Диагностика и лечение синдрома раздраженного кишечника и воспалительного заболевания кишечника

Группа изобретений относится к медицине и предназначена для диагностики и лечения синдрома раздраженного кишечника (СРК). Описаны способы, анализы и системы для диагностики, выбора терапии и лечения СРК на основании уровня антител к винкулину и к CdtB у субъекта. Определяют наличие СРК, если уровень антител к винкулину превышает уровень антител к CdtB. Группа изобретений позволяет определить наличие СРК и провести его дифференциальную диагностику от воспалительных заболеваний кишечника. 6 н. и 15 з.п. ф-лы, 2 ил., 2 табл., 2 пр.

 

ОБЛАСТЬ ТЕХНИКИ

[1] Настоящее изобретение относится к диагностике и лечению синдрома раздраженного кишечника.

УРОВЕНЬ ТЕХНИКИ

[2] Следующее описание включает информацию, которая может быть полезной для понимания настоящего изобретения. Это не является признанием того, что любая информация, представленная в данном документе, представляет собой известный уровень техники или относится к настоящему заявленному изобретению, или что любая публикация прямо или косвенно представляют собой ссылки на известный уровень техники.

[3] Диагноз синдрома раздраженного кишечника (СРК) представлял собой диагноз исключения или диагноз, основанный на наличии у пациента симптомов. Кроме того, при наличии у пациентов симптомов со стороны желудочно-кишечного тракта, сложно отличить синдром раздраженного кишечника (СРК) от других видов желудочно-кишечных заболеваний, таких как воспалительное заболевание кишечника (ВЗК) (например, язвенный колит, болезнь Крона), или для исключения ВЗК может потребоваться проведение инвазивных процедур. В настоящее время в данной области техники не существует средств диагностики СРК или средств, позволяющих отличить СРК от других расстройств с дисфункцией кишечника. Традиционно, как правило, необходимо инвазивное исследование, имеющее определенные риски, требующее больших расходов и болезненное для пациентов.

[4] Соответственно, в данной области техники существует потребность в способах и системах для диагностики СРК и дифференциальной диагностики СРК и ВЗК, в частности с использованием менее инвазивных способов.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

[5] Следующие варианты реализации настоящего изобретения и их аспекты описаны и проиллюстрированы в сочетании с композициями и способами, которые предназначены для примера и иллюстрации, а не для ограничения объема изобретения.

[6] В различных вариантах реализации настоящего изобретения предлагается способ диагностики СРК и, необязательно, выбора лечения СРК или, необязательно, назначения терапии СРК, включающий предоставление биологического образца от субъекта, которому желательно поставить диагноз в отношении СРК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; определение разности между уровнем антител к винкулину и уровнем антител к CDT; и определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT.

[7] В различных вариантах реализации настоящего изобретения предлагается способ дифференциальной диагностики СРК и ВЗК и, необязательно, выбора лечения СРК или, необязательно, назначения терапии СРК, включающий: предоставление биологического образца от субъекта, которому желательно поставить диагноз, чтобы дифференцировать СРК и ВЗК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; и определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT, или определение разности между уровнем антител к винкулину и уровнем антител к CDT.

[8] В различных вариантах реализации настоящего изобретения aнализ биологического образца может включать: контактирование винкулина или его фрагмента с биологическим образцом; контактирование CdtB или его фрагмента с биологическим образцом, причем антитела к винкулину и/или CdtB специфически связываются в биологическом образце с винкулином или его фрагментом и/или с CdtB или его фрагментом; и измерение уровней антител к винкулину и антител к CdtB в биологическом образце.

[9] В различных вариантах реализации настоящего изобретения у субъекта может быть определено наличие СРК, если уровень антител к винкулину на 25% или более превышает уровень антител к CDT.

[10] В различных вариантах реализации настоящего изобретения для измерения уровня антител к винкулину и антител к CDT можно использовать оптическую плотность (ОП), и если разность между ОП антител к винкулину (ОПV) и ОП антител к CDT (ОПCDT) превышает 0, у субъекта может быть определено наличие СРК.

[11] В различных вариантах реализации настоящего изобретения у субъекта может быть определено наличие СРК, если разность ОПV–ОПCDT превышает 0,2.

[12] В различных вариантах реализации настоящего изобретения антитело к винкулину может представлять собой антитело, которое специфически связывается с винкулином. В различных вариантах реализации настоящего изобретения антитело к винкулину может представлять собой антитело, которое специфически связывается с пептидом из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков, имеющим по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками винкулина или SEQ ID №:7.

[13] В различных вариантах реализации настоящего изобретения антитело к винкулину может представлять собой антитело, которое специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющим по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками винкулина или SEQ ID №:7.

[14] В различных вариантах реализации настоящего изобретения антитело к CDT может представлять собой антитело, которое специфически связывается с CdtB, субъединицей CDT.

[15] В различных вариантах реализации настоящего изобретения аминокислотная последовательность CdtB может представлять собой цитолетальный растягивающий токсин B Campylobacter jejuni (SEQ ID №:5).

[16] В различных вариантах реализации настоящего изобретения антитело к CDT может представлять собой антитело, которое специфически связывается с аминокислотной последовательностью, по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичной SEQ ID №:5.

[17] Способ по пункту ‎10, в котором аминокислотная последовательность CdtB представляет собой цитолетальный растягивающий токсин B Campylobacter coli (SEQ ID №:1). В различных вариантах реализации настоящего изобретения антитело к CDT может представлять собой антитело, которое специфически связывается с аминокислотной последовательностью, по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичной SEQ ID №:1.

[18] В различных вариантах реализации настоящего изобретения антитело к CDT может представлять собой антитело, которое специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками CdtB.

[19] В различных вариантах реализации настоящего изобретения способ может дополнительно включать выбор лечения СРК для субъекта, если определено, что у субъекта имеется СРК.

[20] В различных вариантах реализации настоящего изобретения способ может дополнительно включать назначение субъекту терапии СРК, если определено, что у субъекта имеется СРК.

[21] В различных вариантах реализации настоящего изобретения предлагается система для диагностики СРК, содержащая: биологический образец, выделенный от субъекта, которому желательно поставить диагноз в отношении СРК; и один или более анализов для определения уровня антител к винкулину и уровня антител к CDT для диагностики СРК.

[22] В различных вариантах реализации настоящего изобретения предлагается система для дифференциальной диагностики СРК и ВЗК, содержащая: выделенный биологический образец от субъекта, которому желательно провести дифференциальную диагностику СРК и ВЗК; и один или более анализов для определения уровня антител к винкулину и уровня антител к CDT для дифференциации СРК и ВЗК.

[23] В различных вариантах реализации настоящего изобретения система может дополнительно содержать аппарат для определения наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT.

[24] В различных вариантах реализации настоящего изобретения система может дополнительно содержать выходной сигнал или элемент отображения для отображения того, имеет ли пациент СРК, и/или для отображения того, превышает ли уровень антител к винкулину уровень антител к CDT.

[25] Другие отличительные признаки и преимущества настоящего изобретения станут очевидными из последующего подробного описания, которое следует рассматривать совместно с прилагаемыми чертежами, которые иллюстрируют, в качестве примера, различные признаки вариантов реализации настоящего изобретения.

КРАТКОЕ ОПИСАНИЕ ФИГУР

[26] Примеры вариантов реализации настоящего изобретения показаны на упомянутых фигурах. Предполагается, что варианты реализации настоящего изобретения и фигуры, описанные в данном документе, должны рассматриваться скорее как иллюстративные, а не ограничивающие.

[27] На Фиг. 1 показана оптическая плотность антител к винкулину (ОПV) и оптическая плотность антител к CDTB (ОПCDTB) в соответствии с различными вариантами реализации настоящего изобретения.

[28] На Фиг. 2 показана разность между оптической плотностью антител к винкулину (ОПV) и оптической плотностью антител к CDTB (ОПCDTB) в соответствии с различными вариантами реализации настоящего изобретения.

ОПИСАНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

[29] Все ссылки, приведенные в настоящем документе включены в него путем ссылки во всей их полноте, как если бы были изложены полностью. Если не указано иное, технические и научные термины, используемые в настоящем документе, имеют то же значение, которое обычно понимается специалистом в той области техники, к которой относится настоящее изобретение. В публикациях Singleton et al., Dictionary of Microbiology and Molecular Biology 3rd ed., Revised, J. Wiley & Sons (New York, NY 2006); и Sambrook and Russel, Molecular Cloning: A Laboratory Manual 4th ed., Cold Spring Harbor Laboratory Press (Cold Spring Harbor, NY 2012) для специалистов в данной области техники предоставлено общее руководство в отношении многих терминов, используемых в настоящей заявке. Для справки в отношении получения антител, см. публикации D. Lane, Antibodies: A Laboratory Manual 2nd ed. (Cold Spring Harbor Press, Cold Spring Harbor NY, 2013); Kohler and Milstein, (1976) Eur. J. Immunol. 6: 511; Queen et al. патент США № 5585089; и Riechmann et al., Nature 332: 323 (1988); патент США № 4946778; Bird, Science 242:423–42 (1988); Huston et al., Proc. Natl. Acad. Sci. USA 85:5879–5883 (1988); Ward et al., Nature 334:544–54 (1989); Tomlinson I. и Holliger P. (2000) Methods Enzymol, 326, 461–479; Holliger P. (2005) Nat. Biotechnol. Sep;23(9):1126–36).

[30] Специалисту в данной области техники будут понятны многие способы и вещества, аналогичные или эквивалентные описанным в настоящем документе, которые могут быть использованы в практике настоящего изобретения. Действительно, настоящее изобретение никоим образом не ограничивается описанными способами и материалами.

[31] При использовании в настоящем документе термин «антитело» или «антитела» включает поликлональные антитела, моноклональные антитела, варианты антител, такие как одноцепочечный (рекомбинантный) фрагмент Fv, человеческие антитела, гуманизированные антитела, химерные антитела и иммунологически активные фрагменты антител.

[32] При использовании в настоящем документе выражение «специфически связывается» относится к действию связывания антитела с его антигеном и предназначено для исключения неспецифического связывания низкого уровня, которое может происходить между случайными белками. При использовании в настоящем документе выражение «специфически связывается» не предназначено и не подразумевает того, что антитело не будет связываться с любым белком, отличным от белков или полипептидов, описанных в настоящем документе, поскольку антитела могут перекрестно реагировать с любым белком, включающим соответствующий эпитоп.

[33] При использовании в настоящем документе выражение «тяжелый синдром раздраженного кишечника» относится к синдрому раздраженного кишечника (СРК) у субъекта, который направлен или будет направлен в медицинский центр третьей ступени, к СРК-специалисту, или к специалисту в области моторики.

[34] Авторы настоящего изобретения установили, что, по-видимому, CdtB действует не просто посредством прямой токсичности, а скорее посредством перекрестной реакции антител к CdtB с белком хозяина, винкулином. Винкулин представляет собой цитоплазматический актин-связывающий белок с массой 117 кДа, который является ключевым компонентом как фокальных контактов, так и адгезионных соединений, опосредуя связь между интегринами или кадхеринами, соответственно, и цитоскелетом актина.

[35] Основываясь на этих патофизиологических наблюдениях в животной модели, авторы настоящего изобретения полагают, что воздействие CdtB приводит к аутоиммунитету к винкулину на основе молекулярной мимикрии. В настоящем документе описана оценка эффективности обнаружения этих событий в виде теста на СРК у людей.

[36] Исследование, описанное в настоящем документе, показало, что когда уровень антител к винкулину превышает уровень антител к CdtB, это является весьма показательным для СРК и отличает СРК от ВЗК. Не желая ограничиваться какой-либо конкретной теорией, авторы изобретения полагают, что когда уровень антител к винкулину превышает уровень антител к CdtB, это также является показателем тяжести СРК, испытываемой пациентом. Пациенты с СРК в исследовании, описанном в настоящем документе, наблюдались в медицинских центрах третьей ступени, что явно указывает на тяжесть состояния. Если состояние пациентов не является тяжелым, то их обычно не направляют (или они не обращаются) в медицинские центры третьей ступени. Как правило, они лечатся самостоятельно или их лечат врачи учреждений первичной медицинской помощи. Кроме того, эти пациенты с высокой степенью вероятности были устойчивы к некоторым видам терапии СРК, что, как правило, является основанием для направления в медицинский центр третьей ступени.

Диагноз

[37] В различных вариантах реализации настоящего изобретения предлагаются способы, анализы и системы для диагностики СРК и дифференциальной диагностики СРК и ВЗК.

Способы

[38] В различных вариантах реализации настоящего изобретения предлагается способ диагностики СРК, включающий: предоставление биологического образца от субъекта, которому желательно поставить диагноз в отношении СРК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; определение разности между уровнем антител к винкулину и уровнем антител к CDT, и определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT.

[39] В различных вариантах реализации настоящего изобретения предлагается способ дифференциальной диагностики СРК и ВЗК, включающий: предоставление биологического образца от субъекта, которому желательно поставить диагноз, чтобы дифференцировать СРК и ВЗК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; определение разности между уровнем антител к винкулину и уровнем антител к CDT; и определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT.

[40] В различных вариантах реализации настоящего изобретения анализ включает добавление винкулина или его фрагмента, как обсуждается в настоящем документе, и CdtB или его фрагмента, как описано в настоящем документе, к биологическому образцу от субъекта, которому желательно определить наличие СРК, причем антитела к винкулину и/или CdtB (если они присутствуют в биологическом образце) специфически связываются с винкулином или его фрагментом и/или CdtB или его фрагментом в биологическом образце; измерение уровней антител к винкулину и антител к CdtB в биологическом образце; и идентификацию того, что субъект имеет СРК, если уровень антител к винкулину превышает уровень антител к CdtB. В различных вариантах реализации настоящего изобретения анализ может представлять собой два отдельных анализа, один - для определения уровня антител к винкулину, а другой - для определения уровня антител к CdtB. В различных вариантах реализации настоящего изобретения анализ может представлять собой один анализ, в котором определяют как антитела к винкулину, так и к CdtB.

[41] В различных вариантах реализации настоящего изобретения определяют, что субъект имеет СРК, если уровень антител к винкулину на 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900 или 1000% или более превышает уровень антител к CDT.

[42] В различных вариантах реализации настоящего изобретения величина, на которую уровень антител к винкулину больше уровня антител к CDT, обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Процент в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения процент в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[43] В определенных вариантах реализации настоящего изобретения для определения уровня антител к винкулину и антител к CDT используют измерение оптической плотности (ОП). Таким образом, когда разность между ОП антител к винкулину (ОПV) и ОП антител к CDT (ОПCDT) превышает 0, определяют, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,1, 0,2, 0,3, 0,4, 0,5 или 0,6, определяют, что субъект имеет СРК. В определенных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,2, определяют, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения величина разности ОПV–ОПCDT обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Значение разности ОПV–ОПCDT в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения значение разности ОПV – ОПCDT в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[44] В различных вариантах реализации настоящего изобретения 96-луночный планшет в течение ночи или >16 часов при температуре около 4°C во влажной камере покрывали антигеном в количестве 100 мкл/лунка (винкулин или CdtB) и в концентрации около 1,2 мкг/мл в боратно-солевом буфере (БСБ), приблизительный уровень pH составлял 8,2. Дополнительную лунку для каждого образца покрывали только БСБ для определения неспецифического фона от сыворотки, который впоследствии вычитали из результата для лунки, покрытой антигеном. Лунки промывали около 3 раз с использованием приблизительно 250 мкл/лунка 0,05% PBS-T. Лунки блокировали при помощи 200 мкл/лунка около 3% БСА в PBS в течение около 1 часа при комнатной температуре во влажной камере. Сыворотку разводили до разведения 1:16 с использованием около 3% БСА в PBS. Добавляли около 100 мкл/лунка сыворотки; и инкубировали в течение около 1 часа при комнатной температуре во влажной камере. Лунки промывали около 3 раз с использованием приблизительно 250 мкл/лунка 0,05% PBS-T. Добавляли около 100 мкл/лунка вторичного антитела, конъюгированного с ПХ, разведенного в около 3% БСА в PBS до около 1:10000. Его инкубировали в течение 1 часа при комнатной температуре во влажной камере. Лунки промывали около 6 раз с использованием приблизительно 250 мкл/лунка около 0,05% PBS-T, добавляли 100 мкл/лунка раствор субстрата ТМБ (однокомпонентный Ultra TMB-ELISA Substrate, Pierce, 34028). Сигналы с планшета немедленно считывали на спектрофотометре для прочтения планшетов (например, BioTek Synergy HT), с использованием протокола поглощательной способности при около 370 нм; и оставляли проявляться в течение приблизительно 90 мин (анализ плато около 60 мин).

[45] В различных вариантах реализации настоящего изобретения СРК может представлять собой СРК-З (с запором), СРК-Д (с диареей), СРК-См (смешанного типа) (также известный как СРК-Ч, с чередованием запоров и поносов). В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК. В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК-З, тяжелый СРК-Д или тяжелый СРК-См.

[46] В различных вариантах реализации настоящего изобретения антитела к CDT представляют собой антитела CdtB.

[47] В различных вариантах реализации настоящего изобретения анализы содержат винкулин или его фрагмент, как обсуждается в настоящем документе, и CdtB или его фрагмент, как обсуждается в настоящем документе, в качестве антигена для обнаружения антител к винкулину и CdtB.

Системы

[48] В различных вариантах реализации настоящего изобретения предлагается система для диагностики СРК, содержащая: выделенный биологический образец от субъекта, которому желательно поставить диагноз в отношении СРК; и один или более анализов для определения уровня антител к винкулину и уровня антител к CDT для диагностики СРК.

[49] В различных вариантах реализации настоящего изобретения предлагается система для дифференциальной диагностики СРК и ВЗК, содержащая: выделенный биологический образец от субъекта, которому желательно провести дифференциальную диагностику СРК и ВЗК; один или более анализов для определения уровня антител к винкулину и уровня антител к CDT для дифференциации СРК и ВЗК.

[50] В различных вариантах реализации настоящего изобретения эти системы дополнительно содержат аппарат для определения наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT.

[51] В различных вариантах реализации настоящего изобретения система содержит выходной сигнал или элемент отображения для отображения того, имеет ли пациент СРК, и/или для отображения того превышает ли уровень антител к винкулину уровень антител к CDT.

[52] В различных вариантах реализации настоящего изобретения система определяет, что субъект имеет СРК, если уровень антител к винкулину на 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900 или 1000% или более превышает уровень антител к CDT. В различных вариантах реализации настоящего изобретения величина, на которую уровень антител к винкулину больше уровня антител к CDT, обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Процент в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения процент в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[53] В определенных вариантах реализации настоящего изобретения для определения уровня антител к винкулину и антител к CDT используют измерение оптической плотности (ОП). Таким образом, когда разность между ОП антител к винкулину (ОПV) и ОП антител к CDT (ОПCDT) превышает 0, система определяет, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,1, 0,2, 0,3, 0,4, 0,5 или 0,6, система определяет, что субъект имеет СРК. В определенных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,2, определяют, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения величина разности ОПV–ОПCDT обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Значение разности ОПV–ОПCDT в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения значение разности ОПV–ОПCDT в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[54] В различных вариантах реализации настоящего изобретения СРК может представлять собой СРК-З, СРК-Д, СРК-См (также известный как СРК-Ч). В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК. В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК-З, тяжелый СРК-Д или тяжелый СРК-См.

[55] В различных вариантах реализации настоящего изобретения антитела к CDT представляют собой антитела CdtB.

[56] В различных вариантах реализации настоящего изобретения анализы содержат винкулин или его фрагмент, как обсуждается в настоящем документе, и CdtB или его фрагмент, как обсуждается в настоящем документе, в качестве антигена для обнаружения антител к винкулину и CdtB.

[57] Системы и способы компьютерной реализации/автоматизированных машин

[58] В различных вариантах реализации настоящего изобретения предлагается постоянный машиночитаемый носитель, содержащий команды для выполнения способов настоящего изобретения, как описано в настоящем документе.

[59] В определенных вариантах реализации настоящего изобретения способы настоящего изобретения осуществляют компьютерную программу, например, для сравнения уровней антител к винкулину и уровней антител к CDT. Например, постоянная компьютерная программа может быть использована для выполнения алгоритмов, описанных в настоящем документе.

[60] Многочисленные типы компьютерных систем могут быть использованы для осуществления аналитических способов по настоящему изобретению согласно знаниям, которыми обладает квалифицированный специалист в области биоинформатики и/или вычислительной техники.

[61] Во время работы такой компьютерной системы в память могут быть загружены несколько программных компонентов. Программные компоненты могут представлять собой как программные компоненты, являющиеся стандартными в данной области техники, так и компоненты, которые являются особенными для настоящего изобретения. Способы настоящего изобретения также могут быть запрограммированы или смоделированы в математических программных пакетах, которые позволяют символьную запись уравнений и спецификацию высокого уровня обработки, включая специфические алгоритмы, которые будут использоваться, тем самым освобождая пользователя от необходимости методологически программировать отдельные уравнения и алгоритмы. Такие пакеты включают, например, Matlab от компании Mathworks (Natick, Mass.), Mathematica от компании Wolfram Research (Champaign, Ill.) или S-Plus от компании MathSoft (Seattle, Wash.). В определенных вариантах реализации настоящего изобретения в компьютере имеется база данных для хранения значений уровней антител к винкулину и уровней антител к CDT. Такие сохраненные профили могут быть доступны и использоваться для сравнения уровней антител к винкулину и уровней антител к CDT в образце с известными контрольными уровнями, если это применимо.

[62] В дополнение к иллюстративным программным структурам и компьютерным системам, описанным в настоящем документе, другие, альтернативные программные структуры и компьютерных системы будут очевидны для специалиста в данной области техники. Такие альтернативные системы, которые не отступают от описанной выше компьютерной системы и программных структур по сути или объему, предназначены для введения в рамки прилагаемой формулы изобретения.

[63] После того как лаборант, или врач-лаборант, или группа лаборантов или врачей-лаборантов определит уровень антител к винкулину и уровень антител к CDT, тот же или другой лаборант или врач-лаборант (или группа) может проанадизировать один или более анализов, чтобы определить, превышает ли уровень антител к винкулину уровень антител к CDT или превышает ли разность ОПV–ОПCDT 0,0, 0,1, 0,2, 0,3, 0,4, 0,5 или 0,6, а затем определить, что субъект имеет СРК или тяжелый СРК.

[64] В различных вариантах реализации настоящего изобретения, предложенных в настоящем документе, постоянный машиночитаемый носитель данных содержит: модуль запоминания данных, содержащий данные из образца, включая значения уровня антител к винкулину и уровня антител к CDT; модуль детекции для детекции уровня антител к винкулину и уровня антител к CDT; модуль сравнения, который сравнивает данные, хранящиеся в модуле запоминания данных с эталонными данными и/или контрольными данными, или модуль сравнения для сравнения уровня антител к винкулину с уровнем антител к CDT и для обеспечения содержания сравнения, и выходной модуль для отображения содержания сравнения для пользователя, причем указание, что субъект имеет СРК отображается, когда уровень антител к винкулину превышает уровень антител к CDT, или когда разность ОПV–ОПCDT превышает 0,0, 0,1, 0,2, 0,3, 0,4, 0,5 или 0,6.

[65] В различных вариантах реализации настоящего изобретения контрольные данные содержат данные от пациентов, не имеющих СРК. В различных вариантах реализации настоящего изобретения контрольные данные содержат данные от пациентов, не имеющих ВЗК. В различных вариантах реализации настоящего изобретения контрольные данные содержат данные от пациентов, имеющих СРК. В различных вариантах реализации настоящего изобретения контрольные данные содержат данные от пациентов, имеющих ВЗК.

[66] Варианты реализации настоящего изобретения могут быть описаны с помощью функциональных модулей, которые определяются с помощью записанных в постоянном машиночитаемом носителе команд, выполняемых компьютером, и которые при выполнении заставляют компьютер совершать этапы способа. Для ясности модули разделены по функции. Однако следует понимать, что модули/системы не должны соответствовать отдельным блокам программ, и описанные функции могут быть выполнены посредством исполнения различных частей программы, хранящихся на различных носителях и исполняемых в разное время. Кроме того, следует понимать, что модули могут выполнять другие функции, таким образом, модули не ограничены какой-либо конкретной функцией или набором функций.

[67] Постоянный машиночитаемый носитель данных может представлять собой любой имеющийся материальный носитель данных, доступный через компьютер. Машиночитаемый носитель данных включает энергозависимый и энергонезависимый, съемный и несъемный материальный носитель данных, реализованный любым способом или технологией для хранения информации, такой как машиночитаемые команды, структуры данных, программные модули или другие данные. Машиночитаемый носитель данных включает, но не ограничивается перечисленным, RAM (оперативное запоминающее устройство), ROM (постоянное запоминающее устройство), EPROM (стираемое программируемое постоянное запоминающее устройство), EEPROM (электрически стираемое программируемое постоянное запоминающее устройство), флэш-память или другую технологию запоминающих устройств, CD-ROM (компакт-диск без возможности перезаписи), DVD (цифровые многофункциональные диски) или другие оптические запоминающие устройства, магнитные кассеты, магнитную ленту, магнитное дисковое запоминающее устройство или другие магнитные устройства хранения информации, другие типы энергозависимого и энергонезависимого запоминающего устройства и любой другой материальный носитель данных, который может быть использован для хранения требуемой информации, и который может быть доступен для компьютера и любой подходящей комбинации описанного выше, включительно.

[68] Машиночитаемые данные, реализованные на одном или более постоянных машиночитаемых носителей, могут определять команды, например, как часть одной или более программ, которые, в результате исполнения компьютером дают компьютеру команду для выполнения одной или более функций, описанных в настоящем документе, и/или различных вариантов осуществления, их вариаций и комбинаций. Такие команды могут быть написаны на любом из множества языков программирования, например, Java, J#, Visual Basic, C, C#, C++, Fortran, Pascal, Eiffel, Basic, языке ассемблера COBOL и т.п., или на любой из множества их комбинаций. Машиночитаемые носители, в которых реализованы такие команды, могут находиться на одном или более из компонентов системы или машиночитаемого носителя данных, описанных в настоящем документе, и могут быть распределены на одном или более из таких компонентов.

[69] Машиночитаемые носители могут быть переносными, так что хранящиеся в них команды могут быть загружены на любой компьютерный ресурс для реализации аспектов настоящего изобретения, изложенных выше. Кроме того, следует понимать, что команды, хранящиеся на машиночитаемом носителе, описанном выше, не ограничиваются командами, реализованными как часть прикладной программы, работающей на главном компьютере. Скорее, команды могут быть реализованы в виде любого типа набора команд (например, программного обеспечения или микрокода), которые могут быть использованы для программирования компьютера для реализации аспектов настоящего изобретения. Команды, выполняемые компьютером могут быть записаны на подходящем языке программирования или с помощью комбинации нескольких языков. Основные способы вычислительной биологии известны обычным специалистам в данной области техники и описаны, например, в работах Setubal and Meidanis et al., Introduction to Computational Biology Methods (PWS Publishing Company, Boston, 1997); Salzberg, Searles, Kasif, (Ed.), Computational Methods in Molecular Biology, (Elsevier, Amsterdam, 1998); Rashidi and Buehler, Bioinformatics Basics: Application in Biological Science and Medicine (CRC Press, London, 2000) and Ouelette and Bzevanis Bioinformatics: A Practical Guide for Analysis of Gene and Proteins (Wiley & Sons, Inc., 2nd ed., 2001).

[70] Функциональные модули конкретных вариантов реализации настоящего изобретения включают, например, измерительный модуль, модуль памяти, модуль сравнения и выходной модуль. Функциональные модули могут быть выполнены на одном или множестве компьютеров, или с использованием одной или множества компьютерных сетей. Измерительный модуль имеет команды, выполняемые компьютером для обеспечения, например, выражения информации в машиночитаемой форме.

[71] Измерительный модуль может содержать любую систему для определения уровней антител к винкулину или антител к CDT.

[72] Информация, определенная в системе определения, может быть прочитана модулем памяти. При использовании в настоящем документе термин «модуль памяти» предназначен для включения любого подходящего вычислительного или обрабатывающего устройства или другого устройства, выполненного или приспособленного для хранения данных или информации. Примеры электронного устройства, подходящего для использования с настоящим изобретением, включают автономные вычислительные устройства, данные телекоммуникационных сетей, включая локальные сети (LAN), глобальные сети (WAN), Интернет, интранет и экстранет, а также системы локальной и распределенной компьютерной обработки данных. Модули памяти также включают, но не ограничиваются перечисленным: магнитные устройства хранения информации, такие как дискеты, носители данных жесткого диска, флеш-память, магнитная лента, оптические запоминающие устройства, такие как CD-ROM, DVD, электронные запоминающие устройства, такие как RAM, ROM, EPROM, EEPROM и т.п., общие жесткие диски и гибриды этих категорий, таких как магнитные/оптические запоминающие устройства. Модуль памяти приспособлен или выполнен с возможностью регистрации в нем информации об уровне антител к винкулину и уровне антител к CDT. Такая информация может быть предоставлена в цифровой форме, которая может быть передана и прочитана в электронном виде, например, через Интернет, на флэш-памяти, через USB (универсальная последовательная шина) или с помощью любого другого подходящего способа общения.

[73] При использовании в настоящем документе, «хранящийся» относится к процессу кодирования информации в модуле памяти. Специалисты в данной области техники могут легко выбрать любой из известных в настоящее время способов регистрации информации на известных носителях для создания изделий, содержащих информацию об уровне антител к винкулину и уровне антител к CDT.

[74] В одном варианте реализации настоящего изобретения эталонные данные, хранящиеся в модуле памяти предназначены для прочтения модулем сравнения представляют собой, например, данные от пациентов, не имеющих СРК, данные от пациентов, не имеющих ВЗК, данные от пациентов, имеющих СРК и/или данные от пациентов, имеющих ВЗК.

[75] «Модуль сравнения» может использовать различные доступные программы и форматы программного обеспечения для оперативного сравнения, чтобы сравнивать данные связывания, определенные в измерительном модуле, с эталонными образцами и/или хранящимися эталонными данными. В одном варианте реализации настоящего изобретения модуль сравнения выполнен с возможностью использования способов распознавания образов для сравнения информации одной или более записей с одним или более образами эталонных данных. Модуль сравнения может быть выполнен с возможностью использования существующего коммерчески доступного или имеющегося в свободном доступе программного обеспечение для сравнения образов, и может быть оптимизирован для проведения сравнений конкретных данных. Модуль сравнения предоставляет связанную машиночитаемую информацию, например, об уровнях антител к винкулину и/или уровнях антител к CDT.

[76] Модуль сравнения или любой другой модуль по изобретению может включать операционную систему (например, UNIX), на которой работает система управления реляционными базами данных, приложение World Wide Web и сервер World Wide Web. Приложение World Wide Web представляет собой выполняемую программу, необходимую для создания операторов языков базы данных (например, операторов языка структурированных запросов (SQL)). Обычно, выполняемые программы включают встроенные операторы SQL. Кроме того, приложение World Wide Web может включать конфигурационный файл, содержащий указатели и адреса различных программных логических объектов, которые содержат базы данных сервера, а также различные внешние и внутренние базы данных, которые должны быть доступны для обслуживания запросов пользователей. Конфигурационный файл также направляет соответствующему аппаратному обеспечению запросы на ресурсы сервера, поскольку может быть необходимость распределения сервера по двум или более отдельным компьютерам. В одном варианте реализации настоящего изобретения сервер World Wide Web поддерживает протокол TCP/IP. Локальные сети, такие как эти, иногда называют «Интранет». Преимущества таких сетей Интранет состоит в том, что они обеспечивают легкую связь с базами данных общедоступного ПО, находящегося на World Wide Web (например, на сайте GenBank или Swiss Pro World Wide Web). Таким образом, в конкретном варианте реализации настоящего изобретения пользователи могут напрямую получить доступ к данным (например, с помощью гипертекстовой ссылки), находящимся в базе данных Интернета с использованием HTML-интерфейса, предоставленного веб-браузерами и веб-серверами.

[77] Модуль сравнения предоставляет машиночитаемый результат сравнения, который может быть обработан в машиночитаемой форме по заданным критериям или критериям, определенным пользователем, для предоставления содержания, частично на основе результата сравнения, которое может быть сохранено и выведено в соответствии с запросом пользователя, использующего выходной модуль.

[78] Содержание на основе результата сравнения может представлять собой уровни антител к винкулину в сравнении с уровнями антител к CDT.

[79] В различных вариантах реализации настоящего изобретения содержание на основе результата сравнения отображается на экране компьютера. В различных вариантах реализации настоящего изобретения содержание на основе результата сравнения отображается с помощью средств печати. Модуль отображения может быть любым подходящим устройством, выполненным с возможностью приема от компьютера и отображения машиночитаемой информации пользователю. Не ограничивающие примеры включают, например, компьютеры общего назначения, такие как компьютеры на основе процессора типа Intel PENTIUM, Motorola PowerPC, Sun UltraSPARC, процессоров Hewlett-Packard PA-RISC, любого из множества процессоров, доступных от компании Advanced Micro Devices (AMD), находящейся в г. Саннивейл, Калифорния, или процессора любого другого типа, устройства визуального отображения, такие как дисплеи с плоским экраном, электронно-лучевые трубки и т.п., а также компьютерные принтеры различных типов.

[80] В одном варианте реализации настоящего изобретения браузер World Wide Web используется для обеспечения пользовательского интерфейса для отображения содержания на основе результата сравнения. Следует понимать, что другие модули по изобретению могут быть выполнены с возможностью иметь интерфейс веб-браузера. Через веб-браузер пользователь может создавать запросы для извлечения данных из модуля сравнения. Таким образом, пользователь, как правило, выбирает и нажимает на элементы пользовательского интерфейса, такие как кнопки, выпадающие меню, полосы прокрутки и т.п., обычно используемые в графических пользовательских интерфейсах.

Биологические образцы

[81] Примеры биологических образцов включают, но не ограничиваются перечисленным, жидкости организма, цельную кровь, плазму, кал, жидкости или аспират кишечника и жидкости или аспират желудка, сыворотку, спинно-мозговую жидкость (СМЖ), мочу, пот, слюну, слезы, секрецию легких, аспират из молочной железы, жидкость предстательной железы, семенную жидкость, цервикальный соскоб, амниотическую жидкость, внутриглазную жидкость, слизистую, и влагу дыхания. В конкретных вариантах реализации способа или системы биологический образец может представлять собой цельную кровь, плазму крови, сыворотку крови, кал, жидкость или аспират кишечника и жидкость или аспират желудка. В определенных вариантах реализации настоящего изобретения биологический образец представляет собой цельную кровь. В определенных вариантах реализации настоящего изобретения биологический образец представляет собой сыворотку. В определенных вариантах реализации настоящего изобретения биологический образец представляет собой плазму.

Антитела к винкулину

[82] В различных вариантах реализации настоящего изобретения антитело к винкулину, обнаруживаемое в этих способах, анализах или системах представляет собой антитело, которое специфически связывается с винкулином.

[83] В различных вариантах реализации настоящего изобретения антитело к винкулину представляет собой антитело, которое специфически связывается с пептидом из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков, имеющим по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками винкулина.

[84] В другом варианте реализации настоящего изобретения антитело к винкулину специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющим по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками винкулина.

[85] В другом варианте реализации настоящего изобретения антитело к винкулину специфически связывается с полипептидом, содержащим или состоящим из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежных остатков винкулина.

[86] В различных вариантах реализации настоящего изобретения антитело к винкулину представляет собой антитело, которое специфически связывается с SEQ ID №:7.

[87] В различных вариантах реализации настоящего изобретения антитело к винкулину представляет собой антитело, которое специфически связывается с пептидом из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков, имеющим по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками SEQ ID №:7.

[88] В другом варианте реализации настоящего изобретения антитело к винкулину специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющим по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками SEQ ID №:7.

[89] В другом варианте реализации настоящего изобретения антитело к винкулину специфически связывается с полипептидом, содержащим или состоящим из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежных остатков SEQ ID №:7.

[90] Смежные остатки винкулина или SEQ ID №:7 включают те, которые начинаются на любой аминокислоте и заканчиваются на любой аминокислоте винкулина или SEQ ID №:7.

[91] Последовательность белка винкулина (SEQ ID №:7):

MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ

Антитела к CDT

[92] В различных вариантах реализации настоящего изобретения антитело к CDT представляет собой антитело, которое специфически связывается с CDT. Аминокислотные последовательности CDT известны в данной области техники.

[93] В одном варианте реализации настоящего изобретения антитело к CDT специфически связывается с эпитопом на домене связывания с рецептором CDT.

[94] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с CdtA, субъединицей CDT. В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с CdtB, субъединицей CDT. В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с CdtC, субъединицей CDT.

[95] Примером аминокислотной последовательности CdtB является цитолетальный растягивающий токсин B Campylobacter jejuni, имеющий аминокислотную последовательность (SEQ ID №:5).

[96] SEQ ID №:5 (CdtB Campylobacter jejuni):

MKKIICLFLSFNLAFANLENFNVGTWNLQGSSAATESKWSVSVRQLVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSRVDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGAIITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLDYAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKF

[97] Другим примером аминокислотной последовательности CdtB является цитолетальный растягивающий токсин B Campylobacter coli, имеющий аминокислотную последовательность (SEQ ID №:1) и последовательность нуклеиновых кислот (SEQ ID №:2).

[98] SEQ ID №:1 (аминокислотная последовательность CdtB Campylobacter coli):

MKKIVFLILSFNVLFAALENYNTGTWNLQGSSAATESKWNVSIRQLITGANPMDVLAVQEAGVLPSTAMMTPRQVQPVGVGIPIHEYIWNLGSVSRPSSVYIYYSRVDVGANRVNLAIVSRVQADEVFVLPPPTVASRPIIGIRIGNDAFFNIHALASGGNDAGAIVAAVDMFFRNRPDINWMILGDFNRESGALVTLLDPDLRARTRVVVPPSSTQTSGRTIDYAITGNSNTAALYNPPPIVAILALEGLRTFLASDHFPVNFRRP

[99] SEQ ID №:2 (последовательность нуклеиновых кислот CdtB Campylobacter coli):

atgaaaaaaa tagtattttt gattttaagt tttaatgtat tatttgccgc tttagaaaat tacaacaccg gaacttggaa tttgcaaggc tcatcagctg caactgaaag caaatggaat gttagtataa gacaactcat aaccggtgca aatcctatgg atgttttagc tgttcaagaa gcgggggttt tacctagtac agctatgatg actcctagac aggtacaacc cgtgggcgtg ggtattccta tacatgaata catatggaat ttaggctctg tatcaagacc tagctctgtt tatatatatt attctagagt ggatgtagga gcaaatcgtg tgaatttagc tatcgttagc agagtgcaag cggatgaagt ttttgtttta ccccctccaa cagttgcttc aagacctatt ataggcatac gcataggcaa tgatgctttt ttcaatatac acgctctagc aagtggggga aatgacgcag gagccattgt cgctgctgtg gatatgtttt ttagaaatag acctgatatt aattggatga ttttaggcga ttttaataga gaatcaggcg ccttagtaac cttgctagat cctgacttaa gagcacgcac tcgcgtagtt gttccgcctt cttctacgca aacaagtgga agaacgattg attatgctat cactggaaat tccaacactg cagctttata caacccacca ccgatagttg cgattttagc tttagaagga ttaagaacct ttttggcttc agatcatttt cctgtaaatt ttagaagacc ttag

[100] Соответственно, в одном варианте реализации настоящего изобретения, антитело к CDT специфически связывается с SEQ ID №:5 (CdtB C. jejuni). В различных вариантах реализации настоящего изобретения антитело к CDT специфически связывается с аминокислотной последовательностью, по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичной SEQ ID №:5.

[101] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с SEQ ID №:1 (CdtB C. coli). В различных вариантах реализации настоящего изобретения антитело к CDT специфически связывается с аминокислотной последовательностью, по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичной SEQ ID №:1.

[102] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с пептидом CdtB из 17 остатков (например, 17 остатков SEQ. ID №:1 или 5). В одном варианте реализации настоящего изобретения пептид из 17 остатков имеет следующую последовательность: LDYAITGNSNRQQTYTP (SEQ ID №:3).

[103] В других вариантах реализации настоящего изобретения антитело к CDT специфически связывается с пептидом из 17 остатков, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 17 смежными остатками CdtB (например, 17 смежными остатками SEQ. ID №:1 или 5). В одном варианте реализации настоящего изобретения 17 остатков CdtB имеют следующую последовательность: LDYAITGNSNRQQTYTP (SEQ ID №:3).

[104] В других вариантах реализации настоящего изобретения антитело к CDT специфически связывается с полипептидом, содержащим 17 остатков, которые имеют по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 17 смежными остатками CdtB (например, 17 остатками SEQ. ID №:1 или 5). В одном варианте реализации настоящего изобретения 17 смежных остатков CdtB имеют следующую последовательность: LDYAITGNSNRQQTYTP (SEQ ID №:3).

[105] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с пептидом из 18 остатков, имеющим следующую последовательность: CLDYAITGNSNRQQTYTP (SEQ ID №:4). Цистеин на N-конце был добавлен в SEQ ID №: 3 для целей сопряжения.

[106] В других вариантах реализации настоящего изобретения антитело к CDT специфически связывается с полипептидом, содержащим 18 остатков, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с CLDYAITGNSNRQQTYTP (SEQ ID №:4).

[107] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с пептидом из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками CdtB (например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, или 22 смежными остатками SEQ ID №:1 или 5). В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками CdtB (например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, или 22 смежными остатками SEQ ID №:1 или 5). Смежные остатки SEQ ID №:1 включают те, которые начинаются на любой аминокислоте и заканчиваются на любой аминокислоте SEQ ID №:1. Смежные остатки SEQ ID №:5 включают те, которые начинаются на любой аминокислоте и заканчиваются на любой аминокислоте SEQ ID №:5.

[108] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с пептидом из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 или 17 остатков имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 или 17 смежными остатками LDYAITGNSNRQQTYTP (SEQ ID №:3) (например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 или 17 смежными остатками SEQ ID №:3). В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, или 17 остатков, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 или 17 смежными остатками SEQ ID №:3 (например, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 или 17 смежными остатками SEQ ID №:3). Смежные остатки SEQ ID №:3 включают те, которые начинаются на любой аминокислоте и заканчиваются на любой аминокислоте SEQ ID №:3.

[109] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с пептидом из 17 остатков, кодируемым последовательностью гена CdtB. В конкретных вариантах реализации настоящего изобретения очищенное антитело специфически связывается с пептидом из 17 остатков, кодируемым SEQ ID №:2. В различных вариантах реализации настоящего изобретения антитело к CDT специфически связывается с пептидом из 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков, кодируемым SEQ ID №:2. В различных вариантах реализации настоящего изобретения антитело к CDT специфически связывается с пептидом из 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 14, 15, 16, 17, 18, 19, 20, 21, или 22 смежными остатками, кодированными SEQ ID №:2. В различных вариантах реализации настоящего изобретения антитело к CDT специфически связывается с полипептидом, содержащим 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками, кодированными SEQ ID №:2.

[110] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с пептидом, кодируемым последовательностью нуклеиновых кислот, имеющей следующую последовательность: CTTGATTATGCAATTACAGGAAATTCAAATAGACAACAAACCTATACTCCA (SEQ ID №:6), которая кодирует пептид из 17 аминокислот SEQ ID №:3. В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с полипептидом, содержащим пептид, кодируемый SEQ ID №:6.

[111] В другом варианте реализации настоящего изобретения антитело к CDT специфически связывается с CdtB, выделенным из E. coli, сверхэкспрессирующим почти полноразмерную ОРС CdtB. (См. публикацию Infection and Immunity, December 2000, p. 6535–6541, Vol. 68, № 12, включенную в настоящий документ путем ссылки в полном объеме, как если бы она была изложена полностью).

Анализы

[112] В различных вариантах реализации способов и систем, описанных в настоящем документе, анализ представляет собой твердофазный иммуноферментный анализ (ELISA), включая, но не ограничиваясь перечисленным, непрямой анализ ELISA, анализ ELISA типа «сэндвич», конкурентный анализ ELISA, множественный и портативный анализ ELISA.

[113] В различных вариантах реализации способов и систем, описанных в настоящем документе, анализ представляет собой анализ для определения уровня антител к винкулину. Анализ может включать: первый реагент (например, антиген), для реакции с биологическим образцом, если биологический образец содержит антитело к винкулину (если антитела к винкулину отсутствуют, то первый реагент не будет реагировать с биологическим образцом, но первый реагент по-прежнему присутствует в анализе), второй реагент (например, вторичное антитело), для реакции с антителом к винкулину, или второй реагент для реакции с первым реагентом, и субстрат (например, для реакции со вторым реагентом и создания сигнала). В различных вариантах реализации настоящего изобретения первый реагент представляет собой винкулин, SEQ ID №:7 или его фрагмент, как обсуждается в настоящем документе. В различных вариантах реализации настоящего изобретения второй реагент содержит метку для создания сигнала индикации наличия антитела к винкулину. В различных вариантах реализации настоящего изобретения метка представляет собой радиометку, хромофор, флуорофор, квантовую точку, фермент, пероксидазу хрена (ПХ), щелочную фосфатазу (ЩФ), биотин или их комбинацию. В различных вариантах реализации настоящего изобретения метка представляет собой фермент, который будет вступать в реакцию с субстратом. В различных вариантах реализации настоящего изобретения первый реагент находится на твердой фазе (например, на планшете, многолуночном планшете). В различных вариантах реализации настоящего изобретения субстрат представляет собой хромогенный субстрат (например, 3,3’,5,5’-тетраметилбензидин (ТМБ), 3,3’-диаминобензидин (ДАБ), 2,2’-азино-бис(3-этилбензотиазолин-6-сульфокислоту) (АБТС). В различных вариантах реализации настоящего изобретения субстрат представляет собой хемилюминесцентный субстрат (например, ECL).

[114] В различных вариантах реализации настоящего изобретения анализ содержит первый реагент для реакции с антителом к винкулину. В различных вариантах реализации настоящего изобретения первый реагент содержит метку для создания сигнала индикации наличия антитела к винкулину. В различных вариантах реализации настоящего изобретения метка представляет собой радиометку, хромофор, флуорофор, квантовую точку, фермент, пероксидазу хрена (ПХ), щелочную фосфатазу (ЩФ), биотин или их комбинацию. В различных вариантах реализации настоящего изобретения первый реагент находится на твердой фазе (например, на планшете, многолуночном планшете). В различных вариантах реализации настоящего изобретения анализ дополнительно содержит субстрат для реакции с меткой в тех случаях, когда метке для создания сигнала необходим субстрат; например, ПХ может реагировать с субстратом ТМБ.

[115] В различных вариантах реализации настоящего изобретения анализ представляет собой анализ для определения уровня антител к CDT. Анализ может включать: первый реагент для реакции с биологическим образцом, если биологический образец содержит антитело к CDT (если антитела к CDT отсутствуют, то первый реагент не будет реагировать с биологическим образцом, но первый реагент по-прежнему присутствует в анализе), второй реагент (например, вторичное антитело), для реакции с антителом к CDT или второй реагент для реакции с первым реагентом, и субстрат. В различных вариантах реализации настоящего изобретения первый реагент представляет собой CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагмент, как обсуждается в настоящем документе. В различных вариантах реализации настоящего изобретения второй реагент содержит метку для создания сигнала индикации наличия антитела к CDT. В различных вариантах реализации настоящего изобретения метка представляет собой радиометку, хромофор, флуорофор, квантовую точку, фермент, пероксидазу хрена (ПХ), щелочную фосфатазу (ЩФ), биотин или их комбинацию. В различных вариантах реализации настоящего изобретения метка представляет собой фермент, который будет вступать в реакцию с субстратом. В различных вариантах реализации настоящего изобретения первый реагент находится на твердой фазе (например, на планшете, многолуночном планшете). В различных вариантах реализации настоящего изобретения субстрат представляет собой хромогенный субстрат (например, 3,3’,5,5’-тетраметилбензидин (ТМБ), 3,3’-диаминобензидин (ДАБ), 2,2’-азино-бис(3-этилбензотиазолин-6-сульфокислоту) (АБТС). В различных вариантах реализации настоящего изобретения субстрат представляет собой хемилюминесцентный субстрат (например, ECL).

[116] В различных вариантах реализации настоящего изобретения анализ включает первый реагент для реакции с антителом к CDT. В различных вариантах реализации настоящего изобретения первый реагент содержит метку для создания сигнала индикации наличия антитела к CDT. В различных вариантах реализации настоящего изобретения метка представляет собой радиометку, хромофор, флуорофор, квантовую точку, фермент, пероксидазу хрена (ПХ), щелочную фосфатазу (ЩФ), биотин или их комбинацию. В различных вариантах реализации настоящего изобретения реагент находится на твердой фазе (например, на планшете, многолуночном планшете). В различных вариантах реализации настоящего изобретения анализ дополнительно содержит субстрат для реакции с меткой в тех случаях, когда метке для создания сигнала необходим субстрат; например, ПХ может реагировать с субстратом ТМБ.

[117] В различных вариантах реализации настоящего изобретения анализ представляет собой анализ для определения уровня антител к винкулину и уровня антител к CDT. Анализ может включать: первый реагент и второй реагент для реакции с биологическим образцом, если биологический образец содержит антитело к винкулину и/или антитело к CDT (если антитела к винкулину отсутствуют, то первый реагент не будет реагировать с биологическим образцом, но первый реагент по-прежнему присутствует в анализе; или если антитела к CDT отсутствуют, то второй реагент не будет реагировать с биологическим образцом, но второй реагент по-прежнему присутствует в анализе), третий реагент и четвертый (например, вторичные антитела) для реакции с антителом к винкулину, антителом к CDT, или третий реагент для реакции с первым реагентом и четвертый реагент для реакции со вторым реагентом, и субстрат. В различных вариантах реализации настоящего изобретения первый реагент представляет собой винкулин или его фрагмент. В различных вариантах реализации настоящего изобретения второй реагент представляет собой CDT или его фрагмент. В различных вариантах реализации настоящего изобретения третий реагент и/или четвертый реагент содержит метку для создания сигнала индикации наличия антитела к винкулину и/или антитела к CDT. В различных вариантах реализации настоящего изобретения метка представляет собой радиометку, хромофор, флуорофор, квантовую точку, фермент, пероксидазу хрена (ПХ), щелочную фосфатазу (ЩФ), биотин или их комбинацию. В различных вариантах реализации настоящего изобретения метка представляет собой фермент, который будет вступать в реакцию с субстратом. В различных вариантах реализации настоящего изобретения первый реагент находится на твердой фазе (например, на планшете, многолуночном планшете). В различных вариантах реализации настоящего изобретения субстрат представляет собой хромогенный субстрат (например, 3,3’,5,5’-тетраметилбензидин (ТМБ), 3,3’-диаминобензидин (ДАБ), 2,2’-азино-бис(3-этилбензотиазолин-6-сульфокислоту) (АБТС). В различных вариантах реализации настоящего изобретения субстрат представляет собой хемилюминесцентный субстрат (например, ECL).

[118] В различных вариантах реализации настоящего изобретения анализ включает первый реагент для реакции с антителом к винкулину и второй реагент для реакции с антителом к CDT. В различных вариантах реализации настоящего изобретения первый реагент и/или второй реагент содержит метку для создания сигнала индикации наличия антитела к винкулину и/или антитела к CDT. В различных вариантах реализации настоящего изобретения метка представляет собой радиометку, хромофор, флуорофор, квантовую точку, фермент, пероксидазу хрена (ПХ), щелочную фосфатазу (ЩФ), биотин или их комбинацию. В различных вариантах реализации настоящего изобретения реагент находится на твердой фазе (например, на планшете, многолуночном планшете). В различных вариантах реализации настоящего изобретения анализ дополнительно содержит субстрат для реакции с меткой в тех случаях, когда метке для создания сигнала необходим субстрат; например, ПХ может реагировать с субстратом ТМБ.

[119] В различных вариантах реализации настоящего изобретения определение уровня антитела к винкулину или уровня антитела к CDT выполняют в биологическом образце, полученном от субъекта. В другом варианте реализации настоящего изобретения определение уровня антитела к винкулину или уровня антител к CDT выполняют в образце крови, сыворотки или кала, полученном от субъекта. Обычный специалист в данной области техники легко поймет способы и системы, которые могут быть использованы для определения уровня антител к винкулину или уровня антител к CDT. Эти способы и системы включают, но не ограничиваются перечисленным, иммуноферментный анализ (ELISA), иммуногистохимический анализ, проточную цитометрию, флюоресцентную гибридизацию in situ (FISH), радиоиммуноанализы и афинную очистку.

[120] В различных вариантах реализации настоящего изобретения винкулин, SEQ ID №:7, или его фрагмент (как описано выше) используют в качестве реагента (например, коллектора, ловушки) для связывания с антителами к винкулину (при их наличии).

[121] В определенных вариантах реализации настоящего изобретения определение уровня антитела, которое специфически связывается с винкулином, SEQ ID №: 7, или его фрагментом, может быть выполнено посредством контактирования винкулина, SEQ ID №:7, или его фрагмента с биологическим образцом, полученным от субъекта, чтобы выделить антитело, которое специфически связывается с винкулином, SEQ ID №:7, или его фрагментом.

[122] В различных вариантах реализации настоящего изобретения фрагмент винкулина или SEQ ID №:7 могут быть фрагментами, описанными в настоящем документе. В качестве примера, аффинная матрица, содержащая винкулин, SEQ ID №:7, или его фрагмент, может быть связана с твердой подложкой; биологический образец может контактировать с аффинной матрицей для получения комплекса «аффинная матрица-антитело» (при наличии антитела); комплекс «аффинная матрица-антитело» может быть отделен от остальной части биологического образца; и антитело может быть высвобождено из аффинной матрицы. В другом примере метку (например, флуоресцентную метку) можно поместить на винкулин, SEQ ID №:7, или его фрагмент; меченный винкулин, SEQ ID №:7, или его фрагмент может контактировать с биологическим образцом, чтобы позволить антителу (при его наличии) специфически связываться с меченным винкулином, SEQ ID №:7, или его фрагментом. В различных вариантах реализации настоящего изобретения меченный винкулин, SEQ ID №:7, или его фрагмент может быть отделен и проанализирован в отношении его связывания с антителом.

[123] В различных вариантах реализации настоящего изобретения CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5, или их фрагмент, как обсуждается в настоящем документе, используют в качестве реагента (например, коллектора, ловушки) для связывания с антителами к CDT (при их наличии).

[124] В определенных вариантах реализации настоящего изобретения определение уровня антитела, которое специфически связывается с CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или его фрагментом, как обсуждается в настоящем документе, может быть выполнено посредством контактирования CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагмента, как обсуждается в настоящем документе, с биологическим образцом, полученным от субъекта, чтобы выделить антитело, которое специфически связывается с CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагментом, как обсуждается в настоящем документе.

[125] В различных вариантах реализации настоящего изобретения фрагмент CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 является таким, как описано в настоящем документе. В качестве примера, аффинная матрица, содержащая CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагмент, как обсуждается в настоящем документе, может быть связана с твердой подложкой; биологический образец может контактировать с аффинной матрицей для получения комплекса «аффинная матрица-антитело» (при наличии антитела); комплекс «аффинная матрица-антитело» может быть отделен от остальной части биологического образца; и антитело может быть высвобождено из аффинной матрицы. В другом примере метку (например, флуоресцентную метку) можно поместить на CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагмент, как обсуждается в настоящем документе; меченный CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагмент, как обсуждается в настоящем документе, контактирует с биологическим образцом, чтобы позволить антителу (при его наличии) специфически связываться с меченным CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагментом, как обсуждается в настоящем документе. В различных вариантах реализации настоящего изобретения меченный CDT, CdtA, CdtB, CdtC, SEQ ID №:1, 2, 4, 5 или их фрагмент, как обсуждается в настоящем документе, может быть отделен и проанализирован в отношении его связывания с антителом.

[126] В различных вариантах реализации настоящего изобретения анализ включает добавление винкулина или его фрагмента, как обсуждается в настоящем документе, и CdtB или его фрагмента, как обсуждается в настоящем документе, к биологическому образцу от субъекта, которому желательно определить наличие СРК, причем антитела к винкулину и/или CdtB (если они присутствуют в биологическом образце) специфически связываются с винкулином или его фрагментом и CdtB или его фрагментом в биологическом образце; измерение уровней антител к винкулину и антител к CdtB в биологическом образце; и идентификацию того, что субъект имеет СРК, если уровни связывания антител к винкулину выше уровней связывания антител к CdtB.

Выбор терапии

Способы

[127] В различных вариантах реализации настоящего изобретения предлагается способ выбора терапии СРК, включающий: предоставление биологического образца от субъекта, которому желательно поставить диагноз в отношении СРК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; определение разности между уровнем антител к винкулину и уровнем антител к CDT; определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT; и выбор терапии СРК при установлении наличия СРК.

[128] В различных вариантах реализации настоящего изобретения предлагается способ выбора терапии СРК: предоставление биологического образца от субъекта, которому желательно поставить диагноз, чтобы дифференцировать СРК и ВЗК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; определение разности между уровнем антител к винкулину и уровнем антител к CDT; определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT; и выбор терапии СРК при установлении наличия СРК.

[129] Анализ биологических образцов может быть выполнен так, как описано в настоящем документе.

[130] В различных вариантах реализации настоящего изобретения определяют, что субъект имеет СРК, если уровень антител к винкулину на 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900 или 1000% или более превышает уровень антител к CDT. В различных вариантах реализации настоящего изобретения величина, на которую уровень антител к винкулину больше уровня антител к CDT, обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Процент в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения процент в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[131] В определенных вариантах реализации настоящего изобретения для определения уровня антител к винкулину и антител к CDT используют измерение оптической плотности (ОП). Таким образом, когда разность между ОП антител к винкулину (ОПV) и ОП антител к CDT (ОПCDT) превышает 0, определяют, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,1, 0,2, 0,3, 0,4, 0,5 или 0,6, определяют, что субъект имеет СРК. В определенных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,2, определяют, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения величина разности ОПV–ОПCDT обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Значение разности ОПV–ОПCDT в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения значение разности ОПV–ОПCDT в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[132] При использовании в настоящем документе выражение «выбор терапии» включает, но не ограничивается перечисленным, выбор, отбор, назначение, предоставление советов, рекомендаций, инструктажа или консультирования субъекта в отношении лечения.

[133] В различных вариантах реализации настоящего изобретения способ дополнительно включает назначение терапии для лечения СРК.

[134] В различных вариантах реализации настоящего изобретения выбранная и назначенная терапия представляет собой терапию, которая описана в настоящем документе. В различных вариантах реализации настоящего изобретения выбранная или назначенная терапия является доступной терапией в момент осуществления настоящего изобретения. В различных вариантах реализации настоящего изобретения доступная терапия включает назначение курса антибиотикотерапии для лечения СРК. В различных вариантах реализации настоящего изобретения терапия является доступной терапией СРК известного уровня техники. В различных вариантах реализации настоящего изобретения доступная терапия является экспериментальной терапией СРК, например, терапией для лечения СРК, которая проходит одобрение FDA.

[135] В различных вариантах реализации настоящего изобретения анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT может быть выполнен как описано в настоящем документе.

[136] В различных вариантах реализации настоящего изобретения субъект может являться субъектом, с наличием одного или более симптомов СРК; таких как, например, запор, диарея, вздутие живота, боли в животе.

[137] В различных вариантах реализации настоящего изобретения СРК может представлять собой СРК-З, СРК-Д, СРК-См (также известный как СРК-Ч). В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК. В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК-З, тяжелый СРК-Д или тяжелый СРК-См.

[138] В различных вариантах реализации настоящего изобретения антитела к CDT представляют собой антитела CdtB.

[139] Примеры антибиотиков включают, но не ограничиваются перечисленным, аминогликозиды (например, амикацин, гентамицин, канамицин, неомицин, нетилмицин, стрептомицин, тобрамицин, паромомицин), ансамицины (например, гелданамицин, гербимицин), карбацефемы (например, лоракарбеф), карбапенемы (например, эртапенем, дорипенем, имипенем, циластатин, меропенем), цефалоспорины (например, первое поколение: цефадроксил, цефазолин, цефалотин или цефалозин, цефалексин; второе поколение: цефаклор, цефамандол, цефокситин, цефпрозил, цефуроксим; третье поколение: цефиксим, цефдинир, цефдиторен, цефоперазон, цефотаксим, цефподоксим, цефтазидим, цефтибутен, цефтизоксим, цефтриаксон; четвертое поколение: цефепим; пятое поколение: цефтобипрол), гликопептиды (например, тейкопланин, ванкомицин), макролиды (например, азитромицин, кларитромицин, диритромицин, эритромицин, рокситромицин, тролеандомицин, телитромицин, спектиномицин), монобактамы (например, азтреонам), пенициллины (например, амоксициллин, ампициллин, азосилин, карбенициллин, клоксациллин, диклоксациллин, флуклоксациллин, мезлоциллин, метициллин, нафциллин, оксациллин, пенициллин, пиперациллин, тикарциллин), полипептидные антибиотики (например, бацитрацин, колистин, полимиксин В), хинолоны (например, ципрофлоксацин, эноксацин, гатифлоксацин, левофлоксацин, ломефлоксацин, моксифлоксацин, норфлоксацин, офлоксацин, тровафлоксацина), рифамицины (например, рифампицин или рифампин, рифабутин, рифапентин, рифаксимин), сульфаниламиды (например, мафенид, пронтозил, сульфацетамид, сульфаметизол, сульфаниламид, сульфасалазин, сульфизоксазол, триметоприм, триметоприм-сульфаметоксазол (ко-тримоксазол, TMP-SMX) и тетрациклины (например, демеклоциклин, доксициклин, миноциклин, окситетрациклин, тетрациклин), а также арсфенамин, хлорамфеникол, клиндамицин, линкомицин, этамбутол, фосфомицин, фузидиева кислота, фуразолидон, изониазид, линезолид, метронидазол, мупироцин, нитрофурантоин, платенсимицин, пиразинамид, комбинация квинупристин/ дальфопристин и тинидазол или их комбинации. В различных вариантах реализации настоящего изобретения антибиотики представляют собой комбинацию рифаксимина и неомицина. В различных вариантах реализации настоящего изобретения антибиотики представляют собой комбинацию рифаксимина и доксициклина. В различных вариантах реализации настоящего изобретения антибиотики представляют собой комбинацию рифаксимина и метронидазола.

[140] В различных вариантах реализации настоящего изобретения антибиотики представляют собой неабсорбируемые антибиотики. Примеры неабсорбируемых антибиотиков включают, но не ограничиваются перечисленным, рифаксимин, неомицин, бацитрацин, ванкомицин, тейкопланин, рамопланин и парамомицин.

[141] Примеры дополнительных средств терапии СРК включают пищевые добавки с волокнами клетчатки (например, METAMUCIL, CITRUCEL), осмотические слабительные (например, гидроокись магния, полиэтиленгликоль), антидиарейные препараты (например, лоперамид (IMODIUM), вещества, связывающие желчные кислоты (например, холестирамин (PREVALITE), колестипол (COLESTID) или колесевелам (WELCHOL), антихолинергические и спазмолитические препараты (например, гиосциамин (LEVSIN) и дицикломин (BENTYL), антидепрессанты (например, трициклический антидепрессант (например, имипрамин (TOFRANIL) или нортриптилин (PAMELOR)) или селективный ингибитор обратного захвата серотонина (СИОЗС) (например, флуоксетин (PROZAC, SARAFEM) или пароксетин (PAXIL)), алосетрон (LOTRONEX) и лубипростон (AMITIZA). Современные средства для терапии СРК с запорами включают стимуляторы секреции, такие как лубипростон (активатор хлоридных каналов (AMITIZA)) и линаклотид (агонист гуанилатциклазы C (LINZESS)).

Разведение биологических образцов и антигенов

[142] В различных вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину, белок винкулин или его фрагмент, как описано в настоящем документе, используют в качестве антигена в концентрации около 1,2 мкг/мл. В других вариантах реализации настоящего изобретения концентрация может составлять около 0,1, 0,2, 0,3, 0,4, 0,5, 0,6, 0,7, 0,8, 0,9, 1,0, 1,1, 1,3, 1,4, 1,5, 1,6, 1,7, 1,8, 1,9 или 2,0 мкг/мл.

[143] В различных вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину используют биологический образец (например, плазму, сыворотку) в разведении около 1:16. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину используют биологический образец (например, плазму, сыворотку) в разведении около 1:8, 1:9, 1:10; 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17; 1:18, 1:19, 1:20, 1:22, 1:24, 1:26, 1:28, 1:30, 1:32, 1:34, 1:36, 1:38, 1:40, 1:42, 1:44, 1:46 или 1:48. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину используют биологический образец (например, плазму, сыворотку) в разведении от около 1:8 до 1:48.

[144] В различных вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину используют биологический образец (например, плазму, сыворотку) в разведении около 1:32. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину используют биологический образец (например, плазму, сыворотку) в разведении около 1:8, 1:10, 1:12; 1:16, 1:20, 1:24, 1:30, 1:36, 1:48 или 1:64. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину используют биологический образец (например, плазму, сыворотку) в разведении от около 1:8 до 1:64. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к винкулину используют биологический образец (например, плазму, сыворотку) в разведении от около 1:5 до 1:10, 1:10–1:25, 1:25–1:50, 1:50–1:100, 1:100–1:200, 1:200–1:300, 1:300–1:400, 1:400–1:500, 1:500–1:600 или 1:600–1:100.

[145] В различных вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB, белок CdtB или его фрагмент, как описано в настоящем документе, используют в качестве антигена в концентрации около 1,2 мкг/мл. В других вариантах реализации настоящего изобретения концентрация может составлять около 0,1, 0,2, 0,3, 0,4, 0,5, 0,6, 0,7, 0,8, 0,9, 1,0, 1,1, 1,3, 1,4, 1,5, 1,6, 1,7, 1,8, 1,9 или 2,0 мкг/мл.

[146] В различных вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении около 1:16. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении около 1:8, 1:9, 1:10; 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17; 1:18, 1:19, 1:20, 1:22, 1:24, 1:26, 1:28, 1:30, 1:32, 1:34, 1:36, 1:38, 1:40, 1:42, 1:44, 1:46 или 1:48. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении от около 1:8 до 1:48.

[147] В различных вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении 1:512. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении около 1:128, 1:256, 1:768 или 1:1024. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении около 1:100, 1:150, 1:200, 1:250, 1:300, 1:350, 1:400, 1:500, 1:550; 1:600, 1:650, 1:700, 1:750, 1:800, 1:850, 1:900, 1:950 или 1:1000. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении около 1:100–1:1000. В других вариантах реализации настоящего изобретения при определении наличия или уровня антител к CdtB используют биологический образец (например, плазму, сыворотку) в разведении от около 1:5 до 1:10, 1:10–1:25, 1:25–1:50, 1:50–1:100, 1:100–1:200, 1:200–1:300, 1:300–1:400, 1:400–1:500, 1:500–1:600 или 1:600–1:100.

[148] В различных вариантах реализации настоящего изобретения если для определения уровня антител к винкулину и уровня антител к CdtB разведение биологического образца отличается и используют ОП, то выполняют корректировку на разницу ОП.

Виды лечения

[149] В различных вариантах реализации настоящего изобретения предлагаются способы лечения СРК.

[150] В различных вариантах реализации настоящего изобретения способ может включать определение наличия антител к винкулину, превышающее наличие антител к CDT в биологическом образце, полученном от субъекта; и назначение субъекту терапии СРК.

[151] В различных вариантах реализации настоящего изобретения способ может включать предоставление биологического образца от субъекта, которому желательно поставить диагноз в отношении СРК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; определение разности между уровнем антител к винкулину и уровнем антител к CDT; определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT; и назначение терапии СРК при определении наличия СРК.

[152] В различных вариантах реализации настоящего изобретения способ может включать предоставление биологического образца от субъекта, которому желательно поставить диагноз, чтобы дифференцировать СРК и ВЗК; анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; определение разности между уровнем антител к винкулину и уровнем антител к CDT; определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT; и назначение терапии СРК при определении наличия СРК.

[153] Анализ биологических образцов может быть выполнен так, как описано в настоящем документе.

[154] В различных вариантах реализации настоящего изобретения определяют, что субъект имеет СРК, если уровень антител к винкулину на 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900 или 1000% или более превышает уровень антител к CDT. В различных вариантах реализации настоящего изобретения величина, на которую уровень антител к винкулину больше уровня антител к CDT, обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Процент в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения процент в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[155] В определенных вариантах реализации настоящего изобретения для определения уровня антител к винкулину и антител к CDT используют измерение оптической плотности (ОП). Таким образом, когда разность между ОП антител к винкулину (ОПV) и ОП антител к CDT (ОПCDT) превышает 0, определяют, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,1, 0,2, 0,3, 0,4, 0,5 или 0,6, определяют, что субъект имеет СРК. В определенных вариантах реализации настоящего изобретения, когда разность ОПV–ОПCDT превышает 0,2, определяют, что субъект имеет СРК. В различных вариантах реализации настоящего изобретения величина разности ОПV–ОПCDT обеспечивает прогностическую ценность положительных результатов в отношении наличия СРК. Значение разности ОПV–ОПCDT в отношении прогностической ценности положительных результатов может быть таким, как описано в настоящем документе. В некоторых вариантах реализации настоящего изобретения значение разности ОПV–ОПCDT в отношении прогностической ценности положительных результатов можно рассчитать путем исследования уровней антител к винкулину и антител к CDT у дополнительных пациентов с СРК в сравнении с контрольными пациентами или у дополнительных пациентов с СРК в сравнении с пациентами с ВЗК.

[156] В различных вариантах реализации настоящего изобретения назначенная терапия представляет собой терапию, которая описана в настоящем документе. В различных вариантах реализации настоящего изобретения назначенная терапия является доступной терапией в момент осуществления настоящего изобретения. В различных вариантах реализации настоящего изобретения доступная терапия включает назначение курса антибиотикотерапии для лечения СРК. В различных вариантах реализации настоящего изобретения терапия является доступной терапией известного уровня техники.

[157] В различных вариантах реализации настоящего изобретения анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT может быть выполнен как описано в способах и системах настоящего изобретения.

[158] В различных вариантах реализации настоящего изобретения субъект может являться субъектом, с наличием одного или более симптомов СРК; таких как, например, запор, диарея, вздутие живота, боли в животе.

[159] В различных вариантах реализации настоящего изобретения СРК может представлять собой СРК-З, СРК-Д, СРК-См (также известный как СРК-Ч). В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК. В различных вариантах реализации настоящего изобретения СРК представляет собой тяжелый СРК-З, тяжелый СРК-Д или тяжелый СРК-См.

[160] В различных вариантах реализации настоящего изобретения антитела к CDT представляют собой антитела CdtB.

[161] В различных вариантах реализации настоящего изобретения способ может включать предоставление агента, нейтрализующего или ингибирующего антитело к винкулину и введение агента, нейтрализующего или ингибирующего антитело к винкулину, субъекту, которому необходимо нейтрализовать или ингибировать антитело к винкулину.

[162] В различных вариантах реализации настоящего изобретения агент, нейтрализующий или ингибирующий антитело к винкулину, представляет собой полипептид, способный связываться с антителом к винкулину и нейтрализовать или ингибировать его функцию.

[163] В различных вариантах реализации настоящего изобретения агент, нейтрализующий или ингибирующий антитело к винкулину, представляет собой полипептид, способный связываться с антигенсвязывающим участком антитела к винкулину. Не желая ограничиваться какой-либо конкретной теорией, авторы изобретения полагают, что эти полипептиды могут служить в качестве ложной цели для антитела к винкулину. В различных вариантах реализации настоящего изобретения полипептиды представляют собой пентапептиды CDT, как раскрыто в публикации Lucchese and Delfino (Developing an anti-Campylobacter jejuni vaccine. Immunopharmacology and Immunotoxicology, 2012; Early Online: 1–6), включенной в настоящий документ путем ссылки во всей полноте, как если бы она была изложена полностью.

[164] В различных вариантах реализации настоящего изобретения агент, нейтрализующий или ингибирующий антитело к винкулину, представляет собой малую молекулу, способную связываться с антителом к винкулину и нейтрализовать или ингибировать его функцию.

[165] В различных вариантах реализации настоящего изобретения агент, нейтрализующий или ингибирующий антитело к винкулину, представляет собой малую молекулу, способную связываться с антигенсвязывающим участком антитела к винкулину.

[166] В различных вариантах реализации настоящего изобретения способ может включать предоставление агента для изменения состояния винкулина из неактивного состояния в активное; и ведение агента субъекту, нуждающемуся в этом, для лечения СРК.

[167] В различных вариантах реализации настоящего изобретения агент для изменения состояния винкулина из неактивного состояния в активное представляет собой малую молекулу, способную активировать винкулин.

[168] В различных вариантах реализации настоящего изобретения способ может включать предоставление агониста винкулина; и введение агониста винкулина субъекту, нуждающемуся в этом, для лечения СРК. В определенных вариантах реализации настоящего изобретения агонист винкулина может представлять собой винкулин-активирующий пептид (ВАП), как раскрыто в публикации Nelson et al., Vinculin Activators Target Integrins from Within the Cell to Increase Melanoma Sensitivity to Chemotherapy, Mol Cancer Res June 2011 9; 712 (опубликована онлайн 1 апреля 2011 г.), включенной в настоящий документ путем ссылки во всей полноте, как если бы она была изложена полностью. В различных вариантах реализации настоящего изобретения ВАП может представлять собой остатки 500–633 белка инвазина IpaA Shigella.

[169] Последовательность белка IpaA Shigella:

[170] MHNVNNTQAP TFLYKATSPS STEYSELKSK ISDIHSSQTS LKTPASVSEK ENFATSFNQK CLDFLFSSSG KEDVLRSIYS NSMNAYAKSE ILEFSNVLYS LVHQNGLNFE NEKGLQKIVA QYSELIIKDK LSQDSAFGPW SAKNKKLHQL RQNIEHRLAL LAQQHTSGEA LSLGQKLLNT EVSSFIKNNI LAELKLSNET VSSLKLDDLV DAQAKLAFDS LRNQRKNTID SKGFGIGKLS RDLNTVAVFP ELLRKVLNDI LEDIKDSHPI QDGLPTPPED MPDGGPTPGA NEKTSQPVIH YHINNDNRTY DNRVFDNRVY DNSYHENPEN DAQSPTSQTN DLLSRNGNSL LNPQRALVQK VTSVLPHSIS DTVQTFANNS ALEKVFNHTP DNSDGIGSDL LTTSSQERSA NNSLSRGHRP LNIQNSSTTP PLHPEGVTSS NDNSSDTTKS SASLSHRVAS QINKFNSNTD SKVLQTDFLS RNGDTYLTRE TIFEASKKVT NSLSNLISLI GTKSGTQERE LQEKSKDITK STTEHRINNK LKVTDANIRN YVTETNADTI DKNHAIYEKA KEVSSALSKV LSKIDDTSAE LLTDDISDLK NNNDITAENN NIYKAAKDVT TSLSKVLKNI NKD (SEQ ID №:8)

[171] В различных вариантах реализации настоящего изобретения способ может включать предоставление активатора винкулина; и введение активатора винкулина субъекту, нуждающемуся в этом, для лечения СРК. В определенных вариантах реализации настоящего изобретения активатор винкулина может представлять собой талин, f-актин, a-катенин, или их комбинации.

[172] В различных вариантах реализации в настоящем изобретении предлагается фармацевтическая композиция, содержащая фармацевтически приемлемое вспомогательное вещество вместе с терапевтически эффективным количеством агентов, описанных в настоящем документе. «Фармацевтически приемлемое вспомогательное вещество» означает вспомогательное вещество, подходящее для получения фармацевтической композиции, которая в общем случае является безопасной, нетоксичной и желательной, и содержит вспомогательные вещества, являющиеся приемлемыми для применения в ветеринарии, а также для фармацевтического применения у людей. Такие вспомогательные вещества могут быть твердыми, жидкими, полутвердыми или, в случае аэрозольной композиции, газообразными.

[173] В различных вариантах реализации настоящего изобретения фармацевтические композиции в соответствии с настоящим изобретением могут быть приготовлены для доставки посредством любого пути введения. «Путь введения» может относиться к любому пути введения, известному в данной области техники, включая, но не ограничиваясь перечисленным, аэрозольный, назальный, пероральный, через слизистую, трансдермальный или парентеральный. «Трансдермальное введение» можно осуществлять с использованием крема или мази для местного нанесения или с помощью трансдермального пластыря. Для лечения кожи и слизистых оболочек фармацевтические композиции на основе соединений по настоящему изобретению могут быть приготовлены для местного пути введения и быть представленными в форме мазей, кремов, молочка, бальзамов, порошков, пропитанных тампонов, растворов, гелей, спреев, лосьонов или суспензий. Они могут также быть в форме микросфер, или наносфер, или липидных везикул, или полимерных везикул, или полимерных пластырей и гидрогелей, позволяющих контролируемое высвобождение. Эти композиции для местного пути введения в зависимости от клинических показаний могут быть в безводной форме или в водной форме. «Парентеральный» относится к пути введения, который обычно связан с инъекцией, включая интраорбитальную инъекцию, инфузию, внутриартериальную, интракапсулярную, внутрисердечную, внутрикожную, внутримышечную, внутрибрюшинную, внутрилегочную, интраспинальную, внутригрудинную, интратекальную, внутриматочную, внутривенную, субарахноидальную, подкапсульную, подкожную, черезслизистую или транстрахеальную инъекцию. Для введения парентеральным путем композиции могут быть в форме растворов или суспензий для инфузии или для инъекции, или в форме лиофилизированных порошков. Для введения энтеральным путем фармацевтические композиции могут быть в форме таблеток, гелевых капсул, таблеток с сахарным покрытием, сиропов, суспензий, растворов, порошков, гранул, эмульсий, микросфер, или наносфер, или липидных везикул, или полимерных везикул, позволяющих контролируемое высвобождение. Для введения парентеральным путем композиции могут быть в форме растворов или суспензий для инфузии или для инъекции.

[174] Фармацевтические композиции согласно настоящему изобретению могут также содержать любой фармацевтически приемлемый носитель. При использовании в настоящем документе «фармацевтически приемлемый носитель» относится к фармацевтически приемлемому материалу, композиции или носителю, который участвует в переносе или транспортировке соединения, представляющего интерес, из одной ткани, органа или части организма к другой ткани, органу, или части организма. Например, носитель может представлять собой жидкий или твердый наполнитель, разбавитель, вспомогательное вещество, растворитель, или инкапсулирующий материал, или их комбинацию. Каждый компонент носителя должен быть «фармацевтически приемлемым» в том смысле, что он должен быть совместим с другими компонентами композиции. Он также должен подходить для использования в контакте с любыми тканями или органами, с которыми он может контактировать, а это означает, что он не должен нести риск токсичности, раздражения, аллергической реакции, иммуногенности или любого другого осложнения, которое чрезмерно перевешивает его терапевтические преимущества.

[175] Фармацевтические композиции согласно настоящему изобретению могут быть также инкапсулированы, таблетированы или приготовленный в виде эмульсии или сиропа для перорального введения. Фармацевтически приемлемые твердые или жидкие носители могут быть добавлены для усиления или стабилизации композиции или для облегчения получения композиции. Жидкие носители включают сироп, арахисовое масло, оливковое масло, глицерин, физиологический раствор, спирты и воду. Твердые носители включают крахмал, лактозу, сульфат кальция, дигидрат, каолин, стеарат магния или стеариновую кислоту, тальк, пектин, камедь, агар или желатин. Носитель может также включать материал с замедленным высвобождением, такой как глицерилмоностеарат или глицерилдистеарат, отдельно или с воском.

[176] Фармацевтические препараты получают, следуя обычным способам фармации с использованием измельчения, смешивания, гранулирования и сжатия, когда это необходимо, для таблетированных форм; или измельчения, смешивания и наполнения для форм твердых желатиновых капсул. При использовании жидкого носителя препарат будет в форме сиропа, эликсира, эмульсии или водной или неводной суспензии. Такую жидкую композицию можно вводить непосредственно п/о (перорально) или наполнять ею мягкую желатиновую капсулу.

[177] Фармацевтические композиции согласно настоящему изобретению могут быть доставлены в терапевтически эффективном количестве. Точное терапевтически эффективное количество представляет собой такое количество композиции, которое даст наиболее эффективные результаты с точки зрения эффективности лечения у данного субъекта. Это количество будет варьироваться в зависимости от целого ряда факторов, включая, но не ограничиваясь перечисленным, характеристики терапевтического соединения (включая активность, фармакокинетику, фармакодинамику и биодоступность), физиологическое состояние субъекта (включая возраст, пол, вид и стадию заболевания, общее физическое состояние, чувствительность к данной дозе и тип лекарственного средства), природу фармацевтически приемлемого носителя или носителей в композиции и способ введения. Специалист в клинической и фармакологической областях техники будет способен определить терапевтически эффективное количество посредством рутинного эксперимента, например, путем наблюдения за реакцией субъекта на введение соединения и соответствующей корректировки дозы. Для получения дополнительных указаний см. Remington: The Science and Practice of Pharmacy (Gennaro ed. 20th edition, Williams & Wilkins PA, USA) (2000).

ПРИМЕРЫ

[178] Следующие примеры приведены для лучшей иллюстрации заявленного изобретения и не должны интерпретироваться как ограничивающие объем настоящего изобретения. Упоминания конкретных материалов приведены исключительно для иллюстрации и не имеют целью ограничить настоящее изобретение. Специалист в данной области техники может разработать эквивалентные средства или реагенты без осуществления настоящего изобретения и не выходя за пределы его объема.

Пример 1. Измерение уровней антител к винкулину и антител к CDTB

[179] ЭТАП 1. Иммобилизация антигена. Каждый 96-луночный планшет в течение ночи (>16 часов) при температуре 4°C во влажной камере покрывали антигеном в количестве 100 мкл/лунка (винкулин или CdtB) в концентрации около 1,2 мкг/мл в БСБ, приблизительный уровень pH составлял 8,2. Дополнительную лунку для каждого образца покрывали только БСБ для определения неспецифического фона от сыворотки, который впоследствии вычитали из результата для лунки, покрытой антигеном.

[180] ЭТАП 2. Промывание 1. Лунки промывали 3 раза с использованием 0,05% PBS-T в количестве приблизительно 250 мкл/лунка.

[181] ЭТАП 3. Блокирование. Лунки блокировали с использованием 3% БСА в PBS в количестве 200 мкл/лунка в течение 1 часа при комнатной температуре во влажной камере.

[182] ЭТАП 4. Приготовление и распределение сыворотки. Сыворотку разводили до разведения 1:16 с использованием 3% БСА в PBS. Добавляли 100 мкл/лунка сыворотки. Инкубировали в течение 1 часа при комнатной температуре во влажной камере.

[183] ЭТАП 5. Промывание 2. Лунки промывали 3 раза с использованием 0,05% PBS-T в количестве приблизительно 250 мкл/лунка.

[184] ЭТАП 6. Получение и распределение вторичного раствора. Добавляли 100 мкл/лунка вторичного антитела, конъюгированного с ПХ, разведенного в 3% БСА в PBS до 1:10000. Инкубировали в течение 1 часа при комнатной температуре во влажной камере.

[185] ЭТАП 7. Промывание 3. Лунки промывали 6 раз с использованием 0,05% PBS-T в количестве приблизительно 250 мкл/лунка.

[186] ЭТАП 8. Детекция. Добавляли 100 мкл/лунка раствора субстрата ТМБ (однокомпонентный Ultra TMB-ELISA Substrate, Pierce, 34028). Сигналы с планшета немедленно считывали на спектрофотометре для прочтения планшетов (BioTek Synergy HT), с использованием протокола поглощательной способности при около 370 нм; и оставляли проявляться в течение 90 мин (анализ плато около 60 мин).

Пример 2.

[187] У описанных ниже субъектов отбирали образцы крови и анализировали на уровни антител к винкулину и антител к CDTB. Здоровые субъекты: 26 исследуемых субъектов, которые после заполнения анкеты были признаны не имеющими никаких патологических симптомов со стороны кишечника. Субъекты с ВЗК: 30 субъектов (15 БК и 15 ЯК). Активное ВЗК подтверждали с использованием эндоскопии, без терапии иммуномодуляторами. Субъекты с СРК: 162 субъекта (100 из медицинского центра Beth Israel и 62 из медицинского центра Cedars-Sinai); римские критерии положительные. Результаты представлены в таблицах ниже. ПЦПР=прогностическая ценность положительных результатов

[188]

Таблица 1
Разность между ОПV и ОПCDTB
Сравнение со здоровыми Сравнение с ВЗК
Пороговое значение ОПV–ПCDT Чувствительность Специфичность ПЦПР Чувствительность Специфичность ПЦПР
>0,6 20 100 100 20 93 94
>0,2 41 85 94 41 88 94
>0,1 48 77 93 48 83 94
>0 56 73 93 48 89 96

[189] Результаты дополнительно проанализировали для контроля ВЗК с использованием предположения, что 10% пациентов с ВЗК имеют СРК. Был получен коэффициент положительных антител для СРК, который применили к 10% пациентов с ВЗК (т.е. их удалили из анализа).

[190] Таблицы 2A и 2B. Контроль пациентов с СРК в группе ВЗК.

Таблица 2A
Винкулин Сравнение с ВЗК
Пороговое значение ОП Чувствительность Специфичность ПЦПР
>1,0 30 85 92
>0,8 59 70 92
>0,5 59 70 92

Таблица 2B
Сравнение с ВЗК
Пороговое значение ОПV–ОПCDT Чувствительность Специфичность ПЦПР
>0,6 20 96 97
>0,2 41 93 97
>0,1 48 89 96
>0 48 89 96

[191] Различные варианты реализации настоящего изобретения описаны выше в разделе «Подробное описание». В то время как эти описания непосредственно описывают вышеприведенные варианты реализации настоящего изобретения, следует понимать, что специалисты в данной области техники могут представить себе модификации и/или вариации конкретных вариантов реализации настоящего изобретения, показанных и описанных в данном документе. Любые такие модификации или вариации, попадающие в сферу данного описания, также предназначены для включения в него. Если специально не указано, то по замыслу изобретателей словам и фразам в описании и формуле изобретения даны обычные и привычные для обычных специалистов в соответствующей области (соответствующих областях) техники значения.

[192] Приведенное выше описание различных вариантов реализации настоящего изобретения, известных заявителю во время подачи заявки, представлено и предназначено для целей иллюстрации и описания. Данное описание не претендует на исчерпывающий характер или на ограничение изобретения точной раскрытой формой, и в свете вышеизложенного возможны многие модификации и вариации. Описанные варианты реализации настоящего изобретения служат для объяснения принципов настоящего изобретения и его практического применения, а также для предоставления возможности специалисту в данной области применять различные варианты реализации настоящего изобретения с различными модификациями, подходящими для конкретного предусмотренного использования. Таким образом, подразумевается, что изобретение не ограничено конкретными вариантами реализации настоящего изобретения, раскрытыми для осуществления данного изобретения.

[193] Хотя были показаны и описаны конкретные варианты реализации настоящего изобретения, для специалистов в данной области техники будет очевидным, что, на основании изложенных в настоящем описании идей, могут быть сделаны изменения и модификации без отступления от настоящего изобретения и его более широких аспектов и, следовательно, объем прилагаемой формулы изобретения охватывает все такие изменения и модификации, поскольку они находятся в пределах истинной сущности и объема настоящего изобретения. Специалистам в данной области техники следует понимать, что, в целом, термины, используемые в настоящем описании обычно являются «открытыми» терминами (например, термин «включая» следует интерпретировать как «включая, но не ограничиваясь перечисленным», термин «имеющий» следует интерпретировать как «имеющий по меньшей мере», термин «содержит» следует интерпретировать как «включает, но не ограничивается перечисленным» и т.п.).

1. Способ диагностики СРК, включающий предоставление биологического образца от субъекта, которому желательно поставить диагноз в отношении СРК;

анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT;

определение разности между уровнем антител к винкулину и уровнем антител к CDT; и

определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT.

2. Способ дифференциальной диагностики СРК и ВЗК, включающий:

предоставление биологического образца от субъекта, которому желательно поставить диагноз, чтобы дифференцировать СРК и ВЗК;

анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; и

определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT, или определение разности между уровнем антител к винкулину и уровнем антител к CDT.

3. Способ по любому из пп. 1, 2, отличающийся тем, что анализ биологического образца включает:

контактирование винкулина или его фрагмента с биологическим образцом;

контактирование CdtB или его фрагмента с биологическим образцом, причем антитела к винкулину и/или CdtB специфически связываются в биологическом образце с винкулином или его фрагментом и/или с CdtB или его фрагментом; и

измерение уровней антител к винкулину и антител к CdtB в биологическом образце.

4. Способ по любому из пп. 1, 2, отличающийся тем, что в нем определяют, что субъект имеет СРК, если уровень антител к винкулину на 25% или более превышает уровень антител к CDT.

5. Способ по любому из пп. 1, 2, отличающийся тем, что для измерения уровня антител к винкулину и антител к CDT используют оптическую плотность (ОП), и когда разность между ОП антител к винкулину (ОПV) и ОП антител к CDT (ОПCDT) превышает 0, определяют, что субъект имеет СРК.

6. Способ по п. 5, отличающийся тем, что когда разность ОПV – ОПCDT превышает 0,2, определяют, что субъект имеет СРК.

7. Способ по любому из пп. 1, 2, отличающийся тем, что антитело к винкулину представляет собой антитело, которое специфически связывается с винкулином.

8. Способ по любому из пп. 1, 2, отличающийся тем, что антитело к винкулину представляет собой антитело, которое специфически связывается с пептидом из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков, имеющим по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками винкулина или SEQ ID №:7.

9. Способ по любому из пп. 1, 2, отличающийся тем, что антитело к винкулину специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющих по меньшей мере 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками винкулина или SEQ ID №:7.

10. Способ по любому из пп. 1, 2, отличающийся тем, что антитело к CDT специфически связывается с CdtB субъединицей CDT.

11. Способ по п. 10, отличающийся тем, что аминокислотная последовательность CdtB представляет собой цитолетальный растягивающий токсин B Campylobacter jejuni (SEQ ID №:5).

12. Способ по любому из пп. 1, 2, отличающийся тем, что антитело к CDT специфически связывается с аминокислотной последовательностью по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичной SEQ ID №:5.

13. Способ по п. 10, отличающийся тем, что аминокислотная последовательность CdtB представляет собой цитолетальный растягивающий токсин B Campylobacter coli (SEQ ID №:1).

14. Способ по любому из пп. 1, 2, отличающийся тем, что антитело к CDT специфически связывается с аминокислотной последовательностью по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичной SEQ ID №:1.

15. Способ по любому из пп. 1, 2, отличающийся тем, что антитело к CDT специфически связывается с полипептидом, содержащим 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатка, имеющим по меньшей мере 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% гомологии с 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 смежными остатками CdtB.

16. Система для диагностики СРК, содержащая:

выделенный биологический образец от субъекта, которому желательно поставить диагноз в отношении СРК; и

один или более анализов, содержащих винкулин или его фрагмент и CdtB или его фрагмент, для определения уровня антител к винкулину и уровня антител к CDT для диагностики СРК.

17. Система для дифференциации СРК и ВЗК, содержащая:

выделенный биологический образец от субъекта, которому желательно провести дифференциальную диагностику СРК и ВЗК; и

один или более анализов, содержащих винкулин или его фрагмент и CdtB или его фрагмент, для определения уровня антител к винкулину и уровня антител к CDT для дифференциации СРК и ВЗК.

18. Система по п. 17, дополнительно содержащая аппарат для определения наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT.

19. Система по п. 17 или 18, дополнительно содержащая выход или элемент отображения для отображения того, имеет ли пациент СРК, и/или для отображения того превышает ли уровень антител к винкулину уровень антител к CDT.

20. Способ проведения лечения СРК, включающий

предоставление биологического образца от субъекта, которому желательно поставить диагноз в отношении СРК;

анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT;

определение разности между уровнем антител к винкулину и уровнем антител к CDT; и

определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT; и

проведение лечения СРК у субъекта, если определено, что субъект имеет СРК.

21. Способ проведения лечения СРК, включающий:

предоставление биологического образца от субъекта, которому желательно поставить диагноз, чтобы дифференцировать СРК и ВЗК;

анализ биологического образца с определением уровня антител к винкулину и уровня антител к CDT; и

определение наличия СРК, если уровень антител к винкулину превышает уровень антител к CDT, или определение разности между уровнем антител к винкулину и уровнем антител к CDT; и

проведение лечения СРК у субъекта, если определено, что субъект имеет СРК.



 

Похожие патенты:

Группа изобретений относится к области создания магазинов аналитических средств. Магазин аналитических средств содержит множество аналитических вспомогательных средств, по меньшей мере два отсека, в которые помещены аналитические вспомогательные средства, при этом каждое из аналитических вспомогательных средств содержит по меньшей мере один тестирующий элемент с по меньшей мере одним химическим реактивом для распознавания по меньшей мере одного аналита в пробе жидкости.

Изобретение относится к области ветеринарии, микробиологии и биотехнологии. Предложен способ выявления и количественной оценки содержания ДНК U.

Изобретение относится к области медицины, в частности к акушерству, и предназначено для прогнозирования преждевременных родов. Используя показатели концентрации общего количества внеклеточной ДНК (овДНК) и концентрации IL-8 в плазме периферической крови у беременных женщин на 22-36 неделях гестации, определяют переменную Р.
Изобретение относится к медицине, гинекологии и может быть использовано в лечении пациенток с пролапсом гениталий при недифференцированной дисплазии соединительной ткани.

Изобретение относится к способу определения свинца(II) в водных объектах окружающей среды и биологических образцах. Способ включает приготовление полимерной сенсорной пленки, которую помещают в испытуемый образец и по изменению цвета полимерной сенсорной пленки определяют наличие в нем свинца(II), количество которого определяют по калиброванной цветовой шкале, предварительно полученной из не менее 5-ти испытуемых образцов с известными концентрациями свинца.

Изобретение относится к измерительной технике и может быть использовано для тестирования жидкой пробы. Заявлен блок носителя реагентов, представляющий собой картридж сосудов или микропланшет, имеющий множество реакционных сосудов, содержащий соединительную часть для обеспечения разъемного соединения с соединительной частью (18) пипетирующей руки средств пипетирования лабораторного робота (1) для разъемного соединения пипетирующего наконечника.

Изобретение относится к медицине, а именно к офтальмологии, и представляет собой способ оценки эффективности нейроретинопротективного лечения первичной открытоугольной глаукомы с применением препарата Ретиналамина, включающий определение содержания нейронспецифической энолазы (neuron specific enolase или NSE) в слезной жидкости, согласно изобретению ее определяют до и после лечения и при снижении содержания NSE не менее чем на 20% от исходного показателя результат нейроретинопротекции оценивают как эффективный.

Изобретение относится к медицине, а именно к офтальмологии, и может быть использовано для оценки эффективности нейроретинопротекции первичной открытоугольной глаукомы.

Изобретение относится к медицине, а именно к офтальмологии, и может быть использовано для оценки эффективности нейроретинопротекции первичной открытоугольной глаукомы.

Изобретение относится к медицине, а именно к области диагностики онкогематологических заболеваний, и может быть использовано для дифференциальной диагностики острых лейкозов.

Изобретение относится к медицине, кардиологии, оценке индивидуального риска развития отдаленных (более 5 лет после чрескожного коронарного вмешательства, ЧКВ) фатальных сердечных и цереброваскулярных событий.

Изобретение относится к области медицины, а именно к хирургии, и предназначено для прогнозирования течения репаративного процесса лапаротомной раны при остром перитоните.

Изобретение относится к медицине, а именно к медицинской диагностике, и может быть использовано для диагностики хламидийной урогенитальной инфекции у мужчин на основе оценки уровней цитокинов.

Изобретение относится к области исследования характеристик крови и ее компонентов, в частности их свертываемости. Устройство для исследования пространственного свертывания крови и ее компонентов содержит термостатируемую камеру с узлом термостабилизации, внутри которой размещена емкость с исследуемым образцом и активатором, светодиоды, и регистрирующий модуль с видеокамерой.

Настоящее изобретение относится к способу измерения гемолиза или гематокрита в образце крови, включающему: a) измерение проводимости образца крови по меньшей мере на трех многочастотных входах переменного тока; b) вычисление значения иммиттанса за каждый из по меньшей мере трех многочастотных входов переменного тока; и c) подвергание каждого значения иммиттанса, вычисленного на этапе b), одной из (1) функции, которая отображает значения иммиттанса к уровням лизированной крови, и определение уровня лизированной крови в образце, или (2) функции, которая отображает значения иммиттанса к уровням гематокрита, и определение уровня гематокрита в образце, в то же время компенсируя уровень электролита образца.

Изобретение относится к области медицины. Предложен способ диагностики нарушений обмена нуклеиновых кислот (НК) у критических больных.

Изобретение относится к области медицины. Предложен способ диагностики нарушений обмена нуклеиновых кислот (НК) у критических больных.

Изобретение относится к измерительной технике и может быть использовано для неинвазивного анализа материала. Раскрыты способ и система для анализа материала (100).

Изобретение относится к биотехнологии. Заявлен способ определения вероятности того, что пациент имеет волчанку в доклинической стадии.
Изобретение относится к способам лабораторного определения макроформ креатинкиназы и макроформ МВ-изофермента. Описан способ определения макроформ креатинкиназы и макроформ МВ-изофермента в сыворотке крови человека, включающий определение активности креатинкиназы и МВ-изофермента энзиматическим методом, отличающийся тем, что макроформы креатинкиназы, в том числе МВ-изофермента, осаждают добавлением к сыворотке равного объема полиэтиленгликоля 6000 в конечной концентрации 12-14% с последующим центрифугированием в течение 20-25 минут при 2000-2200 g, в надосадочной жидкости определяют активность креатинкиназы и МВ-изофермента и рассчитывают активности макроформ в процентах от исходной активности креатинкиназы и ее МВ-изофермента.
Изобретение относится к медицине, а именно к клинической лабораторной диагностике, и может быть использовано для скринингового определения высокой вероятности наличия аллергического характера воспаления при бронхолегочных заболеваниях у детей старше 2 лет с повышенным уровнем в крови интерлейкина-8. Для этого скарифицируют участок эпидермиса на ладонной стороне предплечья. Получают отпечаток клеток и экссудата кожной асептической воспалительной реакции на предметных стеклах через 6, 24 и 32 часа с момента скарификации. Препараты фиксируют этанолом, окрашивают по Гимзе-Романовскому и микроскопируют при увеличении ×1000. Во всех препаратах определяют максимальное число лейкоцитов в поле зрения. Дополнительно в препарате, полученном через 6 часов с момента скарификации, определяют количество лейкоцитов с признаками аутолиза в процентах от общего числа лейкоцитов (показатель аутолиза). В препарате, полученном через 24 часа с момента скарификации, определяют количество эозинофилов в процентах от общего числа лейкоцитов и максимальное количество ядер фибробластов в поле зрения. При максимальном числе лейкоцитов более 26 через 6 часов с момента скарификации, менее 94 через 24 часа и менее 85 через 32 часа и при показателе аутолиза менее 67%, менее 0,3% эозинофилов и менее 5 ядер фибробластов определяют высокую вероятность наличия аллергического характера воспаления. Изобретение обеспечивает доступность и объективность выявления аллергического характера воспаления, ассоциированного с высоким уровнем интерлейкина-8 в крови, у детей с бронхолегочными заболеваниями. 1 пр.

Группа изобретений относится к медицине и предназначена для диагностики и лечения синдрома раздраженного кишечника. Описаны способы, анализы и системы для диагностики, выбора терапии и лечения СРК на основании уровня антител к винкулину и к CdtB у субъекта. Определяют наличие СРК, если уровень антител к винкулину превышает уровень антител к CdtB. Группа изобретений позволяет определить наличие СРК и провести его дифференциальную диагностику от воспалительных заболеваний кишечника. 6 н. и 15 з.п. ф-лы, 2 ил., 2 табл., 2 пр.

Наверх