Анти-fcrh5 антитела



Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела
Анти-fcrh5 антитела

Владельцы патента RU 2687132:

ДЖЕНЕНТЕК, ИНК. (US)

Изобретение относится к области биотехнологии. Предложен способ получения анти-FcRH5 антитела, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c и незначительно связывается с другим Ig-подобным доменом FcRH5. Способ включает иммунизацию мыши антигеном, выделение лимфоцитов из мыши и слияние с клетками миеломы с получением гибридомы и сбор анти-FcRH5 антитела из гибридомы. Также предложено анти-FcRH5 антитело, полученное указанным способом, и иммуноконъюгат на его основе. Рассмотрены полинуклеотид и клетка-хозяин для получения антитела по изобретению. Антитело и иммуноконъюгат по изобретению используются для получения фармацевтических композиций для лечения FcRH5-позитивного рака, в способах лечения пациентов, страдающих FcRH5-позитивным раком, ингибирования пролиферации FcRH5-позитивной клетки. Кроме того, представлен способ детекции FcRH5 в образце и способ детекции FcRH5-позитивного рака. Изобретение может найти применение в диагностике и лечении рака. 14 н. и 54 з.п. ф-лы, 25 ил., 4 табл.

 

РОДСТВЕННЫЕ ЗАЯВКИ

Данная заявка заявляет приоритет согласно 35 U.S.C. 119 предварительной патентной заявки США № 61/838534, поданной 24 июня 2013 г., описание которой настоящим включено полностью путем ссылки.

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Данная заявка содержит перечень последовательностей в формате ASCII и настоящим включена полностью путем ссылки. ASCII текстовый файл был создан 9 июня 2014 г., под названием GNE-0413WO_SL.txt и имеет размер 67,909 байт.

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

В данном документе предложены анти-FcRH5 антитела (например, биспецифические антитела) и их иммуноконъюгаты и способы их использования.

УРОВЕНЬ ТЕХНИКИ

Fc рецептороподобный 5 (FcRL5, также известный как FcRH5 и IRTA2) относится к семейству 6 недавно идентифицированных генов суперсемейства имуноглобулинов (IgSF). Это семейство генов тесно связано с Fc рецепторами с консервативной геномной структурой, внеклеточной Ig доменной композицией и ITIM- и ITAM-подобными сигнальными фрагментами (Davis RS et al., Еur J Immunol (2005) 35:674-80). Члены данного семейства также называли IFGPs (из Ig суперсемейства, FcR, gp42) и SPAPs (SH2 доменсодержащие фосфатазы и якорные белки). Было описано шесть членов FcRH/IRTA рецепторного семейства: FcRH1/IRTA5, FcRH2/IRTA4, FcRH3/IRTA3, FcRH4/IRTA1, FcRH5/IRTA2 и FcRH6 (Polson AG et al., Int. Immunol. (2006) 18(9):1363-1373). Все FcRH/IRTAs содержат некоторую комбинацию канонических иммунорецепторных тирозиновых фрагментов и ‘иммунорецепторных тирозиновых активирующих фрагментоподобных’ сигнальных фрагментов. FcRH кДНК кодируют трансмембранные гликопротеины типа I с несколькими Ig-подобными внеклеточными доменами и цитоплазматическими доменами, содержащими консенсусные иммунорецепторные тирозиновые активирующие и/или ингибирующие сигнальные фрагменты. FcRH гены структурно связаны и их белковые продукты имеют 28-60% внеклеточной идентичности друг с другом. Они также имеют 15-31% идентичность с их ближайшими FcR родственниками. Это представляет собой высокую степень гомологии между двумя различными FcRHs.

Лиганд(ы) для FcRH5 неизвестны, но FcRH5 было вовлечено в повышенную пролиферацию и нижнюю изотипную экспрессию во время роста антиген-примированных B-клеток (Dement-Brown J. et al.J Leckoc Biol (2012) 91:59-67). FcRH5 очаг имеет три основные иРНК изоформы (FcRH5a, FcRH5b, и FcRH5c). Основные FcRH5 белковые изоформы, кодированные этими транскриптами, имеют общую аминокислотную последовательность до остатка 560, характеризующую общий сигнальный пептид, и шесть внеклеточных Ig-подобных доменов. FcRH5a представляет собой 759 аминокислоту, секретирующую гликопротеин с восемью Ig-подобными доменами с последующими 13 уникальными, в основном полярными, аминокислотами на его C-конце. FcRH5b отличается от FcRH5a на аминокислотном остатке 560 и проходит на короткое расстояние из 32 дополнительных остатков, гидрофобность которых совместима с их стыковкой с мембраной плазмы через GPI якорь. FcRH5c является наиболее длинной изоформой, последовательность которой отличается от FcRH5a на аминокислоте 746. FcRH5c кодирует 977 aa типа I трансмембранный гликопротеин с девятью внеклеточными доменами Ig-типа, укрывая восемь потенциальных N-связанных сайтов гликозилирования, 23 аминокислотную трансмембрану и 104 аминокислотный цитоплазмический домен с тремя консенсусными SH2 связывающими фрагментами с ITIM консенсусом.

FcRH гены объединены в кластеры среди классических FcR генов, FcγRI, FcγRII, FcγRIII, и FcεRI, в 1q21-23 участок хромосома 1. Данный участок содержит 1 из наиболее часто встречающихся вторичных хромосомных аномалий, связанных со злокачественным фенотипом в гематопоэтических опухолях, в особенности в множественной миеломе (Hatzivassiliou G.et al.Immunity (2001) 14:277-89). FcRH5 экспрессируется только в B-последовательности клеточных поколений, начиная еще как пре-B-клетки, но не достигает полной экспрессии до зрелой B-клеточной стадии. В отличие от наиболее известных других B-клеточноспецифичных поверхностных белков (например, CD20, CD19, и CD22), FcRH5 продолжает экспрессироваться в плазмацитах, в то время как другие B-клеточноспецифичные маркеры негативно регулируются (Polson AG et al., Int Immunol (2006) 18:1363-73). Дополнительно, FcRH5 иРНК чрезмерно экспрессируется в клеточных линиях множественной миеломы с 1q21 аномалиями, как детектировано олигонуклеотидными матрицами (Inoue J., Am J Pathol (2004) 165:71-81). Конфигурация экспрессии указывает на то, что FcRH5 может быть мишенью для терапии на основе антител для лечения множественной миеломы. Множественная миелома представляет собой злокачественность плазмацитов, характеризующуюся поражениями скелетной структуры, почечной недостаточностью, анемией и гиперкальциемией. Она существенно неизлечима существующими терапевтическими агентами. Современные лекарственные терапии множественной миеломы включают комбинации протеосомного ингибитора бортезомиба (Велкад), иммуномодулятора леналидомида (Ревлимид), и стероида дексаметазона.

Терапии FcRH5c специфичными антителами и способы детекции могут быть особенно эффективными, поскольку они специфично распознают клетку-мишень, мембрана-ассоциированные FcRH5, скорее чем антитела, распознающие как растворимые, так и мембранные изоформы FcRH5. Однако, только последний Ig-подобный домен FcRH5 (Ig-подобный домен 9) является уникальным внеклеточным участком, который отличается у трех основных изоформ FcRH5, и существует значительная гомология между Ig-подобными доменами внутри FcRH5. Дополнительно, последний Ig-подобный домен является высококонсервативным среди FcRH1, FcRH2, FcRH3, и FcRH5. Любая терапия на основе антител, которая специфично направлена на FcRH5, должна будет иметь минимальную перекрестную реактивность с другими FcRHs во избежание эффектов не обнаружения мишени (например, FcRH3 экспрессируются на нормальных NK клетках). В данной области существует потребность в агентах, которые способствуют диагностике и лечению рака, таких как FcRH5-ассоциированный рак.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

В данном документе предложены анти-FcRH5 антитела, включая биспецифические антитела, иммуноконъюгаты, и способы их использования. В данном документе предложены выделенные анти-FcRH5 антитела, связывающие изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит Ig-подобный домен 9. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 743-850 SEQ ID №:1.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:38, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:62, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:86; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:2, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:14, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:26. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:50, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:74, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:98.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:39, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:63, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:87; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:3, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:15, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:27. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:51, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:75, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:99.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:40, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:64, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:88; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:4, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:16, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:28. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:52, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:76, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:100.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:41, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:65, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:89; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:5, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:17, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:29. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:53, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:77, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:101.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:42, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:66, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:90; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:6, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:18, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:30. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:54, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:78, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:102.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:43, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:67, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:91; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:7, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:19, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:31. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:55, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:79, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:103.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:44, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:68, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:92; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:8, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:20, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:32. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:56, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:80, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:104.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:45, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:69, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:93; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:9, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:21, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:33. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:57, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:81, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:105.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:46, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:70, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:94; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:10, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:22, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:34. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:58, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:82, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:106.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:47, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:71, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:95; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:11, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:23, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:35. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:59, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:83, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:107.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:48, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:72, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:96; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:12, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:24, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:36. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:60, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:84, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:108.

В некоторых вариантах реализации изобретения, антитело содержит: a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:49, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:73, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:97; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:13, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:25, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:37. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:61, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:85, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:109.

В некоторых вариантах реализации изобретения любого из антител, антитело содержит: a) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:111 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №: 110; b) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:113 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:112; c) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:115 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:114; d) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:117 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:116; e) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:119 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:118; f) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:121 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:120; g) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:123 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:122; h) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:125 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:124; i) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:127 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №: 126; j) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:129 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:128; k) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:131 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:130; l) VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:133 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:132; или VH последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:135 и/или VL последовательность, имеющую по меньшей мере 95% идентичность последовательности к аминокислотной последовательности SEQ ID №:134.

В некоторых вариантах реализации изобретения любого из антител, антитело содержит: a) VH последовательность SEQ ID №:111 и/или VL последовательность SEQ ID №:110; b) VH последовательность SEQ ID №:113 и/или VL последовательность SEQ ID №:112; c) VH последовательность SEQ ID №:115 и/или VL последовательность SEQ ID №:114; d) VH последовательность SEQ ID №:117 и/или VL последовательность SEQ ID №:116; e) VH последовательность SEQ ID №:119 и/или VL последовательность SEQ ID №:118; f) VH последовательность SEQ ID №:121 и/или VL последовательность SEQ ID №:120; g) VH последовательность SEQ ID №:123 и/или VL последовательность SEQ ID №:122; h) VH последовательность SEQ ID №:125 и/или VL последовательность SEQ ID №:124; i) VH последовательность SEQ ID №:127 и/или VL последовательность SEQ ID №:126; j) VH последовательность SEQ ID №:129 и/или VL последовательность SEQ ID №:128; k) VH последовательность SEQ ID №:131 и/или VL последовательность SEQ ID №:130; l) VH последовательность SEQ ID №:133 и/или VL последовательность SEQ ID №:132, или m) VH последовательность SEQ ID №:135 и/или VL последовательность SEQ ID №:134.

В некоторых вариантах реализации изобретения любого из антител, антитело является моноклональным антителом. В некоторых вариантах реализации изобретения любого из антител, антитело является человеческим, гуманизированным или химерным антителом. В некоторых вариантах реализации изобретения любого из антител, антитело представляет собой фрагмент антитела, связывающий FcRH5. В некоторых вариантах реализации изобретения любого из антител, антитело является IgG1, IgG2a или IgG2b антителом.

В некоторых вариантах реализации изобретения любого из антител, антитело имеет одну или более из следующих характеристик: a) перекрестную реактивность с полноразмерным человеческим FcRH5 и FcRH5 макак, b) не имеет перекрестной реактивности с FcRH1, FcRH2, FcRH3, и/или FcRH4, c) связывает эндогенный FcRH5, d) не имеет перекрестной реактивности с FcRH5a, и e) не имеет перекрестной реактивности с другим Ig-подобным доменом FcRH5.

В некоторых вариантах реализации изобретения любого из антител, антитело является биспецифическим антителом. В некоторых вариантах реализации изобретения, биспецифическое антитело связывает FcRH5 и CD3.

В некоторых вариантах реализации изобретения, предложена выделенная нуклеиновая кислота, кодирующая антитело, описанное в данном документе. В некоторых вариантах реализации изобретения, описана клетка-хозяин, содержащая нуклеиновую кислоту. В некоторых вариантах реализации изобретения, описан способ получения антитела, описанного в данном документе. В некоторых вариантах реализации изобретения, способ включает культивирование клетки-хозяина, содержащей нуклеиновую кислоту, кодирующую антитело.

