-меченного субстрата, метилумбеллиферил-N-ацетилнейраминовой кислоты (MU-NANA) (Sigma), в каждую лунку и инкубирования при 37oC в течение 1 часа. Репликацию вируса, представленную активностью NA, количественно определяли путем считывания данных о флуоресценции во флуориметре Envision (PerkinElmer) с применением следующих установочных параметров: длина волны возбуждения 355 нм, длина волны испускания 460 нм; 10 вспышек на лунку. Титр нейтрализации (50% ингибирующую концентрацию [IC50]) выражали в виде конечной концентрации антитела, которая ослабляла сигнал флуоресценции на 50% по сравнению с лунками с контрольными клетками. В таблице 4 и 5 показаны антитела к HA, нейтрализующие вирусы гриппа A различных подтипов, исследуемых ниже: H1-PR34 (A/Пуэрто-Рико/8/34 (H1N1)); H1-PR34-OR (A/Пуэрто-Рико/8/34, содержащий мутацию 274Y NA (нумерация по N2), придающую устойчивость к озельтамивиру (H1N1)); H1-FM47 (A/Форт-Монмаут/1/47 (H1N1)); H1-NJ76 (A/Нью-Джерси/8/76 (H1N1)); H1-Kaw86 (A/Кавасаки/9/86 (H1N1)); H1-TX91 (ca A/Техас/36/91 (H1N1)); H1-BJ95 (ca A/Пекин/262/95 (H1N1)); H1-Ncal99 (ca A/Новая Каледония/20/99 (H1N1)); H1-SD07 (ca A/Южная Дакота/6/07 (H1N1)); H1-CA09 (ca A/Калифорния/7/09 (H1N1)); H1-CA09-OR (ca A/Калифорния/7/09, содержащий мутацию 274Y NA (нумерация по N2), придающую устойчивость к озельтамивиру (H1N1)); H5-VN04 (ca A/Вьетнам/1203/04 (H5N1)); H5-HK03 (ca A/Гонконг/213/03 (H5N1)); H9-HK97 (ca A/курица/Гонконг/G9/97 (H9N2); H2-JP57 (ca A/Япония/57 (H2N2)); H2-MO06 (ca A/свинья/Миссури/06 (H2N3)); H6-HK97 (ca A/чирок/Гонконг/W312/97 (H6N1)); H6-AB85 (ca A/кряква/Альберта/89/85 (H6N2)); H3-HK68 (A/Гонконг/8/68 (H3N2)); H3-Vic75 (A/Виктория/3/75 (H3N2)); H3-LA87 (A/Лос-Анджелес/7/09 (H3N2)); H3-SD93 (A/Шаньдун/9/93 (H3N2)); H3-WH95 (ca A/Ухань/359/95 (H3N2)); H3-Syd97 (ca A/Сидней/5/97 (H3N2)); H3-WH95-OR (ca A/Ухань/359/95, содержащий мутацию 274Y NA (нумерация по N2), придающую устойчивость к озельтамивиру (H3N2)); H3-Pa99 (ca A/Панама/2007/99 (H3N2)); H3-Wy03 (A/Вайоминг/03/03 (H3N2)); H3-WI05 (A/Висконсин/67/05 (H3N2)); H3-Perth09 (ca A/Перт/16/09 (H3N2)), H3-VC11 (A/Виктория/361/11 (H3N2)); H7-NLD03 (ca A/Нидерланды/219/03 (H7N7)); H7-BC04 (ca A/Британская Колумбия/CN-6/04 (H7N3-LP); H7-ANU13 (ca A/Аньхой/1/13 (H7N9).

Таблица 4
Вирус Нейтрализация инфекционных вирусов
(IC50, мкг/мл)
Антитело 3 Антитело 5 Антитело 6 Антитело 8 Антитело 10
Группа 1 H1-PR34 1,07 1,13 4,37 3,02 2,15
H1-FM47 0,92 0,86 3,04 1,37 1,11
H1-NJ76 1,41 1,64 2,60 2,26 0,15
H1-Kaw86 0,58 1,01 3,51 2,11 1,62
H1-TX91 0,60 0,76 2,20 0,70 0,48
H1-BJ95 3,41 5,06 20,86 10,60 4,46
H1-Ncal99 0,79 0,85 3,00 2,06 1,26
H1-SD07 0,97 1,61 6,27 2,62 1,37
H1-CA09 2,19 2,52 5,56 4,50 1,62
H2-MO06 2,27 2,38 2,90 2,62 1,04
H5-VM04 2,11 2,60 8,87 3,90 2,21
H5-HK03 4,64 1,18 10,45 1,82 1,60
H6-HK97 1,77 2,27 3,23 2,97 1,05
H9-HK97 1,79 2,43 16,47 26,39 1,76
Группа 2 H3-HK68 0,68 0,39 2,04 2,82 0,85
H3-Vic75 0,75 0,57 1,09 3,83 0,91
H3-LA87 4,19 3,54 12,60 >50 4,59
H3-SD93 9,39 6,92 19,50 >50 11,65
H3-WH95 3,96 3,72 10,54 >50 8,70
H3-Syd97 3,75 3,03 6,54 >50 9,29
H3-Pa99 17,74 16,74 25,82 >50 18,71
H3-Wy03 0,63 0,77 4,70 >50 1,52
H3-WI05 2,44 2,83 6,76 >50 4,46
H3-Perth09 1,49 2,22 5,03 >50 2,56
H7-NLD03 4,78 4,14 >50 12,75 3,80
H7-BC04 4,72 5,35 >50 14,69 3,59

В таблице 4 показано, что антитела к HA нейтрализуют все исследуемые вирусы гриппа А группы 1. Все антитела к HA, за исключением антитела 8, демонстрировали нейтрализующую активность в отношении всех вирусов гриппа А H3, и все антитела к HA, за исключением антитела 6, проявляли нейтрализующую активность в отношении H7-NLD03 (ca A/Нидерланды/219/03 (H7N7)); H7-BC04 (ca A/Британская Колумбия/CN-6/04 (H7N3-LP).

Таблица 5
Вирус Нейтрализация инфекционных вирусов (IC50, мкг/мл)
Антитело 3 Антитело 11 Антитело 12 Антитело 13 Антитело 14 Антитело 15
Группа 1 H1-PR34 2,17 0,88 1,07 1,30 1,25 1,47
H1-PR34-OR 1,39 0,73 0,69 0,88 0,83 0,90
H1-FM47 1,04 0,43 0,28 0,50 0,44 0,35
H1-NJ76 0,57 0,13 0,12 0,12 0,11 0,25
H1-Kaw86 1,01 0,53 0,28 0,41 0,35 0,48
H1-TX91 0,92 0,11 0,12 0,09 0,09 0,13
H1-BJ95 2,98 1,01 1,31 1,86 2,09 1,81
H1-Ncal99 1,16 0,66 0,61 0,77 0,67 0,79
H1-SD07 2,04 0,98 0,78 1,35 1,05 0,81
H1-CA09 2,07 0,90 0,98 1,23 1,07 1,17
H1-CA09-OR 2,10 0,87 0,84 1,05 1,23 1,35
H1-BS10 2,16 1,15 1,25 1,23 1,93 1,89
H2-JP57 0,46 0,31 0,35 0,47 0,67 0,33
H2-MO06 1,09 0,60 0,53 0,57 0,65 0,83
H5-VM04 1,19 0,57 0,31 0,56 0,33 0,28
H5-HK03 0,71 0,21 0,17 0,17 0,21 0,05
H6-AB85 0,69 0,24 0,32 0,29 0,26 0,19
H6-HK97 0,63 0,40 0,45 0,55 0,26 0,33
H9-HK97 1,18 0,36 0,31 0,29 0,44 0,35
Группа 2 H3-HK68 1,37 0,46 0,42 0,44 0,65 0,50
H3-Vic75 1,12 0,46 0,32 0,43 0,44 0,35
H3-LA87 2,04 0,80 0,82 1,00 0,83 0,83
H3-SD93 3,57 1,11 1,32 1,56 1,57 1,43
H3-WH95 5,63 2,45 2,09 2,77 2,77 3,32
H3-WH95-OR 7,70 2,26 2,34 3,01 3,09 3,48
H3-Syd97 6,50 1,53 1,56 2,18 1,82 1,79
H3-Pa99 9,00 2,18 2,04 2,62 4,36 3,39
H3-WI05 2,62 1,07 1,09 1,19 1,19 1,30
H3-Perth09 1,30 0,17 0,25 0,28 0,47 0,50
H3-VC11 3,40 0,85 0,83 1,03 1,15 1,29
H7-NLD03 4,74 0,94 0,83 2,45 1,16 1,30
H7-BC04 2,95 0,71 0,78 0,96 0,86 1,25
H7-ANU13 4,26 н.о. 2,56 н.о. 2,12 н.о.

В таблице 5 показано, что варианты антител (антитела 11-15) являются более эффективными, чем исходное антитело 3, в нейтрализации всех исследуемых вирусов гриппа А группы 1 и группы 2 при пониженных значениях IC50. Кроме того, антитела также нейтрализовали 3 вируса, имеющие мутацию, внедренную в белок NA, которая придает устойчивость к озельтамивиру (OR).

Пример 5. Нейтрализующая активность антител IgG к HA в отношении вирусов H3N2 свиного происхождения

Нейтрализующую активность антитела 3 к HA и его вариантов (антител 11-15) в отношении недавно появившихся вирусов H3N2 свиного происхождения (A/Миннесота/11/2010 и A/Индиана/10/2011) измеряли в анализе микронейтрализации, как описано в примере 4. В качестве контрольного антитела применяли антитело FI6v4 (описано в WO2013/011347A1). Как показано в таблице 6 по результатам двух независимых экспериментов, антитело 3 и варианты антитела (антитела 11-15) были более эффективными, чем FI6v4, в нейтрализации вируса H3N2 A/Индиана/10/2011 свиного происхождения. Антитело 3 и варианты антитела эффективно нейтрализовали вирус H3N2 A/Миннесота/11/2010 свиного происхождения, тогда как FI6v4 было неспособно к нейтрализации при наибольшей концентрации (50 мкг/мл) исследуемого антитела.

Таблица 6
Нейтрализующая активность (IC50, мкг/мл)
Вирус H3N2 FI6 v4 Антитело 3 Антитело 11 Антитело 12 Антитело 13 Антитело 14 Антитело 15
Свиного происхождения A/Миннесота/11/2010 >50 2,2 1,6 1,1 1,6 1,4 0,9
>50 4,2 1,5 1,2 1,4 2,3 2,7
Свиного происхождения A/Индиана/10/2011 13,7 3,1 2,8 2,5 2,2 3,3 5,5
29,3 3,7 2,1 1,8 3,9 2,9 3,9

Пример 6. Нейтрализующее антитело к HA ингибирует слияние вируса гриппа и опосредованное протеазами расщепление HA0

Для исследования опосредованного антителом ингибирования слияния проводили анализ индуцированного низким pH слияния с эритроцитами согласно модифицированному протоколу, описанному ранее (Wang T.T. et al., 2010 PLoS Pathog. 6). Вкратце, вирус A/Пуэрто-Рико/8/34 (10×106 TCID50) инкубировали с человеческими эритроцитами (конечная концентрация эритроцитов 2%) на льду в течение 10 минут. Разведения антитела 3, антитела 12 и нерелевантного антитела MPE8v3 инкубировали с вирусом в течение 30 минут при RT. Затем к смеси вирус-антитело добавляли эритроциты на 30 минут при 37°C, и напоследок добавляли натрий-ацетатный буфер (0,5M, pH 5,0) на дополнительные 45 минут при 37°C. Образцы центрифугировали в течение 6 минут при 400×g и инкубировали в течение дополнительных 45 минут при RT, а затем снова центрифугировали в течение 6 минут при 400×g с осаждением эритроцитов. Затем образцы надосадочной жидкости переносили на планшет для ELISA для определения количества высвободившегося NADPH путем измерения поглощения при 540 нм (фигура 1B). Результат показал, что антитело 3 и антитело 12 эффективно ингибировали слияние вируса, тогда как MPE8v3, моноклональное человеческое антитело к белку парамиксовируса, обеспечивающему слияние (Corti et al., 2013 Nature 501), было неспособно ингибировать слияние, индуцированное низким pH.

Для исследования опосредованной антителом блокады созревания HA рекомбинантный HA A/Новая Каледония/20/99 (H1N1) инкубировали в течение 40 минут с антителом 3, FI6v4, FE17.23 или антителом изотипического контроля при молярном соотношении 15:1 (mAb:HA). Смесь антитело-HA затем подвергали действию 2,5 мкг/мл трипсина, обработанного TPCK, и инкубировали в течение 5, 10 и 20 минут при 37°C. Образцы разделяли на полиакриламидном геле и затем переносили на нитроцеллюлозную мембрану для вестерн-блот-анализа с применением биотинилированного человеческого mAb (FO32) (Humabs), которое распознает HA2 и HA0 штаммов вируса гриппа A (фигура 1C). Результат показал, что антитело 3 было более эффективным, чем FI6v4, в блокировании опосредованного протеазами расщепления HA0. В противоположность этому, FE17.23, моноклональное человеческое антитело, которое распознает глобулярную головку HA, и контрольное антитело были неспособны ингибировать опосредованное протеазами расщепление HA0. В отдельном эксперименте сравнивали ингибирование антителом 12 и антителом 14 расщепления протеазами по сравнению с антителом 3 с применением тех же условий, что описаны выше (фигура 1D). Результаты показали, что антитело 12, антитело 13 характеризовались способностью блокировать расщепление протеазами, сходной с таковой у антитела 3.

Пример 7. Антитела к HA проявляют эффекторную функцию Fc

Антитела характеризуются потенциалом к устранению инфицированных вирусом клеток посредством эффекторной функции Fc, такой как антителозависимая клеточная цитотоксичность (ADCC), антителозависимый клеточный фагоцитоз (ADCP) и комплементзависимое уничтожение (CDC). Для подтверждения того, что антитела к HA проявляли ADCC-активность, исследовали их способность к уничтожению инфицированных вирусом клеток в присутствии человеческих естественных клеток-киллеров (NK). Анализ ADCC проводили на клетках MDCK, инфицированных A/Гонконг/8/68 при MOI 20. Инфицированные клетки инкубировали с антителом в серии разведений, а затем инкубировали с очищенными клетками NK, которые подвергали негативному отбору из человеческих PBMC (Miltenyi), при соотношении эффектор-мишень 6:1. Смеси инфицированных клеток, антитела и клеток NK инкубировали в течение 4 часов, и уничтожение клеток измеряли по высвобождению LDH (Roche). На фигуре 2 показано, что все четыре антитела, связывающиеся со "стволом" HA, проявляли дозозависимое уничтожение инфицированных клеток MDCK.

Для измерения способности антител к HA опосредовать фагоцитоз применяли клетки MDCK, подвергнутые стабильной трансфекции HA, полученным из A/Гонконг/8/68, в качестве клеток-мишеней. Человеческие моноциты выделяли из PBMC и культивировали в течение 7 дней в присутствии M-CSF с дифференциацией в макрофаги. Человеческие макрофаги и экспрессирующие HA клетки-мишени флуоресцентно метили фиолетовым и зеленым красителями, соответственно (CellTrace фиолетовым или CSFE, Invitrogen). Меченые эффекторные клетки и клетки-мишени инкубировали при соотношении 6:1 в присутствии антитела в серии разведений в течение 2 часов и затем анализировали с помощью проточной цитометрии. Процент фагоцитоза измеряли в виде процента окрашенных фиолетовым макрофагов, которые также были положительными в отношении зеленых клеток-мишеней (двойными положительными). На фигуре 3 показано, что все антитела к HA демонстрировали сходные уровни ADCP, а неспецифическое контрольное антитело, как и ожидалось, не демонстрировало фагоцитоз.

Для измерения способности антител к HA функционировать совместно с системой комплемента для опосредования уничтожения инфицированных клеток проводили анализ CDC. В этом анализе клетки MDCK инфицировали A/Пуэрто-Рико/8/34 при MOI 2, инкубировали с антителом в серии разведений и системой комплемента, полученной от кролика (Cedarlane), при соотношении эффектор-мишень 1:18. Уничтожение клеток измеряли по высвобождению LDH (Roche). На фигуре 4 показано, что все антитела к HA демонстрировали способность к опосредованию уничтожения клеток в присутствии системы комплемента.

Пример 8. Профилактический и терапевтический эффект антител к HA

Эффективность защиты человеческих нейтрализующих антител (nAb) от инфекции, вызванной вирусом гриппа, оценивали в модели на мышах BALB/c (Harlan Laboratories) в возрасте шести-восьми недель. Мышей обрабатывали различными дозами nAb до либо после смертельного заражения вирусом.

Профилактическая активность (фигуры 5 и 6). Мышам в группах по 8 особей вводили антитело 3 в виде однократной внутрибрюшинной инъекции (IP) в дозах 0,1, 0,3, 1, 3 и 10 мг/кг или человеческий нерелевантный IgG изотипического контроля при 10 мг/кг в объемах 100 мкл. Через четыре часа после введения дозы мышам интраназально инокулировали 7-кратную пятидесятипроцентную смертельную дозу для мышей (7 MLD50) A/Калифорния/7/09 (H1N1) (H1-CA09) или реассортантный вирус 7:1 c HA A/PR/8:A/HK/8/68 (H3N1) (H3-HK68) в объеме 50 мкл. Мышей взвешивали в день заражения вирусом или за день до этого, и в течение 14 дней ежедневно отслеживали потерю веса и выживание (мышей с потерей веса тела ≥ 25% подвергали эвтаназии). Антитело 3 обеспечивало защиту дозозависимым образом. IP инъекция 1 мг/кг или более антитела 3 обеспечивала полную защиту у животных, зараженных H1-CA09 (фигура 5) и H3-HK68 (фигура 6). Более низкая доза антитела (0,3 мг/кг) также обладала высоким защитным действием с 90% защитой. Как и ожидалось, ни одна из мышей, которые получали mAb изотипического контроля при 10 мг/кг, не выжила после смертельного заражения инфекцией.

Терапевтическая активность (фигуры 7 и 8). Мышам инокулировали 3 MLD50 H1-CA09 и инъецировали антитело 3 через 24 и 48 часов после инфицирования (h.p.i.) (фигура 7) или 5 MLD50 H3-HK68 через 72, 96 и 120 h.p.i. (фигура 8). Обработка путем IP введения 30 мг/кг антитела 3 через 24 и 48 h.p.i. защищала 75-100% мышей, зараженных H1-CA09, а через 72 и 96 h.p.i. защищала 87,5-100% мышей, зараженных H3-HK68. Обработка с помощью той же дозы нерелевантного антитела изотипического контроля через 0 или 24 h.p.i. в моделях H1 и H3 была неспособна защитить мышей от смертельного заражения, при этом уровень выживания составлял 0 или 12,5%, соответственно.

Терапевтическая активность вариантов антитела 3 (фигуры 9 и 10). Мышам инокулировали 3 MLD50 H1-CA09 и инъецировали антитела через 24 h.p.i. (фигура 9) или инокулировали 7 MLD50 H3-HK68 и инъецировали антитела через 48 h.p.i. (фигура 10). Обработка путем IP введения 2 мг/кг антитела 3 и вариантов mAb (антитела 11, антитела 12 и антитела 14) защищала 87,5-100% мышей, зараженных H1-CA09, а доза 3 мг/кг различных nAb защищала 50-87,5% мышей, зараженных H3-HK68. Как и ожидалось, обработка с помощью той же дозы нерелевантного антитела изотипического контроля через 24 или 48 h.p.i. в моделях H1 и H3 была неспособна защитить мышей, при этом уровень выживания составлял 0 или 12,5%, соответственно.

Пример 9. Терапевтический эффект антител к HA и низкомолекулярного ингибитора озельтамивира

Для непосредственного сравнения эффективности защиты nAb к HA и низкомолекулярного ингибитора нейраминидазы (NA) озельтамивира, а также эффекта комбинированной терапии применяли мышиную модель инфекции, вызванной вирусом гриппа, описанную в примере 8.

Терапевтическое сравнение nAb к HA и озельтамивира (фигуры 11 и 12). Мышам инокулировали 3 MLD50 H1-CA09, и их обрабатывали 10 мг/кг антитела 12 или 25 мг/кг озельтамивира BID в течение 5 дней, начиная за 4 часа до либо через 1 день или 2 дня после инфицирования (фигура 11). Обработка с помощью антитела 12 до и через 1 день после инфицирования защищала 100% мышей, зараженных H1-CA09, при этом все животные, обработанные озельтамивиром, поддались инфекции. Все животные, обработанные одной и той же дозой нерелевантного изотипического контроля за 4 часа до инфицирования, погибли, при этом уровень выживания составлял 0%. Кроме того, мышам инокулировали 7 MLD50 H3-HK68, а затем их обрабатывали 10 мг/кг антитела 12 или 25 мг/кг озельтамивира BID в течение 5 дней, начиная через 1, 2, 3 либо 4 дня после инфицирования (фигура 12). Животные, обработанные антителом 12 через 1, 2 или 3 дня после инфицирования, продемонстрировали уровень выживания 100%, при этом обработка озельтамивиром в эти же самые моменты времени показала уровень выживания, составлявший лишь 60%-20%. Как и ожидалось, мыши, обработанные той же дозой нерелевантного антитела изотипического контроля через 1 день после инфицирования, поддались инфекции, при этом уровень выживания составлял 10%.

Терапевтическая комбинация nAb к HA и озельтамивира (фигура 13). Для оценки дополнительного эффекта комбинации mAb к HA и озельтамивира мышам инокулировали 7 MLD50 H3-HK68, и их обрабатывали антителом 12 в субоптимальной концентрации (2,5 или 0,3 мг/кг), озельтамивиром при 25 мг/кг BID в течение 5 дней или комбинацией антитела 12 (2,5 или 0,3 мг/кг) и озельтамивира при 25 мг/кг BID в течение 5 дней на 3 день после инфицирования (фигура 13). Обработка с помощью как антитела 12, так и озельтамивира в отдельности защищала лишь 10-20% животных, тогда как обработка с помощью 2,5 мг/кг антитела 12 в комбинации с озельтамивиром защищала 80%, а с помощью 0,3 мг/кг антитела 12 в комбинации с озельтамивиром защищала 50% животных.

Пример 10. Терапевтический эффект антител к HA и низкомолекулярного ингибитора в отношении инфекции, вызванной вирусом гриппа H5N1, у хорька

Эффективность защиты nAb к HA и озельтамивира от инфекции, вызванной высокопатогенным вирусом гриппа, оценивали у серонегативных по вирусу гриппа хорьков в возрасте пяти-шести месяцев (Triple F Farms). Всех хорьков интраназально заражали 1 LD90 высокопатогенного вируса птичьего гриппа A/VN/1203/04 (H5N1) в 1,0 мл (примерно 0,5 мл/ноздря), а затем обрабатывали однократной дозой 25 мг/кг антитела 12 либо озельтамивиром при 25 мг/кг BID в течение 5 дней, начиная через 1, 2 или 3 дня после инфицирования. Процент выживания рассчитывали для каждой группы (n=7) (фигура 14). Хорьки, которых обрабатывали антителом 12, начиная через 1, 2 и 3 дня после инфицирования, а также хорьки, которых обрабатывали озельтамивиром через 1 день после инфицирования, были защищены и характеризовались уровнем выживания 100%. Однако, если обработку озельтамивиром начинали через 2 и 3 дня после инфицирования, уровень выживания хорьков составлял лишь 71% (средний день гибели - 12) и 29% (средний день гибели - 9), соответственно. Как и ожидалось, животные, обработанные 25 мг/кг нерелевантного антитела изотипического контроля через 1 день после инфицирования, не выживали, при этом уровень выживания составлял 0%.

Пример 11. Идентификация эпитопов с помощью отбора мутантов, устойчивых к моноклональным антителам (MARM)

Из трех вирусов H3N2 выделяли мутантов, устойчивых к антителам, с применением двух различных способов. H3N2 A/Айти/2/68 (Айти/68) инкубировали с антителом 12 в высокой концентрации (125×IC50) в течение 1 часа до поглощения смеси вируса и антитела клетками MDCK при 30000 TCID50 на лунку в 10 x 96-луночных планшетах и культивировали в присутствии антитела 12 (10 X IC50). Выделяли 3 предполагаемых MARM HK2/68, устойчивых к антителу 12, которые проявляли цитопатический эффект (CPE) в отношении инфицированных клеток в период до 3 дней после инфицирования. Ген HA амплифицировали посредством RT-PCR и затем секвенировали. Анализ последовательности выявил 2 смысловые замены по сравнению с исходной последовательностью (таблица 7). Эти два нуклеотидных изменения кодируют, соответственно, одиночные замены аминокислот изолейцина (I) на аргинин (R) и аспарагиновой кислоты (D) на тирозин (Y) в положениях аминокислот 18 и 19 в высококонсервативном стволовом участке HA2. Альтернативно, серийный пассаж вирусов гриппа H3N2 A/Висконсин/67/2005 (WI05) и ca A/Панама/2007/1999 (Pa99) проводили в присутствии антитела 12 в концентрациях, возрастающих от 2-5 X IC50 до 100 X IC50. Потенциальных "ускользнувших" мутантов пересевали с помощью предельного разведения, и их когнатные гены HA подвергали анализу последовательностей. Выявляли одиночные аминокислотные изменения D на Y в положении 19 и глутамина (Q) на R в положении 42 в HA2. Кроме того, наблюдали двойные мутации с заменой аминокислоты гистидина (H) на Q в положении 156 в HA1 в комбинации с D19Y или D на аспарагин (N) в положении 19 в комбинации с изменением аминокислоты I на N в остатке 45 в HA2; или аланина (A) на треонин (T) в положении 196 в HA1 в комбинации с Q42R (таблица 7). Аналогично, при серийном пассаже Pa99 в присутствии антитела 12 в концентрациях до 100 x IC50 выбирали одиночную замену аминокислоты в остатках 42 (Q42R) и 45 (I45T) HA2 (таблица 7). Иллюстративные варианты MARM, представленные в таблице 7, применяли в анализе микронейтрализации для дополнительной оценки фенотипической восприимчивости этих MARM к нейтрализации антителом 12. Результаты показали, что выбранные in vitro MARM WI05, содержащие мутации D19Y, H156Q/D19Y, D19N/I45N, Q42R или A196T/Q42R; MARM Pa99, содержащие Q42R или I45T, и MARM Айти/68, содержащие мутации D19Y или I18R, были менее восприимчивыми к нейтрализации антителами при возрастании рассчитанных значений IC50, варьирующем в диапазоне от >8-кратного для устойчивых клонов Pa99 до >180-кратного для устойчивых вариантов WI05, по сравнению с их исходными штаммами дикого типа, соответственно (таблица 8). Для оценки эффекта этих замен аминокислот в отношении восприимчивости к нейтрализации антителом 12 создавали рекомбинантные варианты H3 A/Гонконг/1-5/68 (rHK68), кодирующие отдельные мутации, и оценивали с применением анализа микронейтрализации. Как показано в таблице 9, варианты H3 rHK68_I18R и rHK68_D19Y характеризовались устойчивостью к антителу 12 при наибольшей исследуемой концентрации (~200 мкг/мл) и придавали >130-кратное снижение восприимчивости к нейтрализации антителом 12 по сравнению с вирусом дикого типа rHK68. Одиночные замены аминокислот Q42R в rHK68 приводили к незначительному, приблизительно 8-кратному снижению восприимчивости к нейтрализации антителом 12. Однако, замены аминокислот (K156Q, A196T, I45N или I45T), выявленные в белках HA выбранных MARM, не изменяли восприимчивость рекомбинантных вирусов HK68, кодирующих такие замены, к антителу 12 в анализе микронейтрализации. Эти результаты указывают на то, что антитело 12 распознает конформационные эпитопы в высококонсервативном стволовом участке HA2, и аминокислоты в положениях 18, 19, 42 или 45 являются ключевыми контактными остатками.

Таблица 7.
Замены аминокислот, выявленные в мутантных HA H3, устойчивых к антителу 12
Вирус H3N2 Нуклеотидное изменение Аминокислотное изменение в HA Положение в субъединицах HA
A/Висконсин/67/2005 G1090T D19Y HA2
C156A, G1090T H156Q, D19Y HA1, HA2
A1160G Q42R HA2
G634A, A1160G A196T, Q42R HA1,HA2
G1090A, T1169A D19N, I45N HA2,HA2
ca A/Панама/2007/99 A1160G Q42R HA2
T1169C I45T HA2
A/Айти/2/68 G1090T D19Y HA2
T1088G I18R HA2

Таблица 8.
Восприимчивость устойчивых вариантов H3 к нейтрализации антителом 12 (нейтр.)
Исходный вирус H3N2 Аминокислотные изменения в HA исследованных MARM Средняя нейтр. конц. (мкг/мл) Кратность изменения по сравнению с вирусом дикого типа
A/Висконсин/67/2005 дикий тип 1,09
D19Y >200 >180
Q42R >200 >180
H156Q/D19Y >200 >180
D19N/I45N >200 >180
A196T/Q42R >200 >180
ca A/Панама/2007/99 дикий тип 6,68
Q42R >600 >90
I45T 54,51 8,16
A/Айти/2/68 дикий тип 3,98
D19Y >50 >12
I18R >50 >12

Таблица 9.
Восприимчивость вариантов H3 rHK68 к нейтрализации антителом 12 (нейтр.)
Реассортантный вирус_мутация Средняя нейтр. конц. (мкг/мл) Кратность изменения по сравнению с вирусом дикого типа
rHK68, дикий тип 1,42 1
rHK68_I18R >200 >130
rHK68_D19N 3,04 2,01
rHK68_D19Y >200 >130
rHK68_Q42R 11,13 7,82
rHK68_I45N 1,94 1,28
rHK68_I45T 3,38 2,23
rHK68_K156Q 3,33 2,34
rHK68_A196T 4,06 2,85


Антитело 15

Антитело 14

Антитело 13

Литературные источники по вирусу гриппа А

Corti, D., et al. 2010. Heterosubtypic neutralizing antibodies are produced by individuals immunized with a seasonal influenza vaccine. J Clin Invest 120:1663-1673.

Corti, D., et al. 2011. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins. Science 333:850-856.

Corti D., et al. 2013. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody. Nature 501(7467):439-43.

Ekiert, D. C. et al. 2009. Antibody recognition of a highly conserved influenza virus epitope. Science 324: 246-251.

Ekiert, D. C. et al. 2011. A highly conserved neutralizing epitope on group 2 influenza A viruses. Science 333:843-850.

Ekiert, D.C., et al. 2012. Cross-neutralization of influenza A viruses mediated by a single antibody loop. Nature 489: 526-532.

Krause, J. C., et al. 2011. A broadly neutralizing human monoclonal antibody that recognizes a conserved, novel epitope on the globular head of the influenza H1N1 virus hemagglutinin. J. Virol. 85:10905-10908.

Lee, P.S., et al. 2012. Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity. Proc Natl Acad Sci USA. 109: 17040-17045.

Li G.M. et al 2012. Pandemic H1N1 influenza vaccine induces a recall response in humans that favors broadly cross-reactive memory B cells. Proc Natl Acad Sci USA.109:9047-9052.

Nakamura G. et al 2013. An in vivo human-plasmablast enrichment technique allows rapid identification of therapeutic influenza A antibodies. Cell host microbe 14:93-103.

Sui, J., et al. 2009. Structure and functional bases for broad-spectrum neutralization of avian and human influenza A viruses. Nat Struct Mol Biol 16: 265-273.

Throsby, M., et al. 2008. Heterosubtypic neutralizing monoclonal antibodies cross-protective against H5N1 and H1N1 recovered from human IgM+ memory B cells. PLoS One 3: e3492.

Wang T.T., et al., 2010. Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins. PLoS Pathog. 6(2):e1000796.

Whittle, J. R. R., et al. 2011. Broadly neutralizing human antibody that recognizes the receptor-binding pocket of influenza virus hemagglutinin. Proc Natl Acad Sci USA. 108:14216-14221.

Wrammert, J., et al. 2011. Broadly cross-reactive antibodies dominate the human B cell response against 2009 pandemic H1N1 influenza virus infection. J Exp Med. 208:181-193.

Информация перечня последовательностей

Антитело 1 (исходная кДНК)

SEQ ID NO: 1

Cagatacagctgcaggagtcgggtccaggactggtgaagccctcgcagaccctctcactcacctgtgccatctccggggacagtgtctctagcaacaatgctgtttggaactggatcaggcagtccccatcgagaggccttgagtggctgggaaggacatactacaggtccaagtggtataatgattatgcagaatctgtgaaaagtcgaataaccgtcaatccagacacatccaagaaccagttctccctgcacctgaagtctgtgactcccgaggacacggctgtgttttactgtgtacgatctggccacattacggtttttggagtgaatgttgacgcttttgatatgtggggccaagggacaatggtcaccgtctcttcag

SEQ ID NO: 2

QIQLQESGPGLVKPSQTLSLTCAISGDSVSSNNAVWNWIRQSPSRGLEWLGRTYYRSKWYNDYAESVKSRITVNPDTSKNQFSLHLKSVTPEDTAVFYCVRSGHITVFGVNVDAFDMWGQGTMVTVSS

SEQ ID NO: 3 HCDR1SNNAVWN

SEQ ID NO: 4 HCDR2RTYYRSKWYNDYAESVKS

SEQ ID NO: 5 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 6

gacatccagatcacccagtcgccatcctccctgtctgcatctgtaggagacagagtaaccatcacttgccggacaagtcagagccttagtagctatttacattggtatcagcagaaaccagggaaagcccctaagctcctgatctatgctgcatccagtttgcaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttcactctcaccatcagtagtctgcaacctgaagattttgcaacttactactgtcaacagagtcggacgttcggccaagggaccaaggtggaaatcaaa

SEQ ID NO: 7

DIQITQSPSSLSASVGDRVTITCRTSQSLSSYLHWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 8 LCDR1RTSQSLSSYLH

SEQ ID NO: 9 LCDR2AASSLQS

SEQ ID NO: 10 LCDR3QQSRT

Антитело 2 (экспрессируемая форма антитела 1)

SEQ ID NO: 11

caggtacagctgcaggagtcgggtccaggactggtgaagccctcgcagaccctctcactcacctgtgccatctccggggacagtgtctctagcaacaatgctgtttggaactggatcaggcagtccccatcgagaggccttgagtggctgggaaggacatactacaggtccaagtggtataatgattatgcagaatctgtgaaaagtcgaataaccgtcaatccagacacatccaagaaccagttctccctgcacctgaagtctgtgactcccgaggacacggctgtgttttactgtgtacgatctggccacattacggtttttggagtgaatgttgacgcttttgatatgtggggccaagggacaatggtcaccgtctcttcag

SEQ ID NO: 12

QVQLQESGPGLVKPSQTLSLTCAISGDSVSSNNAVWNWIRQSPSRGLEWLGRTYYRSKWYNDYAESVKSRITVNPDTSKNQFSLHLKSVTPEDTAVFYCVRSGHITVFGVNVDAFDMWGQGTMVTVSS

SEQ ID NO: 13 HCDR1SNNAVWN

SEQ ID NO: 14 HCDR2RTYYRSKWYNDYAESVKS

SEQ ID NO: 15 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 16

gacatccagatgacccagtcgccatcctccctgtctgcatctgtaggagacagagtaaccatcacttgccggacaagtcagagccttagtagctatttacattggtatcagcagaaaccagggaaagcccctaagctcctgatctatgctgcatccagtttgcaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttcactctcaccatcagtagtctgcaacctgaagattttgcaacttactactgtcaacagagtcggacgttcggccaagggaccaaggtggaaatcaaa

SEQ ID NO: 17

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYLHWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 18 LCDR1RTSQSLSSYLH

SEQ ID NO: 19 LCDR2AASSLQS

SEQ ID NO: 20 LCDR3QQSRT

Антитело 3 (кодон-оптимизированное антитело 2)

SEQ ID NO: 21

caggtccagctgcaggagagcggccccggactggtcaagccttcacagacactgagcctgacatgcgccattagcggagatagcgtgagctccaacaatgccgtgtggaactggatcaggcagtctccaagtcgaggactggagtggctgggacgaacatactatagatccaagtggtacaatgactatgctgaatcagtgaaaagccgaattactgtcaaccccgatacctccaagaatcagttctctctgcacctgaaaagtgtgacccctgaggacacagccgtgttctactgcgtcagaagcggccatatcaccgtctttggcgtcaatgtggatgctttcgatatgtgggggcaggggactatggtcaccgtgtcaagc

SEQ ID NO: 22

QVQLQESGPGLVKPSQTLSLTCAISGDSVSSNNAVWNWIRQSPSRGLEWLGRTYYRSKWYNDYAESVKSRITVNPDTSKNQFSLHLKSVTPEDTAVFYCVRSGHITVFGVNVDAFDMWGQGTMVTVSS

SEQ ID NO: 23 HCDR1SNNAVWN

SEQ ID NO: 24 HCDR2RTYYRSKWYNDYAESVKS

SEQ ID NO: 25 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 26

gatattcagatgacccagagcccttccagcctgtccgcttcagtgggggatcgagtgaccattacctgccgaaccagccagagcctgagctcctacctgcactggtatcagcagaagcccggcaaagcccctaagctgctgatctacgccgcttctagtctgcagtccggagtgccaagccggttctccggatctgggagtggaaccgactttaccctgacaatttcaagcctgcagcccgaggatttcgctacatactactgtcagcagagcagaactttcgggcagggcactaaggtggagatcaaa

SEQ ID NO: 27

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYLHWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 28 LCDR1RTSQSLSSYLH

SEQ ID NO: 29 LCDR2AASSLQS

SEQ ID NO: 30 LCDR3QQSRT

Антитело 4 (исходная кДНК) - вырожденный нуклеотид в HCDR3, t или a

SEQ ID NO: 31

caggtccagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactcacctgtgccatctccggggacagagtctctagcaacagtgctgtttggaactggatcaggcagtccccatcgagaggcctcgagtggctgggaaggacatattacaggtccaaatggtattatgattatgcagaatctgtgaaaagtcgaatagttatcgacccagacacatccaagaaccaggtctccctgcagttgaattctgtgactcccgaggactcggctatatattactgtgcaagaggtggccacattacggtgtttgggctgaatattgacgcttatgatatttggggccaaggggcaaaggtcaccgtgtcttcag

SEQ ID NO: 32

QVQLQQSGPGLVKPSQTLSLTCAISGDRVSSNSAVWNWIRQSPSRGLEWLGRTYYRSKWYYDYAESVKSRIVIDPDTSKNQVSLQLNSVTPEDSAIYYCARGGHITVFGLNIDAYDIWGQGAKVTVSS

SEQ ID NO: 33 HCDR1SNSAVWN

SEQ ID NO: 34 HCDR2RTYYRSKWYYDYAESVKS

SEQ ID NO: 35 HCDR3GGHITVFGLNIDAYDI

SEQ ID NO: 36

gacatccaggtgacccagtctccgtcctccctgtctgcatctgtaggagacagagtcaccatctcttgccgggcacagagccttagcagctacttacattggtatcagcagaaaccagggcaaccccctaaactcctgatctatgctgcaaccactttgcaaagtggggtcccatcacggttcagtggtagtggatctgggacagatttcactctcaccatcagtactttccaagctgaagatgttgccacttactattgtcaacagagtcggacgttcggccaagggaccaaggttgaaatcaaac

SEQ ID NO: 37

DIQVTQSPSSLSASVGDRVTISCRAQSLSSYLHWYQQKPGQPPKLLIYAATTLQSGVPSRFSGSGSGTDFTLTISTFQAEDVATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 38 LCDR1RAQSLSSYLH

SEQ ID NO: 39 LCDR2AATTLQS

SEQ ID NO: 40 LCDR3QQSRT

Антитело 5 (экспрессируемая форма антитела 4, V в HCDR3)

SEQ ID NO: 41

caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactcacctgtgccatctccggggacagagtctctagcaacagtgctgtttggaactggatcaggcagtccccatcgagaggcctcgagtggctgggaaggacatattacaggtccaaatggtattatgattatgcagaatctgtgaaaagtcgaatagttatcgacccagacacatccaagaaccaggtctccctgcagttgaattctgtgactcccgaggactcggctatatattactgtgcaagaggtggccacattacggtgtttgggctgaatattgacgcttatgatatttggggccaaggggcaatggtcaccgtctcttcag

SEQ ID NO: 42

QVQLQQSGPGLVKPSQTLSLTCAISGDRVSSNSAVWNWIRQSPSRGLEWLGRTYYRSKWYYDYAESVKSRIVIDPDTSKNQVSLQLNSVTPEDSAIYYCARGGHITVFGLNIDAYDIWGQGAMVTVSS

SEQ ID NO: 43 HCDR1SNSAVWN

SEQ ID NO: 44 HCDR2RTYYRSKWYYDYAESVKS

SEQ ID NO: 45 HCDR3GGHITVFGLNIDAYDI

SEQ ID NO: 46

gacatccagatgacccagtctccgtcctccctgtctgcatctgtaggagacagagtcaccatctcttgccgggcacagagccttagcagctacttacattggtatcagcagaaaccagggcaaccccctaaactcctgatctatgctgcaaccactttgcaaagtggggtcccatcacggttcagtggtagtggatctgggacagatttcactctcaccatcagtactttccaagctgaagatgttgccacttactattgtcaacagagtcggacgttcggccaagggaccaaggtggagatcaaac

SEQ ID NO: 47

DIQMTQSPSSLSASVGDRVTISCRAQSLSSYLHWYQQKPGQPPKLLIYAATTLQSGVPSRFSGSGSGTDFTLTISTFQAEDVATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 48 LCDR1RAQSLSSYLH

SEQ ID NO: 49 LCDR2AATTLQS

SEQ ID NO: 50 LCDR3QQSRT

Антитело 6 (экспрессируемая форма антитела 4, Е в HCDR3)

SEQ ID NO: 51

caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactcacctgtgccatctccggggacagagtctctagcaacagtgctgtttggaactggatcaggcagtccccatcgagaggcctcgagtggctgggaaggacatattacaggtccaaatggtattatgattatgcagaatctgtgaaaagtcgaatagttatcgacccagacacatccaagaaccaggtctccctgcagttgaattctgtgactcccgaggactcggctatatattactgtgcaagaggtggccacattacggagtttgggctgaatattgacgcttatgatatttggggccaaggggcaatggtcaccgtctcttcag

SEQ ID NO: 52

QVQLQQSGPGLVKPSQTLSLTCAISGDRVSSNSAVWNWIRQSPSRGLEWLGRTYYRSKWYYDYAESVKSRIVIDPDTSKNQVSLQLNSVTPEDSAIYYCARGGHITEFGLNIDAYDIWGQGAMVTVSS

SEQ ID NO: 53 HCDR1SNSAVWN

SEQ ID NO: 54 HCDR2RTYYRSKWYYDYAESVKS

SEQ ID NO: 55 HCDR3GGHITEFGLNIDAYDI

SEQ ID NO: 56

gacatccagatgacccagtctccgtcctccctgtctgcatctgtaggagacagagtcaccatctcttgccgggcacagagccttagcagctacttacattggtatcagcagaaaccagggcaaccccctaaactcctgatctatgctgcaaccactttgcaaagtggggtcccatcacggttcagtggtagtggatctgggacagatttcactctcaccatcagtactttccaagctgaagatgttgccacttactattgtcaacagagtcggacgttcggccaagggaccaaggtggagatcaaac

SEQ ID NO: 57

DIQMTQSPSSLSASVGDRVTISCRAQSLSSYLHWYQQKPGQPPKLLIYAATTLQSGVPSRFSGSGSGTDFTLTISTFQAEDVATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 58 LCDR1RAQSLSSYLH

SEQ ID NO: 59 LCDR2AATTLQS

SEQ ID NO: 60 LCDR3QQSRT

Антитело 7 (исходная кДНК)

SEQ ID NO: 61

caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctccctcacctgtgtcatctccggagacactgtctctagcaacagagctacttggaattggatgaggcagtccccattgagaggccttgagtggctgggaaggacatactacaggtccaagtggtataatgattacgcagtttctgtgaaaagtcgagtagtcatcaacccagacacatccaagaaccaagtctccctgcagttgaacactgtgactcccgatgactcgggtgtatacttttgtgcaagaggtggccacatcacggtctttggagtgaatattgacgcttttgacatctggggcctcgggacaaaggtcaccgtctcttcag

SEQ ID NO: 62

QVQLQQSGPGLVKPSQTLSLTCVISGDTVSSNRATWNWMRQSPLRGLEWLGRTYYRSKWYNDYAVSVKSRVVINPDTSKNQVSLQLNTVTPDDSGVYFCARGGHITVFGVNIDAFDIWGLGTKVTVSS

SEQ ID NO: 63 HCDR1SNRATWN

SEQ ID NO: 64 HCDR2RTYYRSKWYNDYAVSVKS

SEQ ID NO: 65 HCDR3GGHITVFGVNIDAFDI

SEQ ID NO: 66

gacatccaggtgacccagtctccatcctccctgtctgcatctgtaggagacagagttaccatctcttgccgggcaagtcagagacttaatagttatctacattggtatcagcagacaccagggcaagccccgaagctgctgatctatgcaacgtccactttgcaaagtggggtctcaccaagattcagtggcagtggatctgggacagatttcactctcaccatcagcagtctccaacctgaagatgttgcaacttactactgtcaattgagtcggacgttcggccacgggaccaaggttgaaatcaaac

SEQ ID NO: 67

DIQVTQSPSSLSASVGDRVTISCRASQRLNSYLHWYQQTPGQAPKLLIYATSTLQSGVSPRFSGSGSGTDFTLTISSLQPEDVATYYCQLSRTFGHGTKVEIK

SEQ ID NO: 68 LCDR1RASQRLNSYLH

SEQ ID NO: 69 LCDR2ATSTLQS

SEQ ID NO: 70 LCDR3QLSRT

Антитело 8 (экспрессируемая форма антитела 7)

SEQ ID NO: 71

caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctccctcacctgtgtcatctccggagacactgtctctagcaacagagctacttggaattggatgaggcagtccccattgagaggccttgagtggctgggaaggacatactacaggtccaagtggtataatgattacgcagtttctgtgaaaagtcgagtagtcatcaacccagacacatccaagaaccaagtctccctgcagttgaacactgtgactcccgatgactcgggtgtatacttttgtgcaagaggtggccacatcacggtctttggagtgaatattgacgcttttgacatctggggcctcgggacaaaggtcaccgtctcttcag

SEQ ID NO: 72

QVQLQQSGPGLVKPSQTLSLTCVISGDTVSSNRATWNWMRQSPLRGLEWLGRTYYRSKWYNDYAVSVKSRVVINPDTSKNQVSLQLNTVTPDDSGVYFCARGGHITVFGVNIDAFDIWGLGTKVTVSS

SEQ ID NO: 73 HCDR1SNRATWN

SEQ ID NO: 74 HCDR2RTYYRSKWYNDYAVSVKS

SEQ ID NO: 75 HCDR3GGHITVFGVNIDAFDI

SEQ ID NO: 76

gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagttaccatctcttgccgggcaagtcagagacttaatagttatctacattggtatcagcagacaccagggcaagccccgaagctgctgatctatgcaacgtccactttgcaaagtggggtctcaccaagattcagtggcagtggatctgggacagatttcactctcaccatcagcagtctccaacctgaagatgttgcaacttactactgtcaattgagtcggacgttcggccacgggaccaaggtggaaatcaaac

SEQ ID NO: 77

DIQMTQSPSSLSASVGDRVTISCRASQRLNSYLHWYQQTPGQAPKLLIYATSTLQSGVSPRFSGSGSGTDFTLTISSLQPEDVATYYCQLSRTFGHGTKVEIK

SEQ ID NO: 78 LCDR1RASQRLNSYLH

SEQ ID NO: 79 LCDR2ATSTLQS

SEQ ID NO: 80 LCDR3QLSRT

Антитело 9 (исходная кДНК)

SEQ ID NO: 81

caagtagagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactcacctgtgccatctccggggacagtgtctctagcaacagtgctacttggaactggatcaggcagtccccatcgagaggccttgagtggctgggaaggacatactacaggtccaagtggtataatgattatgcagattttctgaaaaggcgaataaccatcaatccagacacatccaacaacgaggtctccctgcggctgacctctgtgactcccgacgacacggctttgtattactgtgcaagaggtggccacattacggtgtttggagtgaatattgacgcctttgacgtctggggccaagggacaatggccaccgtctcttcag

SEQ ID NO: 82

QVELQQSGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYADFLKRRITINPDTSNNEVSLRLTSVTPDDTALYYCARGGHITVFGVNIDAFDVWGQGTMATVSS

SEQ ID NO: 83 HCDR1SNSATWN

SEQ ID NO: 84 HCDR2RTYYRSKWYNDYADFLKR

SEQ ID NO: 85 HCDR3GGHITVFGVNIDAFDV

SEQ ID NO: 86

gacatccaggtgacccagtctccatcctccctgtctgcatctgtaggagacagaatcaccatctcttgccggacaagtcagagccttaggagctatttacattggtatcagcaaaaaccagggaaagcccctaagctcctgatctatgcttcatccactttacaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttcactctcaccatcagcaatctccaacctgaagattttgcaacttactactgtcaactgagtcggacgttcggccaagggaccaaggttgaaatcaaac

SEQ ID NO: 87

DIQVTQSPSSLSASVGDRITISCRTSQSLRSYLHWYQQKPGKAPKLLIYASSTLQSGVPSRFSGSGSGTDFTLTISNLQPEDFATYYCQLSRTFGQGTKVEIK

SEQ ID NO: 88 LCDR1RTSQSLRSYLH

SEQ ID NO: 89 LCDR2ASSTLQS

SEQ ID NO: 90 LCDR3QLSRT

Антитело 10 (экспрессируемая форма антитела 9)

SEQ ID NO: 91

caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactcacctgtgccatctccggggacagtgtctctagcaacagtgctacttggaactggatcaggcagtccccatcgagaggccttgagtggctgggaaggacatactacaggtccaagtggtataatgattatgcagattttctgaaaaggcgaataaccatcaatccagacacatccaacaacgaggtctccctgcggctgacctctgtgactcccgacgacacggctttgtattactgtgcaagaggtggccacattacggtgtttggagtgaatattgacgcctttgacgtctggggccaagggacaatggtcaccgtctcttcag

SEQ ID NO: 92

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYADFLKRRITINPDTSNNEVSLRLTSVTPDDTALYYCARGGHITVFGVNIDAFDVWGQGTMVTVSS

SEQ ID NO: 93 HCDR1SNSATWN

SEQ ID NO: 94 HCDR2RTYYRSKWYNDYADFLKR

SEQ ID NO: 95 HCDR3GGHITVFGVNIDAFDV

SEQ ID NO: 96

gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagaatcaccatctcttgccggacaagtcagagccttaggagctatttacattggtatcagcaaaaaccagggaaagcccctaagctcctgatctatgcttcatccactttacaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttcactctcaccatcagcaatctccaacctgaagattttgcaacttactactgtcaactgagtcggacgttcggccaagggaccaaggtggagatcaaac

SEQ ID NO: 97

DIQMTQSPSSLSASVGDRITISCRTSQSLRSYLHWYQQKPGKAPKLLIYASSTLQSGVPSRFSGSGSGTDFTLTISNLQPEDFATYYCQLSRTFGQGTKVEIK

SEQ ID NO: 98 LCDR1RTSQSLRSYLH

SEQ ID NO: 99 LCDR2ASSTLQS

SEQ ID NO: 100 LCDR3QLSRT

Антитело 11

SEQ ID NO: 101

caggtccagctgcagcagagcggccccggactggtcaagccttcacagacactgagcctgacatgcgccattagcggagatagcgtgagctcctacaatgccgtgtggaactggatcaggcagtctccaagtcgaggactggagtggctgggacgaacatactatagatccgggtggtacaatgactatgctgaatcagtgaaaagccgaattactatcaaccccgatacctccaagaatcagttctctctgcagctgaacagtgtgacccctgaggacacagccgtgtactactgcgccagaagcggccatatcaccgtctttggcgtcaatgtggatgctttcgatatgtgggggcaggggactatggtcaccgtgtcaagc

SEQ ID NO: 102

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSS

SEQ ID NO: 103 HCDR1SYNAVWN

SEQ ID NO: 104 HCDR2RTYYRSGWYNDYAESVKS

SEQ ID NO: 105 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 106

gatattcagatgacccagagcccttccagcctgtccgcttcagtgggggatcgagtgaccattacctgccgaaccagccagagcctgagctcctacacgcactggtatcagcagaagcccggcaaagcccctaagctgctgatctacgccgcttctagtcggctgtccggagtgccaagccggttctccggatctgggagtggaaccgactttaccctgacaatttcaagcctgcagcccgaggatttcgctacatactactgtcagcagagcagaactttcgggcagggcactaaggtggagatcaaa

SEQ ID NO: 107

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYTHWYQQKPGKAPKLLIYAASSRLSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 108 LCDR1RTSQSLSSYTH

SEQ ID NO: 109 LCDR2AASSRLS

SEQ ID NO: 110 LCDR3QQSRT

Антитело 12

SEQ ID NO: 111

caggtccagctgcagcagagcggccccggactggtcaagccttcacagacactgagcctgacatgcgccattagcggagatagcgtgagctcctacaatgccgtgtggaactggatcaggcagtctccaagtcgaggactggagtggctgggacgaacatactatagatccgggtggtacaatgactatgctgaatcagtgaaaagccgaattactatcaaccccgatacctccaagaatcagttctctctgcagctgaacagtgtgacccctgaggacacagccgtgtactactgcgccagaagcggccatatcaccgtctttggcgtcaatgtggatgctttcgatatgtgggggcaggggactatggtcaccgtgtcaagc

SEQ ID NO: 112

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSS

SEQ ID NO: 113 HCDR1SYNAVWN

SEQ ID NO: 114 HCDR2RTYYRSGWYNDYAESVKS

SEQ ID NO: 115 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 116

gatattcagatgacccagagcccttccagcctgtccgcttcagtgggggatcgagtgaccattacctgccgaaccagccagagcctgagctcctacacgcactggtatcagcagaagcccggcaaagcccctaagctgctgatctacgccgcttctagtcgggggtccggagtgccaagccggttctccggatctgggagtggaaccgactttaccctgacaatttcaagcctgcagcccgaggatttcgctacatactactgtcagcagagcagaactttcgggcagggcactaaggtggagatcaaa

SEQ ID NO: 117

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYTHWYQQKPGKAPKLLIYAASSRGSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 118 LCDR1RTSQSLSSYTH

SEQ ID NO: 119 LCDR2AASSRGS

SEQ ID NO: 120 LCDR3QQSRT

Антитело 13

SEQ ID NO: 121

caggtccagctgcagcagagcggccccggactggtcaagccttcacagacactgagcctgacatgcgccattagcggagatagcgtgagctcctacaatgccgtgtggaactggatcaggcagtctccaagtcgaggactggagtggctgggacgaacatactatagatccgggtggtacaatgactatgctgaatcagtgaaaagccgaattactatcaaccccgatacctccaagaatcagttctctctgcagctgaacagtgtgacccctgaggacacagccgtgtactactgcgccagaagcggccatatcaccgtctttggcgtcaatgtggatgctttcgatatgtgggggcaggggactatggtcaccgtgtcaagc

SEQ ID NO: 122

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSS

SEQ ID NO: 123 HCDR1SYNAVWN

SEQ ID NO: 124 HCDR2RTYYRSGWYNDYAESVKS

SEQ ID NO: 125 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 126

gatattcagatgacccagagcccttccagcctgtccgcttcagtgggggatcgagtgaccattacctgccgaaccagccagagcctgagctcctacgaccactggtatcagcagaagcccggcaaagcccctaagctgctgatctacgccgcttctagtcggctgtccggagtgccaagccggttctccggatctgggagtggaaccgactttaccctgacaatttcaagcctgcagcccgaggatttcgctacatactactgtcagcagagcagaactttcgggcagggcactaaggtggagatcaaa

SEQ ID NO: 127

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYDHWYQQKPGKAPKLLIYAASSRLSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 128 LCDR1RTSQSLSSYDH

SEQ ID NO: 129 LCDR2AASSRLS

SEQ ID NO: 130 LCDR3QQSRT

Антитело 14

SEQ ID NO: 131

caggtccagctgcagcagagcggccccggactggtcaagccttcacagacactgagcctgacatgcgccattagcggagatagcgtgagctccaacaatgccgtgtggaactggatcaggcagtctccaagtcgaggactggagtggctgggacgaacatactatagatccaagtggtacaatgactatgctgaatcagtgaaaagccgaattactatcaaccccgatacctccaagaatcagttctctctgcagctgaacagtgtgacccctgaggacacagccgtgtactactgcgccagaagcggccatatcaccgtctttggcgtcaatgtggatgctttcgatatgtgggggcaggggaccacagtcaccgtctcctca

SEQ ID NO: 132

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNNAVWNWIRQSPSRGLEWLGRTYYRSKWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTTVTVSS

SEQ ID NO: 133 HCDR1SNNAVWN

SEQ ID NO: 134 HCDR2RTYYRSKWYNDYAESVKS

SEQ ID NO: 135 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 136

gatattcagatgacccagagcccttccagcctgtccgcttcagtgggggatcgagtgaccattacctgccgaaccagccagagcctgagctcctacacgcactggtatcagcagaagcccggcaaagcccctaagctgctgatctacgccgcttctagtcggctgtccggagtgccaagccggttctccggatctgggagtggaaccgactttaccctgacaatttcaagcctgcagcccgaggatttcgctacatactactgtcagcagagcagaactttcgggcagggcactaaggtggagatcaaa

SEQ ID NO: 137

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYTHWYQQKPGKAPKLLIYAASSRLSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 138 LCDR1RTSQSLSSYTH

SEQ ID NO: 139 LCDR2AASSRLS

SEQ ID NO: 140 LCDR3QQSRT

Антитело 15

SEQ ID NO: 141

caggtccagctgcagcagagcggccccggactggtcaagccttcacagacactgagcctgacatgcgccattagcggagatagcgtgagctccaacaatgccgtgtggaactggatcaggcagtctccaagtcgaggactggagtggctgggacgaacatactatagatccaagtggtacaatgactatgctgaatcagtgaaaagccgaattactatcaaccccgatacctccaagaatcagttctctctgcagctgaacagtgtgacccctgaggacacagccgtgtactactgcgccagaagcggccatatcaccgtctttggcgtcaatgtggatgctttcgatatgtgggggcaggggaccacagtcaccgtctcctca

SEQ ID NO: 142

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNNAVWNWIRQSPSRGLEWLGRTYYRSKWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTTVTVSS

SEQ ID NO: 143 HCDR1SNNAVWN

SEQ ID NO: 144 HCDR2RTYYRSKWYNDYAESVKS

SEQ ID NO: 145 HCDR3SGHITVFGVNVDAFDM

SEQ ID NO: 146

gatattcagatgacccagagcccttccagcctgtccgcttcagtgggggatcgagtgaccattacctgccgaaccagccagagcctgagytcctacacgcactggtatcagcagaagcccggcaaagcccctaagctgctgatctacgccgcttctagtcgggggtccggagtgccaagccggttctccggatctgggagtggaaccgactttaccctgacaatttcaagcctgcagcccgaggatttcgctacatactactgtcagcagagcagaactttcgggcagggcactaaggtggagatcaaa

SEQ ID NO: 147

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYTHWYQQKPGKAPKLLIYAASSRGSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 148 LCDR1RTSQSLSSYTH

SEQ ID NO: 149 LCDR2AASSRGS

SEQ ID NO: 150 LCDR3QQSRT

Антитело 3-GL

SEQ ID NO: 151

caggtccagctgcagcagagcggccccggactggtcaagccttcacagacactgagcctgacatgcgccattagcggagatagcgtgagctccaacaatgccgtgtggaactggatcaggcagtctccaagtcgaggactggagtggctgggacgaacatactatagatccaagtggtacaatgactatgctgaatcagtgaaaagccgaattactatcaaccccgatacctccaagaatcagttctctctgcagctgaacagtgtgacccctgaggacacagccgtgtactactgcgccagaagcggccatatcaccgtctttggcgtcaatgtggatgctttcgatatgtgggggcaggggaccacagtcaccgtctcctca

SEQ ID NO: 152

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNNAVWNWIRQSPSRGLEWLGRTYYRSKWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTTVTVSS

SEQ ID NO: 153 HCDR1 SNNAVWN

SEQ ID NO: 154 HCDR2 RTYYRSKWYNDYAESVKS

SEQ ID NO: 155 HCDR3 SGHITVFGVNVDAFDM

SEQ ID NO: 156

gatattcagatgacccagagcccttccagcctgtccgcttcagtgggggatcgagtgaccattacctgccgaaccagccagagcctgagctcctacctgcactggtatcagcagaagcccggcaaagcccctaagctgctgatctacgccgcttctagtctgcagtccggagtgccaagccggttctccggatctgggagtggaaccgactttaccctgacaatttcaagcctgcagcccgaggatttcgctacatactactgtcagcagagcagaactttcgggcagggcactaaggtggagatcaaa

SEQ ID NO: 157

DIQMTQSPSSLSASVGDRVTITCRTSQSLSSYLHWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIK

SEQ ID NO: 158 LCDR1 RTSQSLSSYLH

SEQ ID NO: 159 LCDR2 AASSLQS

SEQ ID NO: 160 LCDR3 QQSRT

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ

<110> МЕДИММЬЮН, ЭЛ.ЭЛ.СИ

ХЬЮМАБС БИОМЕД ЭС.ЭЙ

<120> НЕЙТРАЛИЗУЮЩИЕ АНТИТЕЛА К ВИРУСУ ГРИППА А И ПУТИ ИХ ПРИМЕНЕНИЯ

<130> FLUA-100WO1

<140> PCT/US2014/058652

<141> 2014-10-01

<150> 62/002,414

<151> 2014-05-23

<150> 61/885,808

<151> 2013-10-02

<160> 172

<170> PatentIn версия 3.5

<210> 1

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 1

cagatacagc tgcaggagtc gggtccagga ctggtgaagc cctcgcagac cctctcactc 60

acctgtgcca tctccgggga cagtgtctct agcaacaatg ctgtttggaa ctggatcagg 120

cagtccccat cgagaggcct tgagtggctg ggaaggacat actacaggtc caagtggtat 180

aatgattatg cagaatctgt gaaaagtcga ataaccgtca atccagacac atccaagaac 240

cagttctccc tgcacctgaa gtctgtgact cccgaggaca cggctgtgtt ttactgtgta 300

cgatctggcc acattacggt ttttggagtg aatgttgacg cttttgatat gtggggccaa 360

gggacaatgg tcaccgtctc ttcag 385

<210> 2

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 2

Gln Ile Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Val Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu His Leu Lys Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Phe Tyr Cys Val Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 3

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 3

Ser Asn Asn Ala Val Trp Asn

1 5

<210> 4

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 4

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 5

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 5

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 6

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 6

gacatccaga tcacccagtc gccatcctcc ctgtctgcat ctgtaggaga cagagtaacc 60

atcacttgcc ggacaagtca gagccttagt agctatttac attggtatca gcagaaacca 120

gggaaagccc ctaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca 180

aggttcagtg gcagtggatc tgggacagat ttcactctca ccatcagtag tctgcaacct 240

gaagattttg caacttacta ctgtcaacag agtcggacgt tcggccaagg gaccaaggtg 300

gaaatcaaa 309

<210> 7

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 7

Asp Ile Gln Ile Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 8

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 8

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Leu His

1 5 10

<210> 9

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 9

Ala Ala Ser Ser Leu Gln Ser

1 5

<210> 10

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 10

Gln Gln Ser Arg Thr

1 5

<210> 11

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 11

caggtacagc tgcaggagtc gggtccagga ctggtgaagc cctcgcagac cctctcactc 60

acctgtgcca tctccgggga cagtgtctct agcaacaatg ctgtttggaa ctggatcagg 120

cagtccccat cgagaggcct tgagtggctg ggaaggacat actacaggtc caagtggtat 180

aatgattatg cagaatctgt gaaaagtcga ataaccgtca atccagacac atccaagaac 240

cagttctccc tgcacctgaa gtctgtgact cccgaggaca cggctgtgtt ttactgtgta 300

cgatctggcc acattacggt ttttggagtg aatgttgacg cttttgatat gtggggccaa 360

gggacaatgg tcaccgtctc ttcag 385

<210> 12

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 12

Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Val Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu His Leu Lys Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Phe Tyr Cys Val Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 13

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 13

Ser Asn Asn Ala Val Trp Asn

1 5

<210> 14

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 14

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 15

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 15

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 16

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 16

gacatccaga tgacccagtc gccatcctcc ctgtctgcat ctgtaggaga cagagtaacc 60

atcacttgcc ggacaagtca gagccttagt agctatttac attggtatca gcagaaacca 120

gggaaagccc ctaagctcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca 180

aggttcagtg gcagtggatc tgggacagat ttcactctca ccatcagtag tctgcaacct 240

gaagattttg caacttacta ctgtcaacag agtcggacgt tcggccaagg gaccaaggtg 300

gaaatcaaa 309

<210> 17

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 17

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 18

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 18

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Leu His

1 5 10

<210> 19

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 19

Ala Ala Ser Ser Leu Gln Ser

1 5

<210> 20

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 20

Gln Gln Ser Arg Thr

1 5

<210> 21

<211> 384

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 21

caggtccagc tgcaggagag cggccccgga ctggtcaagc cttcacagac actgagcctg 60

acatgcgcca ttagcggaga tagcgtgagc tccaacaatg ccgtgtggaa ctggatcagg 120

cagtctccaa gtcgaggact ggagtggctg ggacgaacat actatagatc caagtggtac 180

aatgactatg ctgaatcagt gaaaagccga attactgtca accccgatac ctccaagaat 240

cagttctctc tgcacctgaa aagtgtgacc cctgaggaca cagccgtgtt ctactgcgtc 300

agaagcggcc atatcaccgt ctttggcgtc aatgtggatg ctttcgatat gtgggggcag 360

gggactatgg tcaccgtgtc aagc 384

<210> 22

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 22

Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Val Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu His Leu Lys Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Phe Tyr Cys Val Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 23

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 23

Ser Asn Asn Ala Val Trp Asn

1 5

<210> 24

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 24

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 25

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 25

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 26

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 26

gatattcaga tgacccagag cccttccagc ctgtccgctt cagtggggga tcgagtgacc 60

attacctgcc gaaccagcca gagcctgagc tcctacctgc actggtatca gcagaagccc 120

ggcaaagccc ctaagctgct gatctacgcc gcttctagtc tgcagtccgg agtgccaagc 180

cggttctccg gatctgggag tggaaccgac tttaccctga caatttcaag cctgcagccc 240

gaggatttcg ctacatacta ctgtcagcag agcagaactt tcgggcaggg cactaaggtg 300

gagatcaaa 309

<210> 27

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 27

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 28

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 28

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Leu His

1 5 10

<210> 29

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 29

Ala Ala Ser Ser Leu Gln Ser

1 5

<210> 30

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 30

Gln Gln Ser Arg Thr

1 5

<210> 31

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 31

caggtccagc tgcagcagtc aggtccagga ctggtgaagc cctcgcagac cctctcactc 60

acctgtgcca tctccgggga cagagtctct agcaacagtg ctgtttggaa ctggatcagg 120

cagtccccat cgagaggcct cgagtggctg ggaaggacat attacaggtc caaatggtat 180

tatgattatg cagaatctgt gaaaagtcga atagttatcg acccagacac atccaagaac 240

caggtctccc tgcagttgaa ttctgtgact cccgaggact cggctatata ttactgtgca 300

agaggtggcc acattacggt gtttgggctg aatattgacg cttatgatat ttggggccaa 360

ggggcaaagg tcaccgtgtc ttcag 385

<210> 32

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 32

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Arg Val Ser Ser Asn

20 25 30

Ser Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Tyr Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Val Ile Asp Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Val Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Ser Ala Ile

85 90 95

Tyr Tyr Cys Ala Arg Gly Gly His Ile Thr Val Phe Gly Leu Asn Ile

100 105 110

Asp Ala Tyr Asp Ile Trp Gly Gln Gly Ala Lys Val Thr Val Ser Ser

115 120 125

<210> 33

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 33

Ser Asn Ser Ala Val Trp Asn

1 5

<210> 34

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 34

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Tyr Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 35

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 35

Gly Gly His Ile Thr Val Phe Gly Leu Asn Ile Asp Ala Tyr Asp Ile

1 5 10 15

<210> 36

<211> 307

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 36

gacatccagg tgacccagtc tccgtcctcc ctgtctgcat ctgtaggaga cagagtcacc 60

atctcttgcc gggcacagag ccttagcagc tacttacatt ggtatcagca gaaaccaggg 120

caacccccta aactcctgat ctatgctgca accactttgc aaagtggggt cccatcacgg 180

ttcagtggta gtggatctgg gacagatttc actctcacca tcagtacttt ccaagctgaa 240

gatgttgcca cttactattg tcaacagagt cggacgttcg gccaagggac caaggttgaa 300

atcaaac 307

<210> 37

<211> 102

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 37

Asp Ile Gln Val Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Ser Cys Arg Ala Gln Ser Leu Ser Ser Tyr Leu

20 25 30

His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr

35 40 45

Ala Ala Thr Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Thr Phe Gln Ala Glu

65 70 75 80

Asp Val Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln Gly

85 90 95

Thr Lys Val Glu Ile Lys

100

<210> 38

<211> 10

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 38

Arg Ala Gln Ser Leu Ser Ser Tyr Leu His

1 5 10

<210> 39

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 39

Ala Ala Thr Thr Leu Gln Ser

1 5

<210> 40

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 40

Gln Gln Ser Arg Thr

1 5

<210> 41

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 41

caggtacagc tgcagcagtc aggtccagga ctggtgaagc cctcgcagac cctctcactc 60

acctgtgcca tctccgggga cagagtctct agcaacagtg ctgtttggaa ctggatcagg 120

cagtccccat cgagaggcct cgagtggctg ggaaggacat attacaggtc caaatggtat 180

tatgattatg cagaatctgt gaaaagtcga atagttatcg acccagacac atccaagaac 240

caggtctccc tgcagttgaa ttctgtgact cccgaggact cggctatata ttactgtgca 300

agaggtggcc acattacggt gtttgggctg aatattgacg cttatgatat ttggggccaa 360

ggggcaatgg tcaccgtctc ttcag 385

<210> 42

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 42

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Arg Val Ser Ser Asn

20 25 30

Ser Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Tyr Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Val Ile Asp Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Val Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Ser Ala Ile

85 90 95

Tyr Tyr Cys Ala Arg Gly Gly His Ile Thr Val Phe Gly Leu Asn Ile

100 105 110

Asp Ala Tyr Asp Ile Trp Gly Gln Gly Ala Met Val Thr Val Ser Ser

115 120 125

<210> 43

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 43

Ser Asn Ser Ala Val Trp Asn

1 5

<210> 44

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 44

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Tyr Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 45

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 45

Gly Gly His Ile Thr Val Phe Gly Leu Asn Ile Asp Ala Tyr Asp Ile

1 5 10 15

<210> 46

<211> 307

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 46

gacatccaga tgacccagtc tccgtcctcc ctgtctgcat ctgtaggaga cagagtcacc 60

atctcttgcc gggcacagag ccttagcagc tacttacatt ggtatcagca gaaaccaggg 120

caacccccta aactcctgat ctatgctgca accactttgc aaagtggggt cccatcacgg 180

ttcagtggta gtggatctgg gacagatttc actctcacca tcagtacttt ccaagctgaa 240

gatgttgcca cttactattg tcaacagagt cggacgttcg gccaagggac caaggtggag 300

atcaaac 307

<210> 47

<211> 102

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 47

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Ser Cys Arg Ala Gln Ser Leu Ser Ser Tyr Leu

20 25 30

His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr

35 40 45

Ala Ala Thr Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Thr Phe Gln Ala Glu

65 70 75 80

Asp Val Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln Gly

85 90 95

Thr Lys Val Glu Ile Lys

100

<210> 48

<211> 10

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 48

Arg Ala Gln Ser Leu Ser Ser Tyr Leu His

1 5 10

<210> 49

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 49

Ala Ala Thr Thr Leu Gln Ser

1 5

<210> 50

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 50

Gln Gln Ser Arg Thr

1 5

<210> 51

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 51

caggtacagc tgcagcagtc aggtccagga ctggtgaagc cctcgcagac cctctcactc 60

acctgtgcca tctccgggga cagagtctct agcaacagtg ctgtttggaa ctggatcagg 120

cagtccccat cgagaggcct cgagtggctg ggaaggacat attacaggtc caaatggtat 180

tatgattatg cagaatctgt gaaaagtcga atagttatcg acccagacac atccaagaac 240

caggtctccc tgcagttgaa ttctgtgact cccgaggact cggctatata ttactgtgca 300

agaggtggcc acattacgga gtttgggctg aatattgacg cttatgatat ttggggccaa 360

ggggcaatgg tcaccgtctc ttcag 385

<210> 52

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 52

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Arg Val Ser Ser Asn

20 25 30

Ser Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Tyr Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Val Ile Asp Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Val Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Ser Ala Ile

85 90 95

Tyr Tyr Cys Ala Arg Gly Gly His Ile Thr Glu Phe Gly Leu Asn Ile

100 105 110

Asp Ala Tyr Asp Ile Trp Gly Gln Gly Ala Met Val Thr Val Ser Ser

115 120 125

<210> 53

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 53

Ser Asn Ser Ala Val Trp Asn

1 5

<210> 54

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 54

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Tyr Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 55

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 55

Gly Gly His Ile Thr Glu Phe Gly Leu Asn Ile Asp Ala Tyr Asp Ile

1 5 10 15

<210> 56

<211> 307

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 56

gacatccaga tgacccagtc tccgtcctcc ctgtctgcat ctgtaggaga cagagtcacc 60

atctcttgcc gggcacagag ccttagcagc tacttacatt ggtatcagca gaaaccaggg 120

caacccccta aactcctgat ctatgctgca accactttgc aaagtggggt cccatcacgg 180

ttcagtggta gtggatctgg gacagatttc actctcacca tcagtacttt ccaagctgaa 240

gatgttgcca cttactattg tcaacagagt cggacgttcg gccaagggac caaggtggag 300

atcaaac 307

<210> 57

<211> 102

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 57

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Ser Cys Arg Ala Gln Ser Leu Ser Ser Tyr Leu

20 25 30

His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr

35 40 45

Ala Ala Thr Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Thr Phe Gln Ala Glu

65 70 75 80

Asp Val Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln Gly

85 90 95

Thr Lys Val Glu Ile Lys

100

<210> 58

<211> 10

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 58

Arg Ala Gln Ser Leu Ser Ser Tyr Leu His

1 5 10

<210> 59

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 59

Ala Ala Thr Thr Leu Gln Ser

1 5

<210> 60

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 60

Gln Gln Ser Arg Thr

1 5

<210> 61

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 61

caggtacagc tgcagcagtc aggtccagga ctggtgaagc cctcgcagac cctctccctc 60

acctgtgtca tctccggaga cactgtctct agcaacagag ctacttggaa ttggatgagg 120

cagtccccat tgagaggcct tgagtggctg ggaaggacat actacaggtc caagtggtat 180

aatgattacg cagtttctgt gaaaagtcga gtagtcatca acccagacac atccaagaac 240

caagtctccc tgcagttgaa cactgtgact cccgatgact cgggtgtata cttttgtgca 300

agaggtggcc acatcacggt ctttggagtg aatattgacg cttttgacat ctggggcctc 360

gggacaaagg tcaccgtctc ttcag 385

<210> 62

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 62

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Val Ile Ser Gly Asp Thr Val Ser Ser Asn

20 25 30

Arg Ala Thr Trp Asn Trp Met Arg Gln Ser Pro Leu Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Val Ser Val Lys Ser Arg Val Val Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Val Ser Leu Gln Leu Asn Thr Val Thr Pro Asp Asp Ser Gly Val

85 90 95

Tyr Phe Cys Ala Arg Gly Gly His Ile Thr Val Phe Gly Val Asn Ile

100 105 110

Asp Ala Phe Asp Ile Trp Gly Leu Gly Thr Lys Val Thr Val Ser Ser

115 120 125

<210> 63

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 63

Ser Asn Arg Ala Thr Trp Asn

1 5

<210> 64

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 64

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Val Ser Val

1 5 10 15

Lys Ser

<210> 65

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 65

Gly Gly His Ile Thr Val Phe Gly Val Asn Ile Asp Ala Phe Asp Ile

1 5 10 15

<210> 66

<211> 310

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 66

gacatccagg tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagttacc 60

atctcttgcc gggcaagtca gagacttaat agttatctac attggtatca gcagacacca 120

gggcaagccc cgaagctgct gatctatgca acgtccactt tgcaaagtgg ggtctcacca 180

agattcagtg gcagtggatc tgggacagat ttcactctca ccatcagcag tctccaacct 240

gaagatgttg caacttacta ctgtcaattg agtcggacgt tcggccacgg gaccaaggtt 300

gaaatcaaac 310

<210> 67

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 67

Asp Ile Gln Val Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Arg Leu Asn Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Thr Pro Gly Gln Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Thr Ser Thr Leu Gln Ser Gly Val Ser Pro Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Val Ala Thr Tyr Tyr Cys Gln Leu Ser Arg Thr Phe Gly His

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 68

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 68

Arg Ala Ser Gln Arg Leu Asn Ser Tyr Leu His

1 5 10

<210> 69

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 69

Ala Thr Ser Thr Leu Gln Ser

1 5

<210> 70

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 70

Gln Leu Ser Arg Thr

1 5

<210> 71

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 71

caggtacagc tgcagcagtc aggtccagga ctggtgaagc cctcgcagac cctctccctc 60

acctgtgtca tctccggaga cactgtctct agcaacagag ctacttggaa ttggatgagg 120

cagtccccat tgagaggcct tgagtggctg ggaaggacat actacaggtc caagtggtat 180

aatgattacg cagtttctgt gaaaagtcga gtagtcatca acccagacac atccaagaac 240

caagtctccc tgcagttgaa cactgtgact cccgatgact cgggtgtata cttttgtgca 300

agaggtggcc acatcacggt ctttggagtg aatattgacg cttttgacat ctggggcctc 360

gggacaaagg tcaccgtctc ttcag 385

<210> 72

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 72

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Val Ile Ser Gly Asp Thr Val Ser Ser Asn

20 25 30

Arg Ala Thr Trp Asn Trp Met Arg Gln Ser Pro Leu Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Val Ser Val Lys Ser Arg Val Val Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Val Ser Leu Gln Leu Asn Thr Val Thr Pro Asp Asp Ser Gly Val

85 90 95

Tyr Phe Cys Ala Arg Gly Gly His Ile Thr Val Phe Gly Val Asn Ile

100 105 110

Asp Ala Phe Asp Ile Trp Gly Leu Gly Thr Lys Val Thr Val Ser Ser

115 120 125

<210> 73

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 73

Ser Asn Arg Ala Thr Trp Asn

1 5

<210> 74

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 74

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Val Ser Val

1 5 10 15

Lys Ser

<210> 75

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 75

Gly Gly His Ile Thr Val Phe Gly Val Asn Ile Asp Ala Phe Asp Ile

1 5 10 15

<210> 76

<211> 310

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 76

gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagttacc 60

atctcttgcc gggcaagtca gagacttaat agttatctac attggtatca gcagacacca 120

gggcaagccc cgaagctgct gatctatgca acgtccactt tgcaaagtgg ggtctcacca 180

agattcagtg gcagtggatc tgggacagat ttcactctca ccatcagcag tctccaacct 240

gaagatgttg caacttacta ctgtcaattg agtcggacgt tcggccacgg gaccaaggtg 300

gaaatcaaac 310

<210> 77

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 77

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Arg Leu Asn Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Thr Pro Gly Gln Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Thr Ser Thr Leu Gln Ser Gly Val Ser Pro Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Val Ala Thr Tyr Tyr Cys Gln Leu Ser Arg Thr Phe Gly His

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 78

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 78

Arg Ala Ser Gln Arg Leu Asn Ser Tyr Leu His

1 5 10

<210> 79

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 79

Ala Thr Ser Thr Leu Gln Ser

1 5

<210> 80

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 80

Gln Leu Ser Arg Thr

1 5

<210> 81

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 81

caagtagagc tgcagcagtc aggtccagga ctggtgaagc cctcgcagac cctctcactc 60

acctgtgcca tctccgggga cagtgtctct agcaacagtg ctacttggaa ctggatcagg 120

cagtccccat cgagaggcct tgagtggctg ggaaggacat actacaggtc caagtggtat 180

aatgattatg cagattttct gaaaaggcga ataaccatca atccagacac atccaacaac 240

gaggtctccc tgcggctgac ctctgtgact cccgacgaca cggctttgta ttactgtgca 300

agaggtggcc acattacggt gtttggagtg aatattgacg cctttgacgt ctggggccaa 360

gggacaatgg ccaccgtctc ttcag 385

<210> 82

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 82

Gln Val Glu Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Ser Ala Thr Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Asp Phe Leu Lys Arg Arg Ile Thr Ile Asn Pro Asp Thr Ser Asn Asn

65 70 75 80

Glu Val Ser Leu Arg Leu Thr Ser Val Thr Pro Asp Asp Thr Ala Leu

85 90 95

Tyr Tyr Cys Ala Arg Gly Gly His Ile Thr Val Phe Gly Val Asn Ile

100 105 110

Asp Ala Phe Asp Val Trp Gly Gln Gly Thr Met Ala Thr Val Ser Ser

115 120 125

<210> 83

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 83

Ser Asn Ser Ala Thr Trp Asn

1 5

<210> 84

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 84

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Asp Phe Leu

1 5 10 15

Lys Arg

<210> 85

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 85

Gly Gly His Ile Thr Val Phe Gly Val Asn Ile Asp Ala Phe Asp Val

1 5 10 15

<210> 86

<211> 310

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 86

gacatccagg tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagaatcacc 60

atctcttgcc ggacaagtca gagccttagg agctatttac attggtatca gcaaaaacca 120

gggaaagccc ctaagctcct gatctatgct tcatccactt tacaaagtgg ggtcccatca 180

aggttcagtg gcagtggatc tgggacagat ttcactctca ccatcagcaa tctccaacct 240

gaagattttg caacttacta ctgtcaactg agtcggacgt tcggccaagg gaccaaggtt 300

gaaatcaaac 310

<210> 87

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 87

Asp Ile Gln Val Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Ile Thr Ile Ser Cys Arg Thr Ser Gln Ser Leu Arg Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ser Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Asn Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Leu Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 88

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 88

Arg Thr Ser Gln Ser Leu Arg Ser Tyr Leu His

1 5 10

<210> 89

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 89

Ala Ser Ser Thr Leu Gln Ser

1 5

<210> 90

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 90

Gln Leu Ser Arg Thr

1 5

<210> 91

<211> 385

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 91

caggtacagc tgcagcagtc aggtccagga ctggtgaagc cctcgcagac cctctcactc 60

acctgtgcca tctccgggga cagtgtctct agcaacagtg ctacttggaa ctggatcagg 120

cagtccccat cgagaggcct tgagtggctg ggaaggacat actacaggtc caagtggtat 180

aatgattatg cagattttct gaaaaggcga ataaccatca atccagacac atccaacaac 240

gaggtctccc tgcggctgac ctctgtgact cccgacgaca cggctttgta ttactgtgca 300

agaggtggcc acattacggt gtttggagtg aatattgacg cctttgacgt ctggggccaa 360

gggacaatgg tcaccgtctc ttcag 385

<210> 92

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 92

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Ser Ala Thr Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Asp Phe Leu Lys Arg Arg Ile Thr Ile Asn Pro Asp Thr Ser Asn Asn

65 70 75 80

Glu Val Ser Leu Arg Leu Thr Ser Val Thr Pro Asp Asp Thr Ala Leu

85 90 95

Tyr Tyr Cys Ala Arg Gly Gly His Ile Thr Val Phe Gly Val Asn Ile

100 105 110

Asp Ala Phe Asp Val Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 93

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 93

Ser Asn Ser Ala Thr Trp Asn

1 5

<210> 94

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 94

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Asp Phe Leu

1 5 10 15

Lys Arg

<210> 95

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 95

Gly Gly His Ile Thr Val Phe Gly Val Asn Ile Asp Ala Phe Asp Val

1 5 10 15

<210> 96

<211> 310

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 96

gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagaatcacc 60

atctcttgcc ggacaagtca gagccttagg agctatttac attggtatca gcaaaaacca 120

gggaaagccc ctaagctcct gatctatgct tcatccactt tacaaagtgg ggtcccatca 180

aggttcagtg gcagtggatc tgggacagat ttcactctca ccatcagcaa tctccaacct 240

gaagattttg caacttacta ctgtcaactg agtcggacgt tcggccaagg gaccaaggtg 300

gagatcaaac 310

<210> 97

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 97

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Ile Thr Ile Ser Cys Arg Thr Ser Gln Ser Leu Arg Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ser Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Asn Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Leu Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 98

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 98

Arg Thr Ser Gln Ser Leu Arg Ser Tyr Leu His

1 5 10

<210> 99

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 99

Ala Ser Ser Thr Leu Gln Ser

1 5

<210> 100

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 100

Gln Leu Ser Arg Thr

1 5

<210> 101

<211> 384

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 101

caggtccagc tgcagcagag cggccccgga ctggtcaagc cttcacagac actgagcctg 60

acatgcgcca ttagcggaga tagcgtgagc tcctacaatg ccgtgtggaa ctggatcagg 120

cagtctccaa gtcgaggact ggagtggctg ggacgaacat actatagatc cgggtggtac 180

aatgactatg ctgaatcagt gaaaagccga attactatca accccgatac ctccaagaat 240

cagttctctc tgcagctgaa cagtgtgacc cctgaggaca cagccgtgta ctactgcgcc 300

agaagcggcc atatcaccgt ctttggcgtc aatgtggatg ctttcgatat gtgggggcag 360

gggactatgg tcaccgtgtc aagc 384

<210> 102

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 102

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Tyr

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Gly Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Tyr Tyr Cys Ala Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 103

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 103

Ser Tyr Asn Ala Val Trp Asn

1 5

<210> 104

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 104

Arg Thr Tyr Tyr Arg Ser Gly Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 105

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 105

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 106

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 106

gatattcaga tgacccagag cccttccagc ctgtccgctt cagtggggga tcgagtgacc 60

attacctgcc gaaccagcca gagcctgagc tcctacacgc actggtatca gcagaagccc 120

ggcaaagccc ctaagctgct gatctacgcc gcttctagtc ggctgtccgg agtgccaagc 180

cggttctccg gatctgggag tggaaccgac tttaccctga caatttcaag cctgcagccc 240

gaggatttcg ctacatacta ctgtcagcag agcagaactt tcgggcaggg cactaaggtg 300

gagatcaaa 309

<210> 107

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 107

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Thr His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Arg Leu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 108

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 108

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Thr His

1 5 10

<210> 109

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 109

Ala Ala Ser Ser Arg Leu Ser

1 5

<210> 110

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 110

Gln Gln Ser Arg Thr

1 5

<210> 111

<211> 384

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 111

caggtccagc tgcagcagag cggccccgga ctggtcaagc cttcacagac actgagcctg 60

acatgcgcca ttagcggaga tagcgtgagc tcctacaatg ccgtgtggaa ctggatcagg 120

cagtctccaa gtcgaggact ggagtggctg ggacgaacat actatagatc cgggtggtac 180

aatgactatg ctgaatcagt gaaaagccga attactatca accccgatac ctccaagaat 240

cagttctctc tgcagctgaa cagtgtgacc cctgaggaca cagccgtgta ctactgcgcc 300

agaagcggcc atatcaccgt ctttggcgtc aatgtggatg ctttcgatat gtgggggcag 360

gggactatgg tcaccgtgtc aagc 384

<210> 112

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 112

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Tyr

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Gly Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Tyr Tyr Cys Ala Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 113

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 113

Ser Tyr Asn Ala Val Trp Asn

1 5

<210> 114

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 114

Arg Thr Tyr Tyr Arg Ser Gly Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 115

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 115

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 116

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 116

gatattcaga tgacccagag cccttccagc ctgtccgctt cagtggggga tcgagtgacc 60

attacctgcc gaaccagcca gagcctgagc tcctacacgc actggtatca gcagaagccc 120

ggcaaagccc ctaagctgct gatctacgcc gcttctagtc gggggtccgg agtgccaagc 180

cggttctccg gatctgggag tggaaccgac tttaccctga caatttcaag cctgcagccc 240

gaggatttcg ctacatacta ctgtcagcag agcagaactt tcgggcaggg cactaaggtg 300

gagatcaaa 309

<210> 117

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 117

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Thr His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Arg Gly Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 118

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 118

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Thr His

1 5 10

<210> 119

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 119

Ala Ala Ser Ser Arg Gly Ser

1 5

<210> 120

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 120

Gln Gln Ser Arg Thr

1 5

<210> 121

<211> 384

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 121

caggtccagc tgcagcagag cggccccgga ctggtcaagc cttcacagac actgagcctg 60

acatgcgcca ttagcggaga tagcgtgagc tcctacaatg ccgtgtggaa ctggatcagg 120

cagtctccaa gtcgaggact ggagtggctg ggacgaacat actatagatc cgggtggtac 180

aatgactatg ctgaatcagt gaaaagccga attactatca accccgatac ctccaagaat 240

cagttctctc tgcagctgaa cagtgtgacc cctgaggaca cagccgtgta ctactgcgcc 300

agaagcggcc atatcaccgt ctttggcgtc aatgtggatg ctttcgatat gtgggggcag 360

gggactatgg tcaccgtgtc aagc 384

<210> 122

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 122

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Tyr

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Gly Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Tyr Tyr Cys Ala Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 123

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 123

Ser Tyr Asn Ala Val Trp Asn

1 5

<210> 124

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 124

Arg Thr Tyr Tyr Arg Ser Gly Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 125

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 125

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 126

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 126

gatattcaga tgacccagag cccttccagc ctgtccgctt cagtggggga tcgagtgacc 60

attacctgcc gaaccagcca gagcctgagc tcctacgacc actggtatca gcagaagccc 120

ggcaaagccc ctaagctgct gatctacgcc gcttctagtc ggctgtccgg agtgccaagc 180

cggttctccg gatctgggag tggaaccgac tttaccctga caatttcaag cctgcagccc 240

gaggatttcg ctacatacta ctgtcagcag agcagaactt tcgggcaggg cactaaggtg 300

gagatcaaa 309

<210> 127

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 127

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Asp His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Arg Leu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 128

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 128

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Asp His

1 5 10

<210> 129

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 129

Ala Ala Ser Ser Arg Leu Ser

1 5

<210> 130

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 130

Gln Gln Ser Arg Thr

1 5

<210> 131

<211> 384

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 131

caggtccagc tgcagcagag cggccccgga ctggtcaagc cttcacagac actgagcctg 60

acatgcgcca ttagcggaga tagcgtgagc tccaacaatg ccgtgtggaa ctggatcagg 120

cagtctccaa gtcgaggact ggagtggctg ggacgaacat actatagatc caagtggtac 180

aatgactatg ctgaatcagt gaaaagccga attactatca accccgatac ctccaagaat 240

cagttctctc tgcagctgaa cagtgtgacc cctgaggaca cagccgtgta ctactgcgcc 300

agaagcggcc atatcaccgt ctttggcgtc aatgtggatg ctttcgatat gtgggggcag 360

gggaccacag tcaccgtctc ctca 384

<210> 132

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 132

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Tyr Tyr Cys Ala Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120 125

<210> 133

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 133

Ser Asn Asn Ala Val Trp Asn

1 5

<210> 134

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 134

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 135

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 135

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 136

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 136

gatattcaga tgacccagag cccttccagc ctgtccgctt cagtggggga tcgagtgacc 60

attacctgcc gaaccagcca gagcctgagc tcctacacgc actggtatca gcagaagccc 120

ggcaaagccc ctaagctgct gatctacgcc gcttctagtc ggctgtccgg agtgccaagc 180

cggttctccg gatctgggag tggaaccgac tttaccctga caatttcaag cctgcagccc 240

gaggatttcg ctacatacta ctgtcagcag agcagaactt tcgggcaggg cactaaggtg 300

gagatcaaa 309

<210> 137

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 137

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Thr His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Arg Leu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 138

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 138

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Thr His

1 5 10

<210> 139

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 139

Ala Ala Ser Ser Arg Leu Ser

1 5

<210> 140

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 140

Gln Gln Ser Arg Thr

1 5

<210> 141

<211> 384

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 141

caggtccagc tgcagcagag cggccccgga ctggtcaagc cttcacagac actgagcctg 60

acatgcgcca ttagcggaga tagcgtgagc tccaacaatg ccgtgtggaa ctggatcagg 120

cagtctccaa gtcgaggact ggagtggctg ggacgaacat actatagatc caagtggtac 180

aatgactatg ctgaatcagt gaaaagccga attactatca accccgatac ctccaagaat 240

cagttctctc tgcagctgaa cagtgtgacc cctgaggaca cagccgtgta ctactgcgcc 300

agaagcggcc atatcaccgt ctttggcgtc aatgtggatg ctttcgatat gtgggggcag 360

gggaccacag tcaccgtctc ctca 384

<210> 142

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 142

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Tyr Tyr Cys Ala Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120 125

<210> 143

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 143

Ser Asn Asn Ala Val Trp Asn

1 5

<210> 144

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 144

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 145

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 145

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 146

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 146

gatattcaga tgacccagag cccttccagc ctgtccgctt cagtggggga tcgagtgacc 60

attacctgcc gaaccagcca gagcctgagy tcctacacgc actggtatca gcagaagccc 120

ggcaaagccc ctaagctgct gatctacgcc gcttctagtc gggggtccgg agtgccaagc 180

cggttctccg gatctgggag tggaaccgac tttaccctga caatttcaag cctgcagccc 240

gaggatttcg ctacatacta ctgtcagcag agcagaactt tcgggcaggg cactaaggtg 300

gagatcaaa 309

<210> 147

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 147

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Thr His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Arg Gly Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 148

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 148

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Thr His

1 5 10

<210> 149

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 149

Ala Ala Ser Ser Arg Gly Ser

1 5

<210> 150

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 150

Gln Gln Ser Arg Thr

1 5

<210> 151

<211> 384

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 151

caggtccagc tgcagcagag cggccccgga ctggtcaagc cttcacagac actgagcctg 60

acatgcgcca ttagcggaga tagcgtgagc tccaacaatg ccgtgtggaa ctggatcagg 120

cagtctccaa gtcgaggact ggagtggctg ggacgaacat actatagatc caagtggtac 180

aatgactatg ctgaatcagt gaaaagccga attactatca accccgatac ctccaagaat 240

cagttctctc tgcagctgaa cagtgtgacc cctgaggaca cagccgtgta ctactgcgcc 300

agaagcggcc atatcaccgt ctttggcgtc aatgtggatg ctttcgatat gtgggggcag 360

gggaccacag tcaccgtctc ctca 384

<210> 152

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 152

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Tyr Tyr Cys Ala Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120 125

<210> 153

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 153

Ser Asn Asn Ala Val Trp Asn

1 5

<210> 154

<211> 18

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 154

Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala Glu Ser Val

1 5 10 15

Lys Ser

<210> 155

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 155

Ser Gly His Ile Thr Val Phe Gly Val Asn Val Asp Ala Phe Asp Met

1 5 10 15

<210> 156

<211> 309

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полинуклеотид

<400> 156

gatattcaga tgacccagag cccttccagc ctgtccgctt cagtggggga tcgagtgacc 60

attacctgcc gaaccagcca gagcctgagc tcctacctgc actggtatca gcagaagccc 120

ggcaaagccc ctaagctgct gatctacgcc gcttctagtc tgcagtccgg agtgccaagc 180

cggttctccg gatctgggag tggaaccgac tttaccctga caatttcaag cctgcagccc 240

gaggatttcg ctacatacta ctgtcagcag agcagaactt tcgggcaggg cactaaggtg 300

gagatcaaa 309

<210> 157

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 157

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 158

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 158

Arg Thr Ser Gln Ser Leu Ser Ser Tyr Leu His

1 5 10

<210> 159

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 159

Ala Ala Ser Ser Leu Gln Ser

1 5

<210> 160

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<400> 160

Gln Gln Ser Arg Thr

1 5

<210> 161

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (2)..(2)

<223> Asn или Tyr

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (3)..(3)

<223> Asn, Ser или Arg

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (5)..(5)

<223> Val или Thr

<400> 161

Ser Xaa Xaa Ala Xaa Trp Asn

1 5

<210> 162

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (7)..(7)

<223> Lys или Gly

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (10)..(10)

<223> Asn или Tyr

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (14)..(14)

<223> Glu, Val или Asp

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (15)..(15)

<223> Ser или Phe

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (16)..(16)

<223> Val или Leu

<400> 162

Arg Thr Tyr Tyr Arg Ser Xaa Trp Tyr Xaa Asp Tyr Ala Xaa Xaa Xaa

1 5 10 15

Lys

<210> 163

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (1)..(1)

<223> Ser или Gly

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (6)..(6)

<223> Val или Glu

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (9)..(9)

<223> Val или Leu

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (11)..(11)

<223> Val или Ile

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (14)..(14)

<223> Phe или Tyr

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (16)..(16)

<223> Met, Ile или Val

<400> 163

Xaa Gly His Ile Thr Xaa Phe Gly Xaa Asn Xaa Asp Ala Xaa Asp Xaa

1 5 10 15

<210> 164

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (2)..(2)

<223> Thr, Ala или отсутствует

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (3)..(3)

<223> Ser или Ala

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (5)..(5)

<223> Ser или Arg

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (7)..(7)

<223> Ser, Asn или Arg

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (10)..(10)

<223> Leu, Thr или Asp

<400> 164

Arg Xaa Xaa Gln Xaa Leu Xaa Ser Tyr Xaa His

1 5 10

<210> 165

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (2)..(2)

<223> Ala, Thr или Ser

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (3)..(4)

<223> Ser или Thr

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (5)..(5)

<223> Leu или Arg

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (6)..(6)

<223> Gln, Leu или Gly

<400> 165

Ala Xaa Xaa Xaa Xaa Xaa Ser

1 5

<210> 166

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

пептид

<220>

<221> МОДИФИЦИРОВАННЫЙ_ОСТАТОК

<222> (2)..(2)

<223> Gln или Leu

<400> 166

Gln Xaa Ser Arg Thr

1 5

<210> 167

<211> 128

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 167

Gln Val Gln Leu Gln Gln Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Thr Leu Ser Leu Thr Cys Ala Ile Ser Gly Asp Ser Val Ser Ser Asn

20 25 30

Asn Ala Val Trp Asn Trp Ile Arg Gln Ser Pro Ser Arg Gly Leu Glu

35 40 45

Trp Leu Gly Arg Thr Tyr Tyr Arg Ser Lys Trp Tyr Asn Asp Tyr Ala

50 55 60

Glu Ser Val Lys Ser Arg Ile Thr Ile Asn Pro Asp Thr Ser Lys Asn

65 70 75 80

Gln Phe Ser Leu Gln Leu Asn Ser Val Thr Pro Glu Asp Thr Ala Val

85 90 95

Tyr Tyr Cys Ala Arg Ser Gly His Ile Thr Val Phe Gly Val Asn Val

100 105 110

Asp Ala Phe Asp Met Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 168

<211> 103

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетический

полипептид

<400> 168

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Thr Ser Gln Ser Leu Ser Ser Tyr

20 25 30

Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Arg Thr Phe Gly Gln

85 90 95

Gly Thr Lys Val Glu Ile Lys

100

<210> 169

<211> 221

<212> БЕЛОК

<213> Вирус гриппа A

<400> 169

Gly Ile Phe Gly Ala Ile Ala Gly Phe Ile Glu Asn Gly Trp Glu Gly

1 5 10 15

Met Val Asp Gly Trp Tyr Gly Phe Arg His Gln Asn Ser Glu Gly Ile

20 25 30

Gly Gln Ala Ala Asp Leu Lys Ser Thr Gln Ala Ala Ile Asn Gln Ile

35 40 45

Asn Gly Lys Leu Asn Arg Leu Ile Gly Lys Thr Asn Glu Lys Phe His

50 55 60

Gln Ile Glu Lys Glu Phe Ser Glu Val Glu Gly Arg Ile Gln Asp Leu

65 70 75 80

Glu Lys Tyr Val Glu Asp Thr Lys Ile Asp Leu Trp Ser Tyr Asn Ala

85 90 95

Glu Leu Leu Val Ala Leu Glu Asn Gln His Thr Ile Asp Leu Thr Asp

100 105 110

Ser Glu Met Asn Lys Leu Phe Glu Arg Thr Lys Lys Gln Leu Arg Glu

115 120 125

Asn Ala Glu Asp Met Gly Asn Gly Cys Phe Lys Ile Tyr His Lys Cys

130 135 140

Asp Asn Ala Cys Ile Gly Ser Ile Arg Asn Gly Thr Tyr Asp His Asp

145 150 155 160

Val Tyr Arg Asp Glu Ala Leu Asn Asn Arg Phe Gln Ile Lys Gly Val

165 170 175

Glu Leu Lys Ser Gly Tyr Lys Asp Trp Ile Leu Trp Ile Ser Phe Ala

180 185 190

Ile Ser Cys Phe Leu Leu Cys Val Ala Leu Leu Gly Phe Ile Met Trp

195 200 205

Ala Cys Gln Lys Gly Asn Ile Arg Cys Asn Ile Cys Ile

210 215 220

<210> 170

<211> 221

<212> БЕЛОК

<213> Вирус гриппа A

<400> 170

Gly Ile Phe Gly Ala Ile Ala Gly Phe Ile Glu Asn Gly Trp Glu Gly

1 5 10 15

Met Val Asp Gly Trp Tyr Gly Phe Arg His Gln Asn Ser Glu Gly Thr

20 25 30

Gly Gln Ala Ala Asp Leu Lys Ser Thr Gln Ala Ala Ile Asn Gln Ile

35 40 45

Asn Gly Lys Leu Asn Arg Leu Ile Glu Lys Thr Asn Glu Lys Phe His

50 55 60

Gln Ile Glu Lys Glu Phe Ser Glu Val Glu Gly Arg Ile Gln Asp Leu

65 70 75 80

Glu Lys Tyr Val Glu Asp Thr Lys Ile Asp Leu Trp Ser Tyr Asn Ala

85 90 95

Glu Leu Leu Val Ala Leu Glu Asn Gln His Thr Ile Asp Leu Thr Asp

100 105 110

Ser Glu Met Asn Lys Leu Phe Glu Arg Thr Lys Lys Gln Leu Arg Glu

115 120 125

Asn Ala Glu Asp Met Gly Asn Gly Cys Phe Lys Ile Tyr His Lys Cys

130 135 140

Asp Asn Ala Cys Ile Gly Ser Ile Arg Asn Gly Thr Tyr Asp His Asp

145 150 155 160

Val Tyr Arg Asp Glu Ala Leu Asn Asn Arg Phe Gln Ile Lys Gly Val

165 170 175

Glu Leu Lys Ser Gly Tyr Lys Asp Trp Ile Leu Trp Ile Ser Phe Ala

180 185 190

Ile Ser Cys Phe Leu Leu Cys Val Val Leu Leu Gly Phe Ile Met Trp

195 200 205

Ala Cys Gln Lys Gly Asn Ile Arg Cys Asn Ile Cys Ile

210 215 220

<210> 171

<211> 221

<212> БЕЛОК

<213> Вирус гриппа A

<400> 171

Gly Leu Phe Gly Ala Ile Ala Gly Phe Ile Glu Asn Gly Trp Glu Gly

1 5 10 15

Met Ile Asp Gly Trp Tyr Gly Phe Arg His Gln Asn Ser Glu Gly Thr

20 25 30

Gly Gln Ala Ala Asp Leu Lys Ser Thr Gln Ala Ala Ile Asp Gln Ile

35 40 45

Asn Gly Lys Leu Asn Arg Val Ile Glu Lys Thr Asn Glu Lys Phe His

50 55 60

Gln Ile Glu Lys Glu Phe Ser Glu Val Glu Gly Arg Ile Gln Asp Leu

65 70 75 80

Glu Lys Tyr Val Glu Asp Thr Lys Ile Asp Leu Trp Ser Tyr Asn Ala

85 90 95

Glu Leu Leu Val Ala Leu Glu Asn Gln His Thr Ile Asp Leu Thr Asp

100 105 110

Ser Glu Met Asn Lys Leu Phe Glu Lys Thr Arg Arg Gln Leu Arg Glu

115 120 125

Asn Ala Glu Glu Met Gly Asn Gly Cys Phe Lys Ile Tyr His Lys Cys

130 135 140

Asp Asn Ala Cys Ile Glu Ser Ile Arg Asn Gly Thr Tyr Asp His Asp

145 150 155 160

Val Tyr Arg Asp Glu Ala Leu Asn Asn Arg Phe Gln Ile Lys Gly Val

165 170 175

Glu Leu Lys Ser Gly Tyr Lys Asp Trp Ile Leu Trp Ile Ser Phe Ala

180 185 190

Ile Ser Cys Phe Leu Leu Cys Val Val Leu Leu Gly Phe Ile Met Trp

195 200 205

Ala Cys Gln Arg Gly Asn Ile Arg Cys Asn Ile Cys Ile

210 215 220

<210> 172

<211> 221

<212> БЕЛОК

<213> Вирус гриппа A

<400> 172

Gly Leu Phe Gly Ala Ile Ala Gly Phe Ile Glu Asn Gly Trp Glu Gly

1 5 10 15

Met Ile Asp Gly Trp Tyr Gly Phe Arg His Gln Asn Ser Glu Gly Thr

20 25 30

Gly Gln Ala Ala Asp Leu Lys Ser Thr Gln Ala Ala Ile Asp Gln Ile

35 40 45

Asn Gly Lys Leu Asn Arg Val Ile Glu Lys Thr Asn Glu Lys Phe His

50 55 60

Gln Ile Glu Lys Glu Phe Ser Glu Val Glu Gly Arg Ile Gln Asp Leu

65 70 75 80

Glu Lys Tyr Val Glu Asp Thr Lys Ile Asp Leu Trp Ser Tyr Asn Ala

85 90 95

Glu Leu Leu Val Ala Leu Glu Asn Gln His Thr Ile Asp Leu Thr Asp

100 105 110

Ser Glu Met Asn Lys Leu Phe Glu Lys Thr Arg Arg Gln Leu Arg Glu

115 120 125

Asn Ala Glu Asp Met Gly Asn Gly Cys Phe Lys Ile Tyr His Lys Cys

130 135 140

Asp Asn Ala Cys Ile Glu Ser Ile Arg Asn Gly Thr Tyr Asp His Asp

145 150 155 160

Val Tyr Arg Asp Glu Ala Leu Asn Asn Arg Phe Gln Ile Lys Gly Val

165 170 175

Glu Leu Lys Ser Gly Tyr Lys Asp Trp Ile Leu Trp Ile Ser Phe Ala

180 185 190

Ile Ser Cys Phe Leu Leu Cys Val Val Leu Leu Gly Phe Ile Met Trp

195 200 205

Ala Cys Gln Arg Gly Asn Ile Arg Cys Asn Ile Cys Ile

210 215 220

1. Выделенное антитело или его связывающий фрагмент, способные связываться с гемагглютинином вируса гриппа А и нейтрализовать по меньшей мере один подтип группы 1 и по меньшей мере 1 подтип группы 2 вируса гриппа A, которые содержат

HCDR1 с последовательностью SEQ ID NO:113,

HCDR2 с последовательностью SEQ ID NO:114,

HCDR3 с последовательностью SEQ ID NO:115,

LCDR1 с последовательностью SEQ ID NO:118,

LCDR2 с последовательностью SEQ ID NO:119 и

LCDR3 с последовательностью SEQ ID NO:120.

2. Антитело или связывающий фрагмент по п.1, которые способны нейтрализовать один или несколько подтипов группы 1 вируса гриппа А, выбранных из H1, H2, H5, H6, H8, H9, H11, H12, H13, H16 и их вариантов;

и одного или нескольких подтипов группы 2 вируса гриппа A, выбранных из H3, H4, H7, H10, H14 и H15 и их вариантов.

3. Антитело или его связывающий фрагмент по п. 1, которые способны нейтрализовать подтипы H1, H2, H5, H6 и H9 группы 1 и подтипы H3 и H7 группы 2; или которые способны нейтрализовать подтипы H1, H2, H5 и H6 группы 1 и подтипы H3 и H7 группы 2.

4. Антитело или его связывающий фрагмент по п. 1, которые обладают высокой эффективностью нейтрализации, выраженной как 50% ингибирующая концентрация (IC50, мкг/мл), в диапазоне от приблизительно 0,01 мкг/мл до приблизительно 50 мкг/мл антитела для нейтрализации вируса гриппа A в анализе микронейтрализации.

5. Антитело или его связывающий фрагмент по п.1, содержащие VH, который по меньшей мере на 75% идентичен, и/или VL, который по меньшей мере на 75% идентичен VH и/или VL, выбранным из VH с SEQ ID NO: 112 и VL с SEQ ID NO: 117.

6. Антитело или его связывающий фрагмент по п.1, содержащие VH и VL, выбранные из VH с SEQ ID NO: 112 и VL с SEQ ID NO: 117.

7. Антитело или его связывающий фрагмент по п.1, которые выбраны из группы, состоящей из молекулы иммуноглобулина, моноклонального антитела, химерного антитела, антитела с трансплантированным CDR, гуманизированного антитела, Fab, Fab', F(аb')2, Fv, Fv c дисульфидной связью, scFv, однодоменного антитела, диатела, полиспецифического антитела, антитела с двойной специфичностью и биспецифического антитела.

8. Антитело или его связывающий фрагмент по п. 1, в которых VH содержит каркасную область VH6-1 зародышевого типа человека, VL содержит каркасную область VK1-39 зародышевого типа человека, и их комбинацию.

9. Антитело или его связывающий фрагмент по п.1, содержащие Fc-участок.

10. Антитело или его связывающий фрагмент по п.1, где антитело представляет собой IgG1, IgG2 или IgG4 или их фрагмент.

11. Выделенная нуклеиновая кислота, кодирующая антитело или его связывающий фрагмент по любому из пп.1-10.

12. Вектор экспрессии, содержащий выделенную нуклеиновую кислоту по п.11.

13. Клетка-хозяин, экспрессирующая выделенное антитело или его антигенсвязывающий фрагмент по любому из пп.1-10, содержащая нуклеиновую кислоту по п.11 или вектор по п.12.

14. Способ получения антитела или его связывающего фрагмента по любому из пп.1-10, включающий культивирование клетки-хозяина по п.13 в условиях, подходящих для экспрессии антитела или его фрагмента.

15. Способ по п.14, дополнительно включающий выделение антитела или его связывающего фрагмента из культуры клеток-хозяев.

16. Композиция для профилактики или лечения инфекции, вызванной вирусом гриппа А, у индивида, содержащая антитело или его связывающий фрагмент по любому из пп.1-10 и фармацевтически приемлемый носитель.

17. Композиция для профилактики или лечения инфекции, вызванной вирусом гриппа А у индивида, содержащая антитело или его связывающий фрагмент по любому из пп.1-10, 25 мM His и 0,15 M NaCl при pH 6,0.

18. Применение антитела или его связывающего фрагмента по любому из пп.1-10 для профилактики или лечения инфекции, вызванной вирусом гриппа A, у индивида.

19. Применение антитела или его связывающего фрагмента по любому из пп.1-10 в производстве лекарственного препарата для профилактики или лечения инфекции, вызванной вирусом гриппа A, у индивида.

20. Способ профилактики или лечения инфекции, вызванной вирусом гриппа A, у индивида, включающий введение индивиду эффективного количества антитела или его связывающего фрагмента по любому из пп.1-10.

21. Способ профилактики или лечения инфекции, вызванной вирусом гриппа A, у индивида, включающий введение эффективного количества антитела или его связывающего фрагмента по любому из пп.1-10 в комбинации с низкомолекулярной противовирусной композицией.

22. Способ по п.21, где низкомолекулярная противовирусная композиция представляет собой ингибитор нейраминидазы или адамантан.

23. Способ по п.21, где низкомолекулярная противовирусная композиция выбрана из озельтамивира, занамивира, амантадина, римантадина и их комбинаций.

24. Применение антитела или его фрагмента по любому из пп.1-10 для диагностики in vitro инфекции, вызванной вирусом гриппа A, у индивида.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к получению рекомбинантных аналогов лактаптина, и может быть использовано в медицине. Сконструирована плазмидная ДНК pEL1, обеспечивающая синтез рекомбинантного пептида EL1 в клетках млекопитающего, и получен рекомбинантный пептид EL1, имеющий молекулярную массу 14,1 кДа.

Настоящее изобретение относится к области биотехнологии, конкретно к клеточным технологиям, и может быть использовано для экспрессии представляющего интерес полипептида в клетках CHO.

Изобретение относится к области биотехнологии, конкретно к бицистронным векторам для экспрессии toll-подобных рецепторов, и может быть использовано в медицине для лечения рака.

Изобретение относится к области биотехнологии, конкретно к получению противоопухолевых пептидных вакцин, и может быть использовано в медицине для лечения или профилактики злокачественных опухолей, сопровождающихся повышенной экспрессией гена WT1.

Изобретение относится к биотехнологии. Разработана кассета генов, несущая гены вируса гриппа субтипов А(Н1N1) и A(H3N2) и типа В - НА, M1 и NA, кодирующие белки вируса гриппа, предназначенная для последующего получения плазмидного вектора для трансдукции клеток млекопитающих, которые в дальнейшем использовались для создания клеток-продуцентов вирусоподобных частиц (ВПЧ) вируса гриппа.

Изобретение относится к биотехнологии. Разработаны лентивирусные векторы, несущие кассету генов белков вируса гриппа субтипов A(H1N1) и A(H3N2) и типа В, кодирующих последовательности белков вируса гриппа для трансдукции клеток млекопитающих.

Настоящее изобретение относится к биотехнологии и служит для повышения репродуктивной активности у крупного рогатого скота, с применением биологически активного рекомбинантного фолликулостимулирующего гормона (rFSH).

Изобретение относится к области клеточной биологии и биотехнологии, в частности к способу выделения мезенхимальных стволовых клеток шейки матки, не являющихся опухолевыми, которые экспрессируют клеточные маркеры CD29, CD44, CD73, CD105 и CD90 и не экспрессируют клеточные маркеры CD117, CD133, HLA-DR, TRA-81, CD45, CD34 и CD31, применению выделенной ткани шейки матки и способу получения кондиционированной среды.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков, и может быть использовано для получения слитого белка MBP84-106-Fc, состоящего из лидерного пептида тяжелой цепи моноклонального антитела FI0, слитого с фрагментом основного белка миелина 84-106 (МВР84-106) и затем с Fc-фрагментом антитела IgG 1 (домены СН2-СН3) человека, в клетках яичника китайского хомячка (СНО).

Изобретение относится к области биотехнологии, конкретно к способу выделения клеток внелуковичной дермальной оболочки волосяного фолликула (NBDS), и может быть использовано в медицине.

Изобретение относится к биотехнологии. Описан вектор на основе аденоассоциированного вируса (AAV) для доставки субъекту гетерологичной последовательности нуклеиновой кислоты, содержащей капсидный белок VP1, который содержит одну или несколько замен лизина, где одна замена лизина представляет K137R.

Изобретение относится к области биотехнологии, конкретно к получению рекомбинантных аналогов лактаптина, и может быть использовано в медицине. Сконструирована плазмидная ДНК pEL1, обеспечивающая синтез рекомбинантного пептида EL1 в клетках млекопитающего, и получен рекомбинантный пептид EL1, имеющий молекулярную массу 14,1 кДа.

Изобретение относится к области биотехнологии, конкретно к бицистронным векторам для экспрессии toll-подобных рецепторов, и может быть использовано в медицине для лечения рака.
Изобретение относится к области медицины. Предложен способ регенерации нервных волокон кровеносных сосудов генным стимулированием ангиогенеза.

Представленное изобретение относится к области вирусологии, в частности к рекомбинантным вирусам болезни Марека и их применению. Заявленное изобретение касается рекомбинантного вируса болезни Марека серотипа 1 (MDV1), включающего промотор из SEQ ID NO:5 и рекомбинантную последовательность нуклеотидов, кодирующую антигенный полипептид, которая находится под контролем указанного нуклеотида.

Изобретение относится к области биотехнологии. Раскрывается заполняющий компонент аденоассоциированного вируса, состоящий из нуклеиновой кислоты длиной от 3300 до 4200 нуклеотидов.

Изобретение относится к области биотехнологии. Раскрывается заполняющий компонент аденоассоциированного вируса, состоящий из нуклеиновой кислоты длиной от 3300 до 4200 нуклеотидов.

Изобретение относится к области биотехнологии и касается рекомбинантного онколитического вируса осповакцины Л-ИВП_oncoM депонированного в государственной коллекции возбудителей вирусных инфекций и реккетсиозов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под номером V-797.

Изобретение относится к области биотехнологии и касается рекомбинантного онколитического вируса осповакцины Л-ИВП_oncoB депонированного в государственной коллекции возбудителей вирусных инфекций и реккетсиозов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под номером V-796.

Изобретение относится к области биотехнологии и касается рекомбинантного онколитического вируса осповакцины Л-ИВП_oncoQ, депонированного в государственной коллекции возбудителей вирусных инфекций и реккетсиозов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под номером V-798.

Изобретение относится к биотехнологии. Способ осуществляют следующим образом.

Изобретение относится к биохимии. Описано выделенное антитело или его связывающий фрагмент, способные связываться с гемагглютинином вируса гриппа А и нейтрализовать по меньшей мере один подтип группы 1 и по меньшей мере 1 подтип группы 2 вируса гриппа A, которые содержат HCDR1 с последовательностью SEQ ID NO:113, HCDR2 с последовательностью SEQ ID NO:114, HCDR3 с последовательностью SEQ ID NO:115, LCDR1 с последовательностью SEQ ID NO:118, LCDR2 с последовательностью SEQ ID NO:119 и LCDR3 с последовательностью SEQ ID NO:120. Представлены применения данного антитела. Изобретение расширяет арсенал средств, нейтрализующих вирус гриппа А. 12 н. и 12 з.п. ф-лы, 15 ил., 13 табл., 11 пр.

Наверх