В некоторых вариантах реализации изобретения, описаны иммуноконъюгаты. В некоторых вариантах реализации изобретения, иммуноконъюгат содержит анти-FcRH5 антитело и цитотоксический агент. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитела связывает Ig-подобный домен 9 FcRH5c. В некоторых вариантах реализации изобретения, иммуноконъюгат имеет формулу Ab-(L-D)p, в которой: (a) Ab представляет собой антитело, описанное в данном документе; (b) L представляет собой линкер; (c) D представляет собой лекарственное средство, выбранное из майтансиноида, ауристатина, калихеамина, пирролобензодиазепина, и производного неморубицина; и (d) p находится в диапазоне 1-8. В некоторых вариантах реализации изобретения, D представляет собой ауристатин. В некоторых таких вариантах реализации изобретения, D имеет формулу DΕ

DE

где каждый R2 и R6 представляет собой метил, каждый R3 и R4 представляет собой изопропил, R5 представляет собой Н, R7 представляет собой втор-бутил, каждый R8 независимо выбран из CH3, O-CH3, OH, и Н; R9 представляет собой Н; и R18 представляет собой -C(R8)2-C(R8)2-арил. В некоторых вариантах реализации изобретения, D представляет собой MMAE со структурой:

.

В некоторых вариантах реализации изобретения, D представляет собой пирролобензодиазепин Формулы A:

A;

где пунктирные линии указывают на необязательное присутствие двойной связи между C1 и С2 или С2 и С3; R2 независимо выбран из H, OH, =O, =CH2, CN, R, OR, =CH-RD, =C(RD)2, O-SO2-R, CO2R и СOR, и необязательно дополнительно выбран из галогена или дигалогена, где RD независимо выбран из R, CO2R, COR, CHO, CO2H, и галогена; R6 и R9 независимо выбраны из Н, R, OH, OR, SH, SR, NH2, NHR, NRR’, NO2, Me3Sn и галогена; R7 независимо выбран из H, R, OH, OR, SH, SR, NH2, NHR, NRR’, NO2, Me3Sn и галогена; Q независимо выбран из O, S и NH; R11 представляет собой либо H, либо R или, если Q представляет собой О, SO3M, где M представляет собой катион металла; R и R’ каждый независимо выбран из независимо замещенных C1-8 алкильной, C1-12 алкильной, C3-8 гетероциклильной, C3-20 гетероциклильной, и С5-20 арильной групп, и необязательно в отношении группы NRR’, R и R’ вместе с атомом азота, к которому они прикреплены, образуют необязательно замещенное 4-, 5-, 6- или 7-членное гетероциклическое кольцо; R12, R16, R19 и R17 являются такими, как определено для R2, R6, R9 и R7 соответственно; R″ представляет собой С3-12 алкиленовую группу, цепь которой может быть прервана одним или более гетероатомами и/или ароматическими кольцами, которые необязательно замещены; и X и Х’ независимо выбраны из O, S и N(H). В некоторых таких вариантах реализации изобретения, D представляет собой

;

где n представляет собой 0 или 1.

В некоторых вариантах реализации изобретения, D представляет собой производное неморубицина. В некоторых вариантах реализации изобретения, D имеет структуру, выбранную из:

; и

.

В некоторых вариантах реализации изобретения, иммуноконъюгат cодержит линкер, расщепляемый протеазой. В некоторых вариантах реализации изобретения, линкер содержит val-cit дипептид или Phe-homoLys дипептид. В некоторых вариантах реализации изобретения, иммуноконъюгат содержит линкер, который является кислото-лабильным. В некоторых таких вариантах реализации изобретения, линкер содержит гидразон.

В некоторых вариантах реализации изобретения, иммуноконъюгат имеет формулу, выбранную из:

где S представляет собой атом серы;

;

;

;

;

;

; и

.

В некоторых вариантах реализации изобретения, p находится в диапазоне 2-5.

В некоторых вариантах реализации изобретения, описаны фармацевтические композиции. В некоторых таких вариантах реализации изобретения, фармацевтическая композиция содержит иммуноконъюгат, содержащий антитело, связывающее FcRH5, например, как описано в данном документе. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c. В некоторых вариантах реализации изобретения, фармацевтическая композиция дополнительно содержит дополнительный терапевтический агент.

В некоторых вариантах реализации изобретения, описаны способы лечения субъектов, имеющих виды FcRH5 (например, FcRH5c)-позитивного рака. В некоторых таких вариантах реализации изобретения, способ включает введение фармацевтической композиции, содержащей иммуноконъюгат, содержащий антитело, связывающее FcRH5 и/или FcRH5 биспецифическое антитело, например, как описано в данном документе. В некоторых вариантах реализации изобретения, FcRH5 биспецифическое антитело содержит FcRH5 связывающее плечо и CD3 связывающее плечо. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитела связывает Ig-подобный домен 9 FcRH5c. В некоторых вариантах реализации изобретения, FcRH5-позитивный рак представляет собой B-клеточное пролиферативное расстройство. В некоторых вариантах реализации изобретения, FcRH5-позитивный рак представляет собой неоплазм плазмацита. В некоторых вариантах реализации изобретения, неоплазм плазмацита представляет собой множественную миелому. В некоторых вариантах реализации изобретения, способ включает введение дополнительного терапевтического агента субъекту.

В некоторых вариантах реализации изобретения предложены способы ингибирования пролиферации FcRH5 (например, FcRH5c)-позитивной клетки. В некоторых вариантах реализации изобретения, способ включает воздействие на клетку иммуноконъюгата, содержащего антитело, связывающее FcRH5 и/или FcRH5 биспецифическое антитело при условиях, разрешающих связывание антитела и FcRH5 на поверхности клетки. В некоторых вариантах реализации изобретения, FcRH5 биспецифическое антитело содержит FcRH5 связывающее плечо и CD3 связывающее плечо. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитела связывают Ig-подобный домен 9 FcRH5c. В некоторых вариантах реализации изобретения, антитело, связывающее FcRH5 представляет собой антитело, описанное в данном документе. В некоторых вариантах реализации изобретения, FcRH5-позитивный рак представляет собой B-клеточное пролиферативное расстройство. В некоторых вариантах реализации изобретения, FcRH5-позитивный рак представляет собой неоплазм плазмацита. В некоторых вариантах реализации изобретения, неоплазм плазмацита представляет собой множественную миелому. В некоторых вариантах реализации изобретения, способ включает введения дополнительного терапевтического агента субъекту.

В некоторых вариантах реализации изобретения, антитело, связывающее FcRH5, конъюгировано с меткой. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c. В некоторых вариантах реализации изобретения, антитело, связывающее FcRH5, представляет собой антитело, описанное в данном документе. В некоторых вариантах реализации изобретения, метка представляет собой излучатель позитронов. В некоторых вариантах реализации изобретения, излучатель позитронов представляет собой 89Zr.

В некоторых вариантах реализации изобретения, предложен способ детекции челевеческого FcRH5 в биологическом образце. В некоторых вариантах реализации изобретения, способ включает приведение в контакт биологического образца с анти-FcRH5 антителом в условиях, разрешающих связывание анти-FcRH5 антитела с природно встречающимся человеческим FcRH5, и детекцию того, образуется ли комплекс между анти-FcRH5 антителом и природно встречающимся человеческим FcRH5 в биологическом образце. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитела связывают Ig-подобный домен 9 FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело представляет собой антитело, описанное в данном документе.

В некоторых вариантах реализации изобретения, описан способ детекции FcRH5-позитивного рака. В некоторых таких вариантах реализации изобретения, способ включает (i) введение меченого анти-FcRH5 антитела субъекту, имеющему или подозреваемому в том, что он имеет FcRH5-позитивный рак, и (ii) детекцию меченого анти-FcRH5 антитела у субъекта, где детекция меченого анти-FcRH5 антитела указывает на FcRH5-позитивный рак у субъекта. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело представляет собой антитело описанное в данном документе.

КРАТКОЕ ОПИСАНИЕ ФИГУР

ФИГ. 1(A) иллюстрирует три основные изоформы FcRH5, FcRH5a (IRTA2a; UniProt Identifier Q96RD9-3), FcRH5b (IRTA2b; UniProt Identifier Q96RD9-4), и FcRH5c (IRTA2c; UniProt Identifier Q96RD9-1). Ig-подобные домены пронумерованы и соответствуют аминокислотной последовательности UniProt Identifier Q69RD9-1 (SEQ ID №:1): Ig-подобный домен 1 (aa ("аминокислота") 23-100), Ig-подобный домен 2 (aa 105-185), Ig-подобный домен 3 (aa 188-271), Ig-подобный домен 4 (287-373), Ig-подобный домен 5 (aa 380-466), Ig-подобный домен 6 (aa 490-555), Ig-подобный домен 7 (aa 568-652), Ig-подобный домен 8 (aa 658-731), и Ig-подобный домен 9 (aa 754-835). ФИГ. 1(B) обозначает часть FcRH5 (SEQ ID №:136) и структуру и гомологию cRH5 аминокислот 735 - 977 FcRH5c (SEQ ID №:2).

ФИГ. 2 иллюстрирует связывание FcRH5 антител и SVT2 клеток, трансфецированных (A) человеческим FcRH5 и (B) FcRH5 макак, в разных концентрациях.

ФИГ. 3 иллюстрирует связывание FcRH5 антитела с (A) EJM клетками или (B) OPM2 клетками, трансфецированными человеческим FcRH5, и связывание субклональных супернатантов (C) 5A10.1, (D) 5F1.1, (E) 3G7.1, и(F) 6D2.2 с MOLP2 клетками, экспрессирующими FcRH5 эндогенно.

ФИГ. 4 иллюстрирует (A) связывание FcRH5 субклональных супернатантов и 293 клеток, трансфецированных ДТ или (B) мутантных FcRH5 с делецией 4 мембранных проксимальных внеклеточных доменов.

ФИГ. 5 иллюстрирует связывание (A) FcRH5 антител и FcRH5a при помощи ELISA, и (B) связывание субклональных супернатантов и человеческих B клеток.

ФИГ. 6 иллюстрирует связывание FcRH5 субклональных супернатантов и SVT2 клеток, трансфецированных (A) FcRH1, (B) FcRH2, (C) FcRH3, или (D) FcRH4.

ФИГ. 7 иллюстрирует связывание субклональных супернатантов FcRH5 антитела и NK клеток.

ФИГ. 8 иллюстрирует (A) лизисную активность FcRH5 bisFabs, FcRH5-TDB (клон 10A8) и (B) HER2-TDB и (C) лизисную активность FcRH5-bisFabs и (D) FcRH5-TDBs на FcRH5 трансфецированных 293 клетках.

ФИГ. 9 иллюстрирует (A) лизисную активность и (B) T-клеточную активацию FcRH5 bisFabs и FcRH5-TDBs на MOLP-2 клетках.

ПОДРОБНОЕ ОПИСАНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

ОПРЕДЕЛЕНИЯ

Термин “FcRH5,” как используют в данном документе, относится к любому нативному, зрелому FcRH5, полученному в результате обработки FcRH5 белка-предшественника в клетке. Термин включает FcRH5 из любого источника из позвоночных, включая млекопитающих, таких как приматы (например люди и яванские макаки) и грызуны (например, мыши и крысы), если не указано иное. Термин также включает природно встречающиеся варианты FcRH5, например, варианты стыковок или аллельные варианты. В некоторых вариантах реализации изобретения, аминокислотные последовательности человеческого FcRH5 белка представляют собой FcRH5a (IRTA2a; UniProt Identifier Q96RD9-3; 759 aa), FcRH5b (IRTA2b; UniProt Identifier Q96RD9-4; 592 aa), FcRH5c (IRTA2c; UniProt Identifier Q96RD9-1; 977 aa (SEQ ID №:1), UniProt Identifier Q96RD9-2 (124 aa), и/или FcRH5d (IRTA2d; UniProt Identifier Q96RD9-5; 152 aa).

Термин "гликозилированные формы FcRH5" относится к природным формам, которые FcRH5 посттрансляционно модифицированы добавлением углеводных остатков.

"Процент (%)идентичности аминокислотных последовательностей" по отношению к реперным полипептидным последовательностям определяется как процент аминокислотных остатков в кандидатной последовательности, которые идентичны аминокислотным остаткам в реперной полипептидной последовательности после выравнивания последовательностей и введения гэпов, если необходимо, для достижения максимального процента идентичности последовательностей, и не учитывает какие-либо консервативные замещения как часть идентичности последовательностей. Выравнивание в целях определения процента идентичности аминокислотной последовательности может быть достигнуто различными способами, которые находятся в пределах компетенции специалиста в данной области, например, с использованием общедоступной компьютерной программы, такой как BLAST, BLAST-2, ALIGN или программного обеспечения Megalign (DNASTAR). Специалисты в данной области могут определить соответствующие параметры для выравнивания последовательностей, включая любые алгоритмы, необходимые для достижения максимального выравнивания по всей длине сравниваемых последовательностей. Для целей настоящего изобретения, однако, значения % идентичности аминокислотных последовательностей генерируют с использованием компьютерной программы сравнения последовательностей ALIGN-2. Компьютерная программа сравнения последовательностей ALIGN-2 была создана Genentech, Inc., и исходный код был подан с документацией пользователя в U.S. Copyright Office, Washington DC, 20559, где он зарегистрирован под регистрацией авторских прав США № TXU510087. Программа ALIGN-2 является общедоступной от Genentech, Inc., South San Francisco, California, или может быть составлена из исходного кода. Программа ALIGN-2 должна быть скомпилирована для использования на операционной системе UNIX, в том числе цифровой UNIX V4.0D. Все параметры сравнения последовательностей установлены программой ALIGN-2 и не изменяются.

В тех случаях, когда используют ALIGN-2 для сравнения аминокислотных последовательностей, % идентичности аминокислотных последовательности данной аминокислотной последовательности A по сравнению или по отношению к указанной аминокислотной последовательности B (которую в качестве альтернативы можно выразить как данную аминокислотную последовательность А, которая имеет или содержит определенный % идентичности аминокислотной последовательности к, с, или в отношении данной аминокислотной последовательности B) рассчитывают следующим образом:

Умножают на 100 фракцию Х/Y, где Х представляет собой количество аминокислотных остатков, оценивали как идентичные совпадения при помощи программы выравнивания последовательности ALIGN-2 в данном программном выравнивании А и В, и где Y представляет общее количество аминокислотных остатков в B. Следует иметь в виду, что, когда длина аминокислотной последовательности A не равна длине аминокислотной последовательности В, % идентичности аминокислотной последовательности А к В не будет равен % идентичности аминокислотной последовательности В к А. Если специально не указано иное, все значения % идентичности аминокислотных последовательностей, используемые в данном документе, получены, как описано в предыдущем параграфе, используя компьютерную программу ALIGN-2.

Термины "анти FcRH5-антитело" и "антитело, связывающее FcRH5" относятся к антителу, способному связываться с FcRH5 с достаточной аффинностью, таким образом, что антитело является полезным в качестве диагностического и/или терапевтического средства для целенаправленного воздействия на FcRH5. В одном варианте реализации изобретения степень связывания анти-FcRH5 антитела и несвязанного не-FcRH5 белка, составляет менее чем приблизительно 10% связывания антитела и FcRH5, как измерено, например, с помощью радиоиммуноанализа (RIA). В некоторых вариантах реализации изобретения антитело, связывающее FcRH5, имеет константу диссоциации (Kd) ≤ 1мкM, ≤ 100 нM, ≤ 10 нM, , ≤ 5 Нм, , ≤ 4 нM, , ≤ 3 нM, , ≤ 2 нM, ≤ 1 нM, ≤ 0,1 нM, ≤ 0,01 нM, или ≤ 0,001 нM (например, 10-8 M или менее, например от 10-8 M до 10-13 M, например, от 10-9 M до 10-13 M). В некоторых вариантах реализации изобретения анти-FcRH5 антитело связывается с эпитопом FcRH5, который является консервативным FcRH5 из различных видов. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывается с Ig-подобным доменом 9 FcRH5c.

Термин "антитело" используется в данном документе в самом широком смысле и он охватывает различные структуры антител, в том числе, но не ограничиваясь приведенным, моноклональные антитела, поликлональные антитела, мультиспецифические антитела (например, биспецифические антитела) и фрагменты антител, пока они проявляют желаемую антигенсвязывающую активность.

Термин " фрагмент антитела" относится к молекуле, отличной от интактного антитела, содержащей часть интактного антитела и связывающей антиген, с которым связывается интактное антитело. Примеры фрагментов антитела включают, но не ограничиваются ими, Fv, Fab, Fab', Fab’-SH, F(ab')2; диатело; линейные антитела; молекулы одноцепочечных антител (например, ScFv); и мультиспецифические антитела, образованные из фрагментов антител.

Термин "эпитоп" относится к конкретному сайту на молекуле антигена, с которым связывается антитело.

Термин "антитело, которое связывается с тем же эпитопом" в качестве реперного антитела, относится к антителу, блокирующему связывание реперного антитела с его антигеном в конкурентном анализе на 50% или более, и наоборот, реперное антитело блокирует связывание антитела с его антигеном в конкурентном анализе на 50% или более. Иллюстративный конкурентный анализ представлен в данном документе.

Термин "моноклональное антитело", как используют в данном документе, относится к антителу, которое получают из популяции по существу гомогенных антител, т.е., отдельные антитела, содержащие популяцию, являются идентичными и/или связывают тот же эпитоп, кроме возможного варианта антител, за исключением, например, содержащих природные мутации или возникающие во время процесса производства препарата моноклональных антител, такие варианты обычно присутствуют в незначительных количествах. В отличие от препаратов поликлональных антител, которые обычно включают различные антитела, направленные против различных детерминант (эпитопов), каждое моноклональное антитело препарата моноклонального антитела, направленного против одной детерминанты на антигене. Таким образом, определение «моноклональное» указывает на характер антитела, как полученного из по существу гомогенной популяции антител, и не должно быть истолковано как требующее получения антител любым конкретным способом. Например, моноклональные антитела, которые будут использованы в соответствии с настоящим изобретением, могут быть изготовлены различными методами, в том числе, но не ограничиваясь приведенным, гибридомным методом, методами рекомбинантной ДНК, методами фаговой индикации, а также методами, использующими трансгенных животных, содержащих все или часть локусов человеческого иммуноглобулина, такие методы и другие иллюстративные способы получения моноклональных антител описаны в данном документе.

Термины "полноразмерное антитело", "интактное антитело" и "цельное антитело" используют в данном документе взаимозаменяемо для обозначения антитела, имеющего структуру, по существу, подобную нативной структуре антитела или имеющего тяжелые цепи, которые содержат Fc участок, как определено в данном документе.

"Голое антитело" относится к антителу, не конъюгированному с гетерологичным фрагментом (например, цитотоксическим фрагментом) либо меченым радиоактивной меткой. Голое антитело может присутствовать в фармацевтической композиции.

"Нативные антитела" относятся к природным молекулам иммуноглобулина с различными структурами. Например, нативные антитела IgG представляют собой гетеротетрамерные гликопротеины приблизительно 150,000 дальтон, состоящие из двух одинаковых легких цепей и двух идентичных тяжелых цепей, которые связаны дисульфидными мостиками. От N- до С-конца, каждая тяжелая цепь имеет вариабельный участок (VH), также называемый вариабельным тяжелым доменом или вариабельным доменом тяжелой цепи, с последующими тремя константными доменами (CH1, CH2, и СH3). Аналогичным образом, от N- до С-конца, каждая легкая цепь имеет вариабельный участок (VL), также называемый вариабельным легким доменом или вариабельным доменом легкой цепи, с последующим константным легким доменом (CL). Легкая цепь антитела может быть отнесена к одному из двух типов, называемых каппа (κ) и лямбда (λ), на основе аминокислотной последовательности ее константного домена.

Термин "химерное" антитело относится к антителу, в котором часть тяжелой и/или легкой цепи получают из конкретного источника или видов, в то время как остальная часть тяжелой и/или легкой цепи получена из другого источника или видов.

"Человеческое антитело" является таким, которое обладает аминокислотной последовательностью, которая соответствует антителу, полученному в организме человека или клетке человека или полученному из нечеловеческого источника, который использует репертуар человеческих антител или другие последовательности, кодирующие человеческое антитело. Это определение человеческого антитела специально исключает гуманизированное антитело, содержащее нечеловеческие антигенсвязывающие остатки.

"Гуманизированное" антитело относится к химерному антителу, содержащему аминокислотные остатки из нечеловеческих HVR и аминокислотных остатков из человеческих FRs. В некоторых вариантах реализации изобретения гуманизированное антитело будет существенно содержать все из по меньшей мере одного, и как правило двух вариабельных доменов, в которых все или по существу все из HVR (например, CDR) соответствуют таковым не-человеческого антитела, и все или по существу, все FRs соответствуют таковым в человеческого антителе. Гуманизированное антитело необязательно может содержать по меньшей мере часть константного участка антитела, полученного из человеческого антитела. "Гуманизированная форма" антитела, например, не-человеческое антитело, относится к антителу, которая прошло гуманизацию.

"Класс" антитела относится к типу константного домена или константного участка, который содержится в его тяжелой цепи. Существует пять основных классов антител: IgA, IgD, IgE, IgG и IgM, и некоторые из них могут быть дополнительно разделены на подклассы (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1, и IgA2. Константные домены тяжелой цепи, которые соответствуют различным классам иммуноглобулинов, называются α, δ, ε, γ, и μ, соответственно.

Термин «Fc участок» в данном документе используют для определения C-концевого участка тяжелой цепи иммуноглобулина, который содержит по меньшей мере часть константного участка. Термин включает нативную последовательность Fc участка и вариантные Fc участки. В одном варианте реализации изобретения, человеческий Fc-участок IgG тяжелой цепи простирается от Cys226, или от Pro230 к карбоксильному концу тяжелой цепи. Тем не менее, С-концевой лизин (Lys447) Fc участка может или не может присутствовать. Если в данном документе не указано иное, нумерация аминокислотных остатков в Fc участке или константном участке приведена в соответствии с системой нумерации ЕС, также называемом индексом ЕС, как описано в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.

Термин "вариабельный участок" или "вариабельный домен" относится к домену тяжелой или легкой цепи антитела, который участвует в связывании антитела с антигеном. Вариабельные домены тяжелой цепи и легкой цепи (VH и VL, соответственно) нативного антитела, как правило, имеют подобные структуры, где каждый домен содержит четыре консервативные каркасные области (FR) и три гипервариабельных участка (HVR). (См., например, Kindt et al. Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007)). Один VH или VL домен может быть достаточным для придания антиген-связывающей специфичности. Дополнительно, антитела, которые связывают конкретный антиген, могут быть выделены с использованием VH или VL домена из антитела, связывающего антиген, для скрининга библиотеки комплементарных VL или VH доменов, соответственно. См., например, Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).

"Каркасный" или "FR" относится к остаткам вариабельного домена, другим, чем остатки гипервариабельного участка (HVR). FR вариабельного домена обычно состоит из четырех доменов: FR1, FR2, FR3, и FR4. Соответственно, последовательности HVR и FR обычно появляются в следующей последовательности в VH (или VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.

"Человеческий консенсусный каркас" является каркасом, который представляет собой наиболее часто встречающиеся аминокислотные остатки при выборе человеческих иммуноглобулиновых VL или VH рамочных последовательностей. Как правило, выбор человеческих иммуноглобулиновых VL или VH последовательностей производят из подгруппы последовательностей вариабельных доменов. Как правило, подгруппа последовательностей является подгруппой, как в Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3. В одном варианте реализации изобретения для VL, подгруппа является подгруппой каппа I, как в Kabat et al., supra. В одном варианте реализации изобретения для VH, подгруппа является подгруппой III, как в Kabat et al., supra.

Термин "гипервариабельный участок" или "HVR", как используют в данном документе, относится к каждому из участков вариабельного домена антитела, которые гипервариабельны в последовательности и/или образуют структурно определенные петли ("гипервариабельные петли"). Как правило, нативные четырехцепочечные антитела включают шесть HVR; три в VH (H1, H2, H3), и три в VL (L1, L2, L3). HVR, как правило, содержат аминокислотные остатки из гипервариабельных петель и/или от «определяющих комплементарность участков" (CDR), причем последний имеет наивысшую вариабельность последовательности и/или участвует в распознавании антигена. Иллюстративные гипервариабельные петли находятся на аминокислотных остатках 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (Н1), 53-55 (Н2) и 96-101 (Н3). (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). Иллюстративные CDR (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, и CDR-H3) находятся на аминокислотных остатках 24-34 L1, 50-56 L2, 89-97 L3, 31-35B H1, 50-65 H2, и 95-102 Н3. (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991)). За исключением CDR1 в VH, CDR, как правило, содержат аминокислотные остатки, которые образуют гипервариабельные петли. CDR содержат также «специфичность-определяющие остатки", или "SDR", которые являются остатками, которые контактируют с антигеном. SDR содержатся в участках CDR, называемых сокращенно CDR, или а-CDR. Иллюстративные а-CDR, (a-CDR-L1, a-CDR-L2, a-CDR-L3, a-CDR-H1, a-CDR-H2, и a-CDR-H3) находятся на аминокислотных остатках 31-34 L1, 50-55 L2, 89-96 L3, 31-35B H1, 50-58 H2, и 95-102 H3. (См. Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)). Если не указано иное, HVR остатки и другие остатки в вариабельном домене (например, FR остатки) нумеруются в данном документе в соответствии с Kabat et al., supra.

Термин "акцепторный человеческий каркас" для целей данного изобретения является каркасом, содержащим аминокислотную последовательность вариабельного домена легкой цепи (VL) рамки или вариабельного домена тяжелой цепи (VH) каркаса, полученного из каркаса человеческого иммуноглобулина или консенсусного человеческого каркаса, как определено ниже. Акцепторный человеческий каркас "полученный из" иммуноглобулинового человеческого каркаса или консенсусного человеческого каркаса, может содержать ту же их аминокислотную последовательность, или может содержать изменения аминокислотной последовательности. В некоторых вариантах реализации изобретения, количество аминокислотных изменений 10 или менее, 9 или менее, 8 или менее, 7 или менее, 6 или менее, 5 или менее, 4 или менее, 3 или менее, или 2, или менее. В некоторых вариантах реализации изобретения, VL акцепторный человеческий каркас идентичен по последовательности VL иммуноглобулиновой человеческой каркасной последовательности или человеческой консенсусной каркасной последовательности.

"Афинность" относится к прочности общей суммы нековалентных взаимодействий между одним сайтом связывания молекулы (например, антителом) и его связывающим партнером (например, антигеном). Если не указано иное, как используют в данном документе, "аффинность связывания" относится к внутреннему сродству, которое отражает 1:1 взаимодействие между членами пары связывания (например, антителом и антигеном). Афинность молекулы X для ее партнера Y может быть в общем представлена константой диссоциации (Kd). Афинность может быть измерена обычными методами, известными в данной области техники, в том числе описанными в данном документе. Особые иллюстративные варианты реализации изобретения для измерения аффинности связывания описаны ниже.

Термин "аффинно зрелое" антитела относится к антителу с одним или несколькими изменениями в одном или более гипервариабельных участков (HVR), по сравнению с родительским антителом, которое не обладает такими изменениями, такие изменения, приводят к улучшению афинности антитела к антигену.

Термин "иммуноконъюгат" представляет собой антитело, конъюгированное с одной или более гетерологичных молекулой(ами), включая, но не ограничиваясь этим, цитотоксический агент.

Термин "цитотоксический агент" как используют в данном документе, относится к веществу, которое ингибирует или предотвращает клеточную функцию и/или вызывает гибель или разрушение клеток. Цитотоксические агенты включают, не ограничиваясь приведенным, радиоактивные изотопы (например, At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu); химиотерапевтические агенты или лекарственные средства (например, метотрексат, адриамицин, алкалоиды барвинка (винкристин, винбластин, этопозид), доксорубицин, мелфалан, митомицин C, хлорамбуцил, даунорубицин или другие интеркалирующие агенты); ингибирующие рост агенты; ферменты и их фрагменты, такие как нуклеолитические ферменты; антибиотики; токсины, такие как низкомолекулярные токсины или ферментативно активные токсины бактериального, грибного, растительного или животного происхождения, в том числе их фрагменты и/или варианты; и различные противоопухолевые или противораковые средства, описанные ниже.

"Эффекторные функции" относятся к таким биологическим активностям, которые относятся к Fc участку антитела, которые изменяются в зависимости от изотипа антитела. Примеры эффекторных функций антител включают: C1q связывание и комплемент-зависимую цитотоксичность (CDC); Fc-рецепторное связывание; антитело-зависимую клеточно-опосредованную цитотоксичность (ADCC); фагоцитоз; понижающую регуляцию рецепторов клеточной поверхности (например рецептора В-клеток); и В-клеточную активацию.

«Выделенное антитело" является антителом, отделенным от компонента его природного окружения. В некоторых вариантах реализации изобретения, антитело очищали до более чем 95% или 99% чистоты, как определено, например, электрофоретически (например, SDS-PAGE, изоэлектрическим фокусирующим (IEF), капиллярным электрофорезом) или хроматографически (например, ионообменной либо ВЭЖХ с обращенной фазой). Обзор методов оценки чистоты антитела см, например, Flatman др., J. Chromatogr. В 848: 79-87 (2007).

Термин "выделенная нуклеиновая кислота" относится к молекуле нуклеиновой кислоты, которая была отделена от компонента его природного окружения. Выделенная нуклеиновая кислота включает молекулу нуклеиновой кислоты, содержащейся в клетках, которые обычно содержат молекулу нуклеиновой кислоты, но молекула нуклеиновой кислоты присутствует вне хромосомы или хромосомного места, которое отличается от его приыродного хромосомного места.

"Выделенная нуклеиновая кислота, кодирующая анти-FcRH5 антитело" относится к одной или более молекулам нуклеиновых кислот, кодирующим тяжелые и легкие цепи антитела (или их фрагменты), в том числе такую молекулу(ы) нуклеиновой кислоты в одном векторе или отдельных векторах, и такая молекула(ы) нуклеиновой кислоты присутствует в одном или нескольких местах в клетке-хозяине.

Термин "вектор", как используют в данном документе, относится к молекуле нуклеиновой кислоты, способной репродуцировать другую нуклеиновую кислоту, с которой она связана. Термин включает вектор как самореплицирующуюся структуру нуклеиновой кислоты, а также вектор, включенный в геном клетки-хозяина, в который он был введен. Некоторые векторы способны регулировать экспрессию нуклеиновых кислот, с которыми они функционально связаны. Такие векторы называют в данном документе "экспрессирующими векторами".

Термины "клетка-хозяин", "линия клетки-хозяина" и "культура клетки-хозяина" используются как взаимозаменяемые и относятся к клеткам, в которые введена экзогенная нуклеиновая кислота, в том числе потомству таких клеток.

Клетки-хозяева включают "трансформанты" и "трансформированные клетки", которые включают первичную трансформированную клетку и потомство, полученное из нее независимо от числа проходов. Потомство не может быть полностью идентичным родительской клетке по содержанию нуклеиновых кислот, но может содержать мутации. Мутантное потомство, которое имеет ту же функцию или биологическую активность, по результатам скрининга или выбранные для первоначально трансформированной клетки в данном документе.

Как используют в данном документе, термин "лечение" (и его грамматические варианты, например, "лечить") относится к клиническому вмешательству в попытке изменить естественное развитие заболевания субъекта, которого лечат, и может быть выполнено либо для профилактики, либо в ходе клинической патологии. Желательные эффекты лечения включают, не ограничиваясь приведенным, предотвращение возникновения либо рецидива заболевания, облегчение симптомов, облегчение каких-либо прямых или косвенных патологических последствий заболевания, предотвращение метастазирования, снижение скорости прогрессирования заболевания, улучшение или временное облегчение состояния заболевания , и ремиссию или улучшение прогноза. В некоторых вариантах реализации изобретения, предложенные в данном документе антитела используют, чтобы задержать развитие заболевания или замедлить прогрессирование заболевания.

Термины "рак" и "раковый" относятся или описывают физиологическое состояние у млекопитающих, которое обычно характеризуется неконтролируемым ростом/пролиферацией клеток. Примеры видов рака включают, не ограничиваясь приведенным, карциному, лимфому (например, лимфому Ходжкина и неходжкинскую лимфому), бластому, саркому и лейкемию. Более конкретные примеры таких раковых заболеваний включают плоскоклеточный рак, мелкоклеточный рак легких, немелкоклеточный рак легких, аденокарциному легкого, плоскоклеточный рак легких, рак брюшины, гепатоцеллюлярный рак, рак желудочно-кишечного тракта, рак поджелудочной железы, глиому, рак шейки матки, рак яичников, рак печени, рак мочевого пузыря, гепатому, рак молочной железы, рак толстой кишки, рак неразветвленному кишки, мелкоклеточный рак кишечника, рак эндометрия или матки, карциному слюнных желез, рак почек, рак печени, рак предстательной железы, рак, относящийся к наружным женским половым органам, рак щитовидной железы, карциному печени, лейкемию и другие лимфопролиферативные нарушения, а также различные виды рака головы и шеи.

"В-клеточная злокачественность" в данном документе включает неходжкинскую лимфому (NHL), в том числе недоброкачественную/фолликулярную NHL, мелкоклеточную лимфоцитарную (SL) NHL, промежуточную/фолликулярную NHL, промежуточную диффузную NHL, высокозлокачественную иммунобластную NHL, высокозлокачественную лимфобластную NHL, высокозлокачественную NHL типа Беркитта, генерализованную NHL, лимфому клеток зоны мантии, лимфому, связанную со СПИДом, и макроглобулинемию Вальденстрема, неходжкинскую лимфому (NHL), лимфому Ходжкина с лимфоцитарным преобладанием (LPHD), мелкоклеточную лимфоцитарную лимфому (SLL), хронический лимфолейкоз (CLL), вялотекущую NHL, включая рецидивную вялотекущую NHL и ритуксимаб-резистентную вялотекущую NHL; лейкемию, в том числе острый лимфобластный лейкоз (ALL), хронический лимфолейкоз (CLL), волосатоклеточный лейкоз, хронический миелобластный лейкоз; лимфому клеток зоны мантии; и другие гематологические злокачественные заболевания. Такие злокачественные опухоли могут быть вылечены антителами, направленными против поверхностных В-клеточных маркеров, таких как FcRH5 (например, FcRH5c). Такие заболевания рассматриваются в настоящем документе для лечения путем введения антитела, направленного против поверхностного В-клеточного маркера, такого как FcRH5 (например, FcRH5c), и лечение включает введение неконъюгированного ("голого") антитела или антитела, конъюгированного с цитотоксическим агентом, как описано в данном документе. Такие заболевания также рассматриваются в настоящем документе для лечения комбинированной терапией, включая анти-FcRH5 антитело (в том числе FcRH5 биспецифическое антитело) или конъюгат анти-FcRH5 антитела с лекарственным средством в комбинации с другим антителом или конъюгатом антитела с лекарственным средством, другим цитотоксическим агентом, облучением или другим лечением, введенными одновременно или последовательно.

Термин "неходжкинская лимфома" или "NHL", как используют в данном документе, относится к раку лимфатической системы, кроме лимфом Ходжкина. Лимфомы Ходжкина обычно можно отличить от неходжкинских лимфом по присутствию клеток Рида-Штернберга в лимфомах Ходжкина и отсутствию указанных клеток в неходжкинских лимфомах. Примеры неходжкинских лимфом, охватываемые данным термином, как используют в данном документе, включают любые лимфомы, которые будут определены в качестве таковых специалистами в данной области (например, онкологом или патологом) в соответствии со схемами классификаций, известными в данной области, такими как Revised ЕСropean-American Lymphoma (REAL) схема, как описано в Color Atlas of Clinical Hematology (3rd edition), A. Victor Hoffbrand and John E. Pettit (eds.) (Harcourt Publishers Ltd., 2000). См., в частности, списки на ФИГ. 11.57, 11.58 и 11.59. Более конкретные примеры включают, не ограничиваясь приведенным, рецидивные либо резистентные NHL, пограничные недоброкачественные NHL, NHL стадии III/IV, резистентные к химиотерапии NHL, лимфобластный лейкоз и/или лимфому предшественников B-клеток, мелкоклеточную лимфоцитарную лимфому, В-клеточный хронический лимфолейкоз и/или пролимфоцитарный лейкоз и/или мелкоклеточную лимфоцитарную лимфому, В-клеточную пролимфоцитарную лимфому, иммуноцитому и/или лимфоплазмацитарную лимфому, лимфоплазмацитарную лимфому, В-клеточную лимфому маргинальной зоны, лимфому маргинальной зоны селезенки, нефолликулярную MALT лимфому маргинальной зоны, узловую лимфому маргинальной зоны, волосатоклеточную лейкемию, плазмоцитому и/или плазмаклеточную миелому, высокодифференцированную/фолликулярную лимфому, промежуточную/фолликулярную NHL, лимфому клеток зоны мантии, лимфому из клеток зоны фулликула (фолликулярную), промежуточную диффузную NHL, диффузную крупноклеточную B-клеточную лимфому, агрессивные NHL (включая агрессивную грануичную NHL и агрессивную рецидивную NHL), NHL, рецидивирующую после или резистивную к трансплантации аутологичных стволовых клеток, первичную медиастинальную крупноклеточную B-клеточную лимфому, первичную выпотную лимфому, высокозлокачественную иммунобластную NHL, высокозлокачественную лимфобластную NHL, высокозлокачественную NHL типа Беркитта, генерализованную NHL, лимфому Беркитта, предраковый (периферический) крупноклеточный гранулированный лимфолейкоз, фунгоидный микоз и/или синдром Сезари, кожные (накожные) лимфомы, анапластическую крупноклеточную лимфому, лимфангиому.

Расстройства плазмацитов являются результатом неконтролируемого деления или размножения клона плазмацитов. Плазмациты возникают из активированных лимфоцитов (т.е. B-клеток). Каждая B-клетка продуцирует уникальный рецептор, известный как B-клеточный рецептор, выстроенный на его поверхности клеток, который является специфичным для инородного вещества, т.е. антигена. Когда В-клеточный рецептор связывает его родственный антиген, клетка, экспрессирующая рецептор, активируется, чтобы повторно ввести клеточный цикл, производя много копий клонов. Клоны созревают в плазмациты, которые находятся в основном в костном мозге и специализируются на продукцировании копий В-клеточного рецептора, которые выбрасываются в кровоток как антитела. В расстройстве плазмацитов, плазмацит или родительская В-клетка страдает от генетического повреждения, приводя в результате к подавлению или нечувствительности к нормальному ограничению на деление и/или активность клеток. Дочерние плазмациты, полученные из таких клеток, являются злокачественными в том, что они могут разделить непроверенное и/или генерировать избыточное количество того же самого иммуноглобулина (антитело). Часто продуцированный иммуноглобулин представляет собой неполную или имеет неправильную конформацию, что может привести к накоплению белка (также известного как моноклональный белок, белок М, парапротеин или амилоидный белок, в зависимости от конкретного расстройства) в сыворотке, тканях или органах (особенно почках), что приводит к дисфункции и/или недостаточности органов. Расстройства плазмацитов включают моноклональные гаммопатии неясного генеза (MGUS), множественную миелому (ММ), макроглобулинемию, болезнь тяжелых цепей, и системный амилоидоз легких цепей (AL), которые дифференцированы в зависимости от пролиферативного характера клона, степени участия костного мозга, а также типа экспрессированного М-белка. Дополнительные расстройства плазмацитов представляют собой солитарную плазмацитому, экстрамедуллярную плазмоцитому, множественные солитарные плазмоцитомы, плазмаклеточный лейкоз, макроглобулинемию Вальденстрема, В-клеточные неходжкинские лимфомы, хронический лимфолейкоз.

Термин "FcRH5-позитивный рак" относится к раку, содержащему клетки, которые экспрессируют FcRH5 на их поверхности. Для целей определения того, экспрессирует ли клетка FcRH5 на поверхности, экспрессия FcRH5 иРНК, как считается, коррелирует с экспрессией FcRH5 на клеточной поверхности. В некоторых вариантах реализации изобретения, экспрессия FcRH5 иРНК определяется способом, выбранным из гибридизации и RT-ПЦР (в том числе количественной RT- ПЦР). Альтернативно, экспрессия FcRH5 на клеточной поверхности может быть определена, например, с помощью антител к FcRH5 таким способом, как иммуногистохимия, FACS и т.д. В некоторых вариантах реализации изобретения, FcRH5 представляет собой один или более из FcRH5a, FcRH5b, FcRH5c, UniProt Identifier Q96RD9-2, и/или FcRH5d. В некоторых вариантах реализации изобретения, FcRH5 представляет собой FcRH5c.

Термин "FcRH5-позитивные клетки" относится к клетке, которая экспрессирует FcRH5 на ее поверхности. В некоторых вариантах реализации изобретения, FcRH5 представляет собой Квартира с одной или более FcRH5a, FcRH5b, FcRH5c, UniProt Identifier Q96RD9-2, и/или FcRH5d. В некоторых вариантах реализации изобретения, FcRH5 представляет собой FcRH5c.

Термин "эффективное количество" агента, например, фармацевтическая композиция, относится к количеству, эффективному в дозах и в течение периодов времени, необходимых для достижения желаемого терапевтического или профилактического результата.

"Индивидуальной" или "субъект" представляет собой млекопитающее. Млекопитающие включают, не ограничиваясь приведенным, домашних животных (например, коров, овец, кошек, собак, и коней), приматов (например, людей и приматов, таких как обезьяны), кроликов, и грызунов (например, мышей и крыс). В некоторых вариантах реализации изобретения, данное лицо или субъект является человеком.

Термин "вкладыш в упаковку" используют для обозначения инструкций, обычно включаемых в коммерческие упаковки терапевтических продуктов, которые содержат информацию о показаниях, дозировке, использование, контроль, комбинированную терапию, противопоказания и/или предупреждения, касающиеся использования таких терапевтических продуктов.

Термин "фармацевтическая композиция" относится к препарату, который находится в такой форме, чтобы обеспечить биологическую активность активного ингредиента, содержащегося в нем, чтобы быть эффективным, и который не содержит дополнительных компонентов, которые недопустимо токсичны для субъекта, которому композицию будут вводить.

"Фармацевтически приемлемый носитель» относится к ингредиенту фармацевтической композиции, кроме активного ингредиента, который нетоксичен для субъекта. Фармацевтически приемлемый носитель включает, но не ограничивается приведенным, буфер, наполнитель, стабилизатор, или консервант.

"Алкил" означает C1-C18 углеводород, содержащий нормальные, вторичные, третичные или циклические атомы углерода. Примерами являются метил (Me, -CH3), этил (Et, -CH2CH3), 1-пропил (н-Pr, н-пропил, -CH2CH2CH3), 2-пропил (изо-Pr, изо-пропил, -CH(CH3)2), 1-бутил (н-Bu, н-бутил, -CH2CH2CH2CH3), 2-метил-1-пропил (изо-Bu, изо-бутил, -CH2CH(CH3)2), 2-бутил (втор-Bu, втор-бутил, -CH(CH3)CH2CH3), 2-метил-2-пропил (трет-Bu, трет-бутил, -C(CH3)3), 1-пентил (н-пентил, -CH2CH2CH2CH2CH3), 2-пентил (-CH(CH3)CH2CH2CH3), 3-пентил (-CH(CH2CH3)2), 2-метил-2-бутил (-C(CH3)2CH2CH3), 3-метил-2-бутил (-CH(CH3)CH(CH3)2), 3-метил-1-бутил (-CH2CH2CH(CH3)2), 2-метил-1-бутил (-CH2CH(CH3)CH2CH3), 1-гексил (-CH2CH2CH2CH2CH2CH3), 2-гексил (-CH(CH3)CH2CH2CH2CH3), 3-гексил (-CH(CH2CH3)(CH2CH2CH3)), 2-метил-2-пентил (-C(CH3)2CH2CH2CH3), 3-метил-2-пентил (-CH(CH3)CH(CH3)CH2CH3), 4-метил-2-пентил (-CH(CH3)CH2CH(CH3)2), 3-метил-3-пентил (-C(CH3)(CH2CH3)2), 2-метил-3-пентил (-CH(CH2CH3)CH(CH3)2), 2,3-диметил-2-бутил (-C(CH3)2CH(CH3)2), 3,3-диметил-2-бутил (-CH(CH3)C(CH3)3.

Термин "C1-C8 алкил," как используют в данном документе, относится к неразветвленному или разветвленному, насыщенному или ненасыщенному углеводороду, имеющему от 1 до 8 атомов углерода. Репрезентативные "C1-C8 алкильные" группы включают, не ограничиваясь приведенным, -метил, -этил, -н-пропил, -н-бутил, -н-пентил, -н-гексил, -н-гептил, -н-октил, -н-нонил и -н-децил; в то время как разветвленные C1-C8 алкилы включают, не ограничиваясь приведенным, -изопропил, -втор-бутил, -изобутил, -трет-бутил, -изо-пентил, -2-метилбутил, ненасыщенные C1-C8 алкилы включают, не ограничиваясь приведенным, -винил, -аллил, -1-бутенил, -2-бутенил, -изобутенил, -1-пентенил, -2-пентенил, -3-метил-1-бутенил, -2 метил-2-бутенил, -2,3-диметил-2-бутенил, -1-гексил, -2-гексил, -3-гексил, -ацетиленил, -пропинил, -бутинил -1-бутинил, -2-бутинил, -1-пентинил, -2-пентинил, -3-метил-1-бутинил. C1-C8 алкильная группа может быть незамещенной или замещенной одной или более группами, включая, но не ограничиваясь этим, -C1-C8 алкил, -O-(C1-C8алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2 , -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -SO3R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R' независимо выбран из Н, -C1-C8 алкила и арила.

Термин "C1-C12 алкил," как используют в данном документе, относится к неразветвленному или разветвленному, насыщенному или ненасыщенному углеводороду, имеющему от 1 до 12 атомов углерода. C1-C12 алкильная группа может быть незамещенной или замещенной одной или более группами, включая, но не ограничиваясь приведенным, -C1-C8 алкил, -O-(C1-C8 алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2 , -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -SO3R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R’ независимо выбран из H, -C1-C8 алкила и арила.

Термин "C1-C6 алкил," как используют в данном документе, относится к неразветвленному или разветвленному, насыщенному или ненасыщенному углеводороду, имеющему от 1 до 6 атомов углерода. Репрезентативные "C1-C6 -алкильные" группы включают, не ограничиваясь приведенным, -метил, -этил, -н-пропил, -н-бутил, -н-пентил и -н-гексил; в то время как разветвленные C1-C6 алкилы включают, не ограничиваясь приведенным, -изопропил, -втор-бутил, -изобутил, -трет-бутил, -изопентил и 2-метилбутил; ненасыщенные C1-C6 алкилы включают, не ограничиваясь приведенным, -винил, -аллил, -1-бутенил, -2-бутенил и -изобутенил, -1-пентенил, -2-пентенил, -3-метил-1-бутенил, -2-метил-2-бутенил, -2,3-диметил-2-бутенил, 1-гексил, 2-гексил и 3-гексил. C1-C6 алкильная группа может быть незамещенной или замещенной одной или более группами, как описано выше для C1-C8 алкильной группы.

Термин "C1-C4 алкил," как используют в данном документе, относится к неразветвленному или разветвленному, насыщенному или ненасыщенному углеводороду, имеющему от 1 до 4 атомов углерода. Репрезентативные " C1-C4 алкильные" группы включают, не ограничиваясь приведенным, -метил, -этил, -н-пропил, -н-бутил; в то время как разветвленные C1-C4 алкилы включают, не ограничиваясь приведенным, -изопропил, -втор-бутил, -изобутил, -трет-бутил; ненасыщенные C1-C4 алкилы включают, не ограничиваясь приведенным, -винил, -аллил, -1-бутенил, -2-бутенил и -изобутенил. C1-C4 алкильная группа может быть незамещенной или замещенной одной или более группами, как описано выше для C1-C8 алкильной группой.

"Алкокси" является алкильной группой. по отдельности связанной с атомом кислорода. Иллюстративные алкокси группы включают, не ограничиваясь приведенным, метокси (-OCH3) и этокси (-OCH2CH3). "C1-C5 алкокси" обозначает алкоксигруппу, содержащую от 1 до 5 атомов углерода. Алкоксигруппы могут может быть незамещенными или замещенными одной или более группами, как описано выше для алкильных групп.

"Алкенил" представляет собой C2-C18 углеводород, содержащий нормальные, вторичные, третичные или циклические атомы углерода с по меньшей мере одним сайтом ненасыщенности, т.е. углерод-углеродной, sp2 двойной связью. Примеры включают, не ограничиваясь приведенным: этилен или винил (-CH=CH2), аллил (-CH2CH=CH2), циклопентил (-C5H7), и 5-гексенил (-CH2 CH2CH2CH2CH=CH2). "C2-C8 алкенил" является углеводородом, содержащим от 2 до 8 нормальных, вторичных, третичных или циклических атомов углерода с по меньшей мере одним сайтом ненасыщенности, т.е. углерод-углеродной, sp2 двойной связью.

"Алкинил" представляет собой C2-C18 углеводород, содержащий нормальные, вторичные, третичные или циклические атомы углерода с по меньшей мере одним сайтом ненасыщенности, т.е. углерод-углеродной, sp тройной связью. Примеры включают, не ограничиваясь приведенным: ацетилен (-C≡CH) и пропаргил (-CH2C≡CH). "C2-C8-алкинил" является углеводородом, содержащим от 2 до 8 нормальных, вторичных, третичных или циклических атомов углерода с по меньшей мере одним сайтом ненасыщенности, т.е. углерод-углеродной, sp тройной связью.

"Алкилен" относится к насыщенному, неразветвленному или разветвленному или циклическому углеводородному радикалу, содержащему 1-18 атомов углерода, и имеющему два одновалентных радикальных центра, полученному удалением двух атомов водорода из того же или двух различных атомов углерода из исходного алкана. Типичные алкиленовые радикалы включают, не ограничиваясь приведенным: метилен (-CH2-) 1,2-этил (-CH2CH2-), 1,3-пропил (-CH2CH2CH2-), 1,4-бутил (-CH2CH2CH2CH2-), и тому подобное.

"C1-C10 алкилен" является неразветвленной насыщенной углеводородной группой формулы -(CH2)1-10-. Примеры С110 алкилена включают метилен, этилен, пропилен, бутилен, пентилен, гексилен, гептилен, октилен, нонилен и декален.

"Алкенилен" относится к ненасыщенному, разветвленному или неразветвленному или циклическому углеводородному радикалу, 2-18 атомов углерода, и имеющему два одновалентных радикальных центра, полученному удалением двух атомов водорода из того же или двух различных атомов углерода из исходного алкена. Типичные алкениленовые радикалы включают, не ограничиваясь приведенным: 1,2-этилен (-CH=CH-).

"Алкинилен" относится к ненасыщенному, разветвленному или неразветвленному или циклическому углеводородному радикалу, содержащему 2-18 атомов углерода, и два одновалентных радикальных центра, полученные удалением двух атомов водорода из того же или двух различных атомов углерода исходного алкина. Типичные алкиниленовые радикалы включают, не ограничиваясь приведенным: ацетилен (-C≡C-), пропаргил (-CH2C≡C-), и 4-пентинил(-CH2CH2CH2C≡C-).

"Арил" относится к карбоциклической ароматической группе. Примеры арильных групп включают, не ограничиваясь приведенным, фенил, нафтил и антраценил. Карбоциклическая ароматическая группа или гетероциклическая ароматическая группа может быть незамещенной или замещенной одной или несколькими группами, включая, но не ограничиваясь этим, -C1-C8 алкил, -O-(C1-C8 алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2, -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R 'независимо выбран из Н, -C1-C8-алкила и арила.

"C5-C20 арил" представляет собой арильную группу с от 5 до 20 атомов углерода в карбоциклических ароматических кольцах. Примеры C5-C20 арильных групп включают, не ограничиваясь приведенным, фенил, нафтил и антраценил. Арильная C5-C20 группа может быть замещенной или незамещенной, как описано выше для арильной группы. "C5-C14 арил" представляет собой арильную группу с от 5 до 14 атомов углерода в карбоциклических ароматических кольцах. Примеры C5-C14 арильных групп включают, не ограничиваясь приведенным, фенил, нафтил и антраценил. C5-C14 арильная группа может быть замещенной или незамещенной, как описано выше для арильных групп.

Термин "арилeн" является арильной группой, которая имеет две ковалентные связи и может быть в орто-, мета-, или пара- конфигурациях, как показано в следующих структурах:

в котором фенильная группа может быть незамещенной или замещенной до четырех групп, включая, но не ограничиваясь этим, -C1-C8 алкил, -O-(C1-C8 алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2 , -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R 'независимо выбран из H, -C1-C8 алкила и арила.

"Арилалкил" относится к ациклическому алкильному радикалу, в котором один из атомов водорода, связанных с атомом углерода, обычно концевой или sp3 атом углерода, замещен на арильный радикал. Типичные арилалкильные группы включают, не ограничиваясь приведенным, бензил, 2-фенилэтан-1-ил, 2-фенилэтен-1-ил, нафтилметил, 2-нафтилэтан-1-ил, 2-нафтилэтен-1-ил, нафтилбензол, 2-нафтофенилэтан-1-ил и тому подобное. Арилалкильная группа содержит от 6 до 20 атомов углерода, например алкильный фрагмент, в том числе алканильные, алкенильные или алкинильные группы, где арилалкильная группа состоит из от 1 до 6 атомов углерода, и ариьныйл фрагмент состоит из от 5 до 14 атомов углерода.

"Гетероарилалкил" относится к ациклическому алкильному радикалу, в котором один из атомов водорода, связанных с атомом углерода, обычно концевым или sp3 атомом углерода, замещен гетероарильным радикалом. Типичные гетероарилалкильные группы включают, не ограничиваясь приведенным, 2-бензимидазолилметил, 2-фурилэтил и тому подобное. Гетероарилалкильная группа содержит от 6 до 20 атомов углерода, например алкильный фрагмент, в том числе алканильные, алкенильные или алкинильные группы, где гетероарилалкильная группа состоит из от 1 до 6 атомов углерода, а гетероарильный фрагмент состоит из от 5 до 14 атомов углерода и от 1 до 3 гетероатомов, выбранных из N, О, Р и S. Гетероарильный фрагмент гетероарилалкильной группы может быть моноциклом, имеющим от 3 до 7 элементов кольца (от 2 до 6 атомов углерода, или бициклом, имеющим от 7 до 10 кольцевых элементов (от 4 до 9 атомов углерода и от 1 до 3 гетероатомов, выбранных из N, О, Р и S), например: бицикло [4,5], [5,5], [5,6] или [6,6] система.

"Замещенный алкил," "замещенный арил", и "замещенный арилалкил" означает алкил, арил и арилалкил соответственно, в которых один или несколько атомов водорода, каждый независимо, замещены заместителем. Типичные заместители включают, не ограничиваясь приведенным, -X, -R, -O-, -OR, -SR, -S-, -NR2, -NR3, =NR, -CX3, -CN, -OCN, -SCN, -N=C=O, -NCS, -NO, -NO2, =N2, -N3, NC(=O)R, -C(=O)R, -C(=O)NR2,-SO3-, -SO3H, -S(=O)2R, -OS(=O)2OR, -S(=O)2NR, -S(=O)R, -OP(=O)(OR)2, -P(=O)(OR)2,-PO3, -PO3H2, -C(=O)R, -C(=O)X, -C(=S)R, -CO2R, -CO2, -C(=S)OR, -C(=O)SR, -C(=S)SR, -C(=O)NR2, -C(=S)NR2, -C(=NR)NR2, где каждый Х независимо представляет собой галоген: F, Cl, Br, или I; и каждый R независимо представляет собой -H, C2-C18 алкил, C6-C20 арил, C3-C14 гетероцикл, защитную группу или фрагмент пролекарства. Алкиленовые, алкениленовые и алкиниленовые группы, описанные выше, могут также быть аналогичным образом замещены.

"Гетероарил" и "гетероцикл" относится к кольцевой системе, в которой один или несколько кольцевых атомов представляют собой гетероатом, например азот, кислород и серу. Гетероциклический радикал содержит от 3 до 20 атомов углерода и от 1 до 3 гетероатомов, выбранных из N, О, Р и S. Гетероцикл может быть моноциклом, имеющим от 3 до 7 кольцевых элементов (от 2 до 6 атомов углерода и от 1 до 3 гетероатомов, выбранных из N, О, Р и S) или бициклом, имеющим от 7 до 10 кольцевых элементов (от 4 до 9 атомов углерода и от 1 до 3 гетероатомов, выбранных из N, О, Р и S), например: бицикло [4,5 ], [5,5], [5,6] или [6,6] система.

Иллюстративные гетероциклы описаны, например, в Paquette, Leo A., “Principles of Modern Heterocyclic Chemistry” (W.A. Benjamin, New York, 1968), в частности Главы 1, 3, 4, 6, 7, и 9; “The Chemistry of Heterocyclic Compounds, A series of Monographs” (John Wiley & Sons, New York, 1950 до настоящего времени), в частности тома 13, 14, 16, 19, и 28; и J. Am. Chem. Soc. (1960) 82:5566.

Примеры гетероциклов включают в качестве примера и не в качестве ограничения, пиридил, дигидропиридил, тетрагидропиридил (пиперидил), тиазолил, тетрагидротиофенил, тетрагидротиофенил с окисленным атомом серы, пиримидинил, фуранил, тиенил, пирролил, пиразолил, имидазолил, тетразолил, бензофуранил, тианафталенил, индолил, индоленил, хинолинил, изохинолинил, бензимидазолил, пиперидинил, 4-пиперидонил, пирролидинил, 2-пирролидонил, пирролинил, тетрагидрофуранил, бис-тетрагидрофуранил, тетрагидропиранил, бис-тетрагидропиранил, тетрагидрохинолинил, тетрагидроизохинолинил, декагидрохинолинил, октагидроизохинолинил, азоцинил, триазинил, 6Н-1,2,5-тиадиазинил, 2H,6H-1,5,2-дитиазинил, тиенил, тиантренил, пиранил, изобензофуранил, хроменил, ксантенил, феноксатинил, 2H-пирролил, изотиазолил, изоксазолил, пиразинил, пиридазинил, индолизинил, изоиндолил, 3Н-индолил, 1H-индазолил, пуринил, 4H-хинолизинил, фталазинил, нафтиридинил, хиноксалинил, хиназолинил, циннолинил, птеридинил, 4aH-карбазолил, карбазолил, β-карболинил, фенантридинил, акридинил, пиримидинил, фенантролинил, феназинил, фенотиазинил, фуразанил, феноксазинил, изохроманил, хроманил, имидазолидинил, имидазолинил, пиразолидинил, пиразолинил, пиперазинил, индолинил, изоиндолинил, хинуклидинил, морфолинил, оксазолидинил, бензотриазолил бензизоксазолил, оксиндолил, бензоксазолинил, и изатиноил.

В качестве примера и без ограничения, углерод-связанные гетероциклы присоединены в положении 2, 3, 4, 5 или 6 пиридина, положении 3, 4, 5 или 6 пиридазина, положении 2, 4, 5, или 6 пиримидина, положении 2, 3, 5, или 6 пиразина, положении 2, 3, 4 или 5 фурана, тетрагидрофурана, тиофурана, тиофена, пиррола или тетрагидропиррола, положении 2, 4, или 5 оксазола, имидазола или тиазола, положении 3, 4 или 5 изоксазола, пиразола или изотиазола, положении 2 или 3 азиридина, положении 2, 3 или 4 из азетидина, положении 2, 3, 4, 5, 6, 7 или 8 хинолина, или положении 1, 3, 4, 5, 6, 7, или 8 изохинолина. Еще более типично, углерод-связанные гетероциклы включают 2-пиридил, 3-пиридил, 4-пиридил, 5-пиридил, 6-пиридил, 3-пиридазинил, 4-пиридазинил, 5-пиридазинил, 6-пиридазинил, 2-пиримидинил, 4-пиримидинил, 5-пиримидинил, 6-пиримидинил, 2-пиразинил, 3-пиразинил, 5-пиразинил, 6-пиразинил, 2-тиазолил, 4-тиазолил или 5-тиазолил.

В качестве примера и без ограничения, азот-связанные гетероциклы присоединены в положении 1 азиридина, азетидина, пиррола, пирролидина, 2-пирролина, 3-пирролина, имидазола, имидазолидина, 2-имидазолина, 3-имидазолина, пиразола, пиразолина, 2-пиразолина, 3-пиразолина, пиперидина, пиперазина, индола, индолина, 1H-индазола, в положении 2 изоиндола или изоиндолина, положении 4 морфолина и положении 9 карбазола или β-карболина. Еще более типично, азот-связанные гетероциклы включают 1-азиридил, 1-азетидил, 1-пирролил, 1-имидазолил, 1-пиразолил и 1-пиперидинил.

"C3-C8 гетероцикл" относится к ароматическому или неароматическому C3-C8 карбоциклу, в котором от одного до четырех атомов углерода в кольце независимо замещены гетероатомом из группы, состоящей из О, S и N. Репрезентативные примеры C3-C8 гетероцикла включают, не ограничиваясь приведенным, бензофуранил, бензотиофен, индолил, бензопиразолил, кумаринил, изохинолинил, пирролил, тиофенил, фуранил, тиазолил, имидазолил, пиразолил, триазолил, хинолинил, пиримидинил, пиридинил, пиридонил, пиразинил, пиридазинил, изотиазолил, изоксазолил и тетразолил. C3-C8 гетероцикл может быть незамещенным или замещенным до семи групп, включая, но не ограничиваясь этим, -C1-C8 алкил, -O-(C1-C8 алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2 , -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R’ независимо выбран из H, -C1-C8 алкила и арила.

"C3-C8 гетероцикло" относится к C3-C8 гетероциклической группе, определенной выше, где один из атомов водорода гетероциклической группы замещен связью. C3-C8 гетероцикло может быть незамещенным или замещенным до шести групп, включая, но не ограничиваясь этим, -C1-C8 алкил, -O-(C1-C8 алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2 , -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R’ независимо выбран из H, -C1-C8 алкила и арила.

"C3-C20 гетероцикл" относится к ароматическому или неароматическому C3-C8 карбоциклу, в котором от одного до четырех атомов углерода в кольце независимо замещены гетероатомом из группы, состоящей из О, S и N. C3-C20 гетероцикл может быть незамещенным или замещенным до семи групп, включая, но не ограничиваясь этим, -C1-C8 алкил, -O-(C1-C8 алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2 , -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R’ независимо выбран из H, -C1-C8 алкила и арила.

"C3-C20 гетероцикло" относится к C3-C20 гетероциклической группе, определенной выше, в которой один из атомов водорода гетероциклической группы замещен связью.

"Карбоцикл" означает насыщенное или ненасыщенное кольцо, имеющее от 3 до 7 атомов углерода, как моноцикл или 7 до 12 атомов углерода как бицикл. Моноциклические карбоциклы имеют от 3 до 6 кольцевых атомов, еще более типично от 5 до 6 атомов в кольце. Бициклические карбоциклы имеют от 7 до 12 атомов в кольце, например расположенных в бицикло [4,5], [5,5], [5,6] или [6,6] системе, или 9, или 10 кольцевых атома расположены в бицикло [ 5,6] или [6,6] системе. Примеры моноциклических карбоциклов включают циклопропил, циклобутил, циклопентил, 1-циклопент-1-енил, 1-циклопент-2-енил, 1-циклопент-3-енил, циклогексил, 1-циклогексен-1-енил, 1-циклогексен-2 енил, 1-циклогексен-3-енил, циклогептил и циклооктил.

"C3-C8 карбоцикл" является 3-, 4-, 5-, 6-, 7- или 8-членным насыщенным или ненасыщенным неароматическим карбоциклическим кольцом. Иллюстративные C3-C8 карбоциклы включают, не ограничиваясь приведенным, -циклопропил, -циклобутил, -циклопентил, -циклопентадиенил, циклогексил, -циклогексенил, -1,3-циклогексадиенил, -1,4-циклогексадиенил, -циклогептил, -1,3-циклогептадиенил, 1,3,5-циклогептатриенил, -циклооктил и -циклооктадиенил. C3-C8 карбоциклическая группа может быть незамещенной или замещенной одной или более группами, включая, но не ограничиваясь этим, -C1-C8 алкил, -O-(C1-C8 алкил), -арил, -C(O)R’, -OC(O)R’, -C(O)OR’, -C(O)NH2 , -C(O)NHR’, -C(O)N(R’)2 -NHC(O)R’, -S(O)2R’, -S(O)R’, -OH, -галоген, -N3 , -NH2, -NH(R’), -N(R’)2 и -CN; где каждый R’ независимо выбран из H, -C1-C8 алкила и арила.

"C3-C8 карбоцикло" относится к C3-C8 карбоциклической группе, определенной выше, где один из атомов водорода карбоцикла групп замещен связью.

"Линкер" относится к химической части молекулы, содержащей ковалентную связь или цепь атомов, которые ковалентно присоединяют антитело к молекуле лекарственного средства. В различных вариантах линкеры включают двухвалентный радикал, такой как алкилдиил, арилдиил, гетероарил или фрагменты, такие как: (-(CR2)nO(CR2)n-, повторяющиеся алкилокси звенья (например полиэтиленокси, ПЭГ, полиметиленокси) и алкиламино (например полиэтиленамино, Jeffamine™); и двухкислотный сложный эфир и амиды, включая сукцинат, сукцинамид, дигликолят, малонат и капроамид. В различных вариантах реализации изобретения линкеры могут содержать один или более аминокислотных остатков, таких как валин, фенилаланин, лизин, и гомолизин.

Термин "хиральный" относится к молекулам, которые обладают свойством не-наложимости на зеркального партнера, в то время как термин "ахиральный" относится к молекулам, которые накладываются на их зеркальный партнер.

Термин "стереоизомеры" относится к соединениям, которые имеют одинаковое химическое строение, но отличаются по расположению атомов или групп в пространстве.

"Диастереомер" относится к стереоизомеру с двумя или более хиральными центрами и, молекулы которых не являются зеркальным отображением друг друга. Диастереомеры имеют различные физические свойства, например точки плавления, точки кипения, спектральные свойства и реакционную способность. Смеси диастереомеров можно разделить при помощи аналитических процедур высокого разрешения, например, электрофореза и хроматографии.

"Энантиомеры" относятся к двум стереоизомерам соединения, которые не являются зеркальными отражениями друг друга.

Стереохимические определения и условные обозначения, используемые в данном документе, как правило, соответствуют S. P. Parker, Ed., McGraw-Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book Company, New York; and Eliel, E. and Wilen, S., Stereochemistry of Organic Compounds (1994) John Wiley & Sons, Inc., New York. Многие органические соединения существуют в оптически активных формах, т.е., они обладают способностью вращать плоскость плоско-поляризованного света. При описании оптически активного соединения префиксы D и L, либо R и S, используются для обозначения абсолютной конфигурации молекулы относительно ее хирального центра(ов). Префиксы d и1 или (+) и (-) используют для обозначения знака вращения плоскополяризованного света соединением, причем (-) или 1 означает, что соединение представляет собой левовращающее соединение. Соединение с префиксом (+) или d представляет собой правовращающее соединение. Для данной химической структуры эти стереоизомеры являются идентичными за исключением того, что они являются зеркальными отражениями друг друга. Конкретный стереоизомер может также называться энантиомером, и смесь таких изомеров часто называют энантиомерной смесью. 50:50 смесь энантиомеров, называют рацемической смесью или рацематом, что может иметь место, когда отсутствовала стереоселекция или стереоспецифичность в химической реакции или процессе. Термины "рацемическая смесь" и "рацемат" относятся к эквимолярной смеси двух энантиомерных видов, лишенных оптической активности.

"Отходящая группа" относится к функциональной группе, которая может быть замещена другой функциональной группой. Некоторые отходящие группы хорошо известны в данной области техники и примеры включают, не ограничиваясь приведенным, галогенид (например, хлорид, бромид, иодид), метансульфонил (метилсульфонил), п-толуолсульфонил (тозил), трифторметилсульфонил (трифлат), и трифторметилсульфонат.

Термин "защитная группа" относится к заместителю, который обычно используют для блокирования или защиты конкретной функциональной группы в процессе взаимодействия других функциональных групп на соединении. Например, "амино-защитные группы" обозначает заместитель, присоединенный к аминогруппе, который блокирует или защищает функциональную аминогруппу в соединении. Подходящие амино-защитные группы включают, не ограничиваясь приведенным, ацетил, трифторацетил, трет-бутоксикарбонил (ВОС), бензилоксикарбонил (CBZ) и 9-флуоренилметиленоксикарбонил (Fmoc). Общее описание защитных групп и их использование см. T. W. Greene, Protective Groups in Organic Synthesis, John Wiley & Sons, New York, 1991, или более поздние выпуски.

Как понятно специалисту в данной области, ссылка на "приблизительное" значение или параметр в данном докумение, включает (и описывает) варианты реализации изобретения, которые направлены на данное значение или параметр как таковые. Например, описание со ссылкой на "приблизительно Х" включает описание «Х».

Понятно, что аспект и варианты реализации изобретения, описанные в данном документе, включают "состоящий из" и/или "состоящий в основном из" аспектов и вариантов реализации изобретения. Как используют в данном документе, форма единственного числа включает ссылки на множественное число, если не указано иное.

1.КОМПОЗИЦИИ И СПОСОБЫ

В данном документе предложены антитела, связывающие FcRH5, включая биспецифические антитела и иммуноконъюгаты, содержащие такие антитела. Антитела и иммуноконъюгаты могут быть полезны, например, для диагностики или лечения видов FcRH5-позитивного рака. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитела связывают Ig-подобный домен 9 FcRH5c.

Не желая быть связанными теорией, выбор точного антигена для антитела в соответствии с данным изобретением был обоснован по меньшей мере тремя важными соображениями. Сначала, существовала потребность в небольшой или в отсутствии перекрестной реактивности с FcRH5 изоформами, отличными от thFcRH5c, такими как изоформа a и изоформа b, чтобы избежать результирующей терапии от связывания молекул - не мишеней и таким образом уменьшения ее эффективности. Как показано на Фигуре 1, домен 9 FcRH5 является примером уникальной последовательности среди трех изоформ. Затем, существовала потребность в необльшой или в отсутствии перекрестной реактивности с членами семейства FcRH, кроме thFcRH5, такими как FcRH1, FcRH2, FcRH3, и FcRH4.

Это сложно ввиду в общем высококонсеративной природы последних Ig-подобных доменов в многих членах семейства FcRH. Но ввиду параллельной потребности в специфичности FcRH5 изоформы c, были продолжены поиски антитела, связывающего последний Ig-подобный домен. Наконец, для антител для использования в терапевтических молекулах, которые функционируют для приведения больших структур в непосредственную близость, таких как T-клетки или опухолевые клетки с использованием формата биспецифичного антитела, известно, что эпитопы опухоли, более близкие к клеточной мембране, более эффективны (см., например, Bluemel et al. Cancer Immunol Immunother. (2010) 59:1197-1209). Иногда описанная как теория кинетической сегрегации, близкое расположение клеточной мембраны домена 9 FcRH5 является желательной мишенью антигена в данном контексте. Для удовлетворения таких соображений и как описано более подробно ниже, были разработаны определенные варианты реализации антитела в соответствии с данным изобретением.

В данном документе предложены выделенные анти-FcRH5 антитела, связывающие изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит Ig-подобный домен 9. В некоторых вариантах реализации изобретения, Ig-подобный домен 9 также имеет название Ig-подобный C2-тип 8. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 754-835 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 752-834 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 743-850 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 745-851 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты приблизительно любую из 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, или 15 из N-концевого и/или C-концевого связывания. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты из приблизительно любой из 750, 751, 752, 753, или 754 до приблизительно любую из 830, 831, 832, 833, 834, 835, или836 SEQ ID №:1. В некоторых вариантах реализации изобретения, предложены антитела связывает FcRH5c и/или изоформный с-специфичный участок с афинностью ≤ 5 нM, или ≤ 4 нM, или ≤ 3 нM, или ≤ 2 нM, или ≤ 1 нM, и необязательно ≥ 0,0001 нM, или ≥ 0,001 нM, или ≥ 0,01 нM.

В некоторых вариантах реализации изобретения любого из антител, антитело имеет одну или более из следующих характеристик: a) перекрестную реактивность с полноразмерным человеческим FcRH5 и FcRH5 макак (т.е., связывает полноразмерный humFcRH5 и связывает полноразмерный FcRH5 макак), b) не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4 (т.е., не связывает в существенной степени FcRH1, FcRH2, FcRH3, и/или FcRH4), c) связывает эндогенный FcRH5, d) не имеет перекрестной реактивности с FcRH5a (т.е., не связывает в существенной степени FcRH5a), и e) не имеет перекрестной реактивности с другим Ig-подобным доменом FcRH5 (т.е., не связывает в существенной степени другой Ig-подобный домен FcRH5). Способы определения способности к связыванию известны в данной области и описаны ниже.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:38, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:62, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:86; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:2, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:14, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:26. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:50, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:74, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:98. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичность последовательности к аминокислотной последовательности SEQ ID №:111 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №: 110. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:111 и/или VL последовательность SEQ ID №:110. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 1C8.1. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 1C8.1. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим FcRH5 и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:39, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:63, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:87; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:3, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:15, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:27. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:51, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:75, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:99. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:113 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:112. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:135 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:134. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:113 и/или VL последовательность SEQ ID №:112. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:135 и/или VL последовательность SEQ ID №:134. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 1G7.2. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 1G7.2. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 1G7.2’. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 1G7.2’. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим FcRH5 и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH5a.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:40, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:64, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:88; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:4, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:16, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:28. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:52, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:76, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:100. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:115 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:114. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:115 и/или VL последовательность SEQ ID №:114. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 2H7.3. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен of 2H7.3. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:41, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:65, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:89; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:5, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:17, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:29. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:53, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:77, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:101. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:117 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:116. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:117 и/или VL последовательность SEQ ID №:116. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 3A4.2. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен of 3A4.2. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:42, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:66, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:90; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:6, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:18, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:30. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:54, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:78, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:102. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:119 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:118. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:119 и/или VL последовательность SEQ ID №:118. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 3B12.1.1. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 3B12.1.1. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH5a.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:43, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:67, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:91; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:7, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:19, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:31. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:55, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:79, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:103. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:121 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:120. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:121 и/или VL последовательность SEQ ID №:120. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 3C10. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен of 3C10. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:44, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:68, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:92; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:8, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:20, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:32. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:56, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:80, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:104. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:123 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:122. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:123 и/или VL последовательность SEQ ID №:122. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 3F10. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 3F10. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH5a.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:45, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:69, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:93; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:9, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:21, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:33. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:57, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:81, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:105. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:125 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:124. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:125 и/или VL последовательность SEQ ID №:124. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 3G3. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 3G3. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH5a.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:46, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:70, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:94; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:10, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:22, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:34. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:58, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:82, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:106. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:127 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №: 126. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:127 и/или VL последовательность SEQ ID №:126. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 3G7.1.5. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 3G7.1.5. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:47, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:71, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:95; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:11, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:23, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:35. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:59, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:83, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:107. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:129 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:128. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:129 и/или VL последовательность SEQ ID №:128. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 5A10.1.3. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 5A10.1.3. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:48, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:72, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:96; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:12, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:24, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:36. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:60, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:84, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:108. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:131 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:130. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:131 и/или VL последовательность SEQ ID №:130. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 5F1.1.5. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 5F1.1.5. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH5a.

В данном документе предложены, и в некоторых вариантах реализации изобретения, предложены антитела, содержащие a) тяжелую цепь, содержащую HVR-H1, содержащий аминокислотную последовательность SEQ ID №:49, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:73, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:97; и/или b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID №:13, HVR-L2, содержащий аминокислотную последовательность SEQ ID №:25, и НVR-L3, содержащий аминокислотную последовательность SEQ ID №:37. В некоторых вариантах реализации изобретения, тяжелая цепь содержит HVR-H1, содержащий аминокислотную последовательность SEQ ID №:61, HVR-H2, содержащий аминокислотную последовательность SEQ ID №:85, и НVR-H3, содержащий аминокислотную последовательность SEQ ID №:109. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:133 и/или VL последовательность, имеющую по меньшей мере приблизительно любую из 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, или 100% идентичности последовательности к аминокислотной последовательности SEQ ID №:132. В некоторых вариантах реализации изобретения, антитело содержит VH последовательность SEQ ID №:133 и/или VL последовательность SEQ ID №:132. В некоторых вариантах реализации изобретения любого из антител, антитело содержит шесть HVR 6D2. В некоторых вариантах реализации изобретения, антитело содержит VH домен и VL домен 6D2. В некоторых вариантах реализации изобретения, антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c (например, Ig-подобный домен 9). В некоторых вариантах реализации изобретения, антитело имеет перекрестную реактивность с полноразмерным человеческим и FcRH5 макак. В некоторых вариантах реализации изобретения, антитело не имеет значительной перекрестной реакции с FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, антитело связывает эндогенный FcRH5. В некоторых вариантах реализации изобретения, антитело связывает B-клетки. В некоторых вариантах реализации изобретения, антитело не связывает в существенной степени NK клетки и/или моноциты.

В дополнительном аспекте, предложенном в данном документе, анти-FcRH5 антитело в соответствии с любым из приведенных выше вариантов реализации изобретения представляет собой моноклональное антитело, включая химерное, гуманизированное или химерное антитело. В одном варианте реализации изобретения, анти-FcRH5 антитело представляет собой фрагмент антитела, например, Fv, Fab, Fab’, scFv, диабоди, или F(ab’)2 фрагмент. В другом варианте реализации изобретения, антитело является существенно полноразмерным антителом, например, IgG1 антителом или другим классом или изотипом антитела, как определено в данном документе.

В дополнительном аспекте, данное изобретение предлагает антитело, связывающее тот же самый эпитоп, что и анти-FcRH5 антитело, предложенное в данном документе. В определенных вариантах реализации изобретения, предложено антитело, связывающее изоформный с-специфичный участок внеклеточного домена FcRH5c из, внутри, или перекрывающее аминокислоты 754-835 SEQ ID №:1.

В некоторых вариантах реализации изобретения любого из анти-FcRH5 антител, FcRH5 антитело, в особенности биспецифическое FcRH5 (например, анти-CD3/анти-FcRH5 биспецифическое), может иметь признаки, отдельно или в комбинации, исходя из анализов клеточных линий HEK (HEK клетки восстанавливали необходимыми сигнальными компонентами для активации TCR, как описано в James and Valle, Nature 487:64-69 (2012), который полностью включен путем ссылки. В некоторых вариантах реализации изобретения, признаки, отдельно или в комбинации, могут включать интерфазу опухолевых клеток/иммунологический синапс, Lck-опосредованное TCR фосфорилирование, ZAP70 активность, включая состояние фосфорилирования и локализацию, CD58 активность, включая локализацию и связывание, β2Ar активность, включая локализацию и связывание, CAAX активность, включая локализацию и связывание CD45 активность, включая локализацию, pMHC активность, включая локализацию, и/или признаки активности и активации TCR.

В дополнительном аспекте, анти-FcRH5 антитело в соответствии с любым из приведенных выше вариантов реализации изобретения может иметь любые признаки, отдельно или в комбинации, как описано в (a)-(e) и/или Разделах 1-7 ниже.

(a) связывает изоформный с-специфичный участок внеклеточного домена FcRH5c

Методы определения того, связывает ли анти-FcRH5 антитело изоформный с-специфичный участок внеклеточного домена FcRH5c, известны в данной области. В некоторых вариантах реализации изобретения, связывание анти-FcRH5 антитела и изоформного с-специфичного участка внеклеточного домена FcRH5c может быть определено путем экспрессии полипептидов FcRH5 с N- и С-концевыми делециями в 293 клетках и/или SVT2 клетках и тестирования при помощи FACS, как описано в Примерах связывания антитела и усеченных полипептидов. В некоторых вариантах реализации изобретения, существенное снижение (снижение ≥ 70%) или устранение связывания антитела и усеченного полипептида относительно связывания с полноразмерным FcRH5, экспрессированным в 293 клетках показывает, что антитело не связывается с данным усеченным полипептидом.

В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит Ig-подобный домен 9. В некоторых вариантах реализации изобретения, Ig-подобный домен 9 также называют Ig-подобный C2-тип 8. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 754-835 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 752-834 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 743-850 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты 745-851 SEQ ID №:1. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты из приблизительно любой из 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, или 15 из N-концевого и/или C-концевого связывания. В некоторых вариантах реализации изобретения, изоформный с-специфичный участок содержит аминокислоты из приблизительно любой из 750, 751, 752, 753, или 754 до приблизительно любой из 830, 831, 832, 833, 834, 835, или 836 SEQ ID №:1. В некоторых вариантах реализации изобретения, FcRH5 представляет собой НumFcRH5. В некоторых вариантах реализации изобретения, FcRH5 представляет собой НumFcRH5 или FcRH5 яванских макак.

(b) перекрестно реагирует с (связывает) человеческий и FcRH5 макак с афинностью ≤ 5 нM, или ≤ 4 нM, или ≤ 3 нM, или ≤ 2 нM, или ≤ 1 нM, и необязательно ≥ 0,0001 нМ, или ≥ 0,001 нМ, или ≥ 0,01 нM

Способы определения афинности связывания известны в данной области. В некоторых вариантах реализации изобретения, афинность связывания может быть определена в соответствии с анализом BIAcore®, ELISA, Facs, и IHC, например как описано в Примерах.

В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает человеческое и/или cynoFcRH5 с афинностью приблизительно любой из ≤ 5 нМ, или ≤ 4 нМ, или ≤ 3 нM, или ≤ 2 нМ, или ≤ 1 нМ. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает человеческое и/или cynoFcRH5 с афинностью приблизительно ≤ 5. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает человеческое и/или cyno FcRH5 с афинностью приблизительно ≤ 4 нМ. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает человеческое и/или cynoFcRH5 с афинностью приблизительно ≤ 3 нМ. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает человеческое и/или cynoFcRH5 с афинностью приблизительно ≤2 нМ. В некоторых вариантах реализации изобретения, FcRH5 представляет собой человеческое FcRH5. В некоторых вариантах реализации изобретения, FcRH5 представляет собой FcRH5 яванских макак.

(c) не имеет перекрестной реактивности с (не связывает) FcRH1, FcRH2, FcRH3, и/или FcRH4

Способы определения связывания известны в данной области. В некоторых вариантах реализации изобретения, афинность связывания может быть определена в соответствии с анализом BIAcore®, Facs, ELISA и IHC, например как описано в Примерах.

В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает FcRH5 с афинностью более чем приблизительно любая из в 2, 5, 10, 20, 50, 100, 500, или 1000 раз превышающая афинность FcRH1, FcRH2, FcRH3, и/или FcRH4. В некоторых вариантах реализации изобретения, FcRH представляет собой человеческое FcRH.

(d) не имеет перекрестной реактивности с (не связывает) FcRH5a

Способы определения связывания известны в данной области. В некоторых вариантах реализации изобретения, афинность связывания может быть определена в соответствии с анализом BIAcore®, Facs, ELISA и IHC, например как описано в Примерах.

В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает FcRH5c с афинностью более чем приблизительно любая из в 2, 5, 10, 20, 50, 100, 500, или 1000 раз превышающая афинность thFcRH5a. В некоторых вариантах реализации изобретения, FcRH представляет собой человеческое FcRH.

(e) не имеет перекрестной реактивности с другим Ig-подобным доменом (не связывает) FcRH5

Способы определения связывания известны в данной области. В некоторых вариантах реализации изобретения, афинность связывания может быть определена в соответствии с анализом BIAcore®, Facs, ELISA и IHC, например как описано в Примерах.

В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5 с афинностью более чем приблизительно любая из в 2, 5, 10, 20, 50, 100, 500, или 1000 раз превышающая афинность Ig-подобного домена 1, 2, 3, 4, 5, 6, 7, и/или 8 FcRH5. В некоторых вариантах реализации изобретения, FcRH представляет собой человеческое FcRH. В некоторых вариантах реализации изобретения, Ig-подобный домен представляет собой Ig-подобный домен 1 (aa 23-100 SEQ ID №:1), Ig-подобный домен 2 (aa 105-185 SEQ ID №:1), Ig-подобный домен 3 (aa 188-271 SEQ ID №:1), Ig-подобный домен 4 (287-373 SEQ ID №:1), Ig-подобный домен 5 (aa 380-466 SEQ ID №:1), Ig-подобный домен 6 (aa 490-555 SEQ ID №:1), Ig-подобный домен 7 (aa 568-652 SEQ ID №:1), Ig-подобный домен 8 (aa 658-731 SEQ ID №:1).

Анализы связывания и другие анализы

В одном аспекте анти-FcRH5 антитело тестируют на активность связывания антигена. Например, в определенных вариантах реализации изобретения, анти-FcRH5 антитело тестируют на его способность связываться с FcRH5, которое экспрессируется на поверхности клетки. FACS анализ может быть использован для такого тестирования.

В иллюстративном конкурентном анализе иммобилизованное FcRH5 инкубируют в растворе, содержащем первое меченое антитело, связывающее FcRH5, и второе немеченое антитело, которое тестируют на его способность конкурировать с первым антителом для связывания FcRH5. Второе антитело может присутствовать в гибридомном супернатанте. В качестве контроля иммобилизованное FcRH5 инкубируют в растворе, содержащем первое мечено антитело, но не второе немеченое антитело. После инкубации в условиях, разрешающих связывание первого антитела и FcRH5, избыток несвязанного антитело удаляют, и измеряют количество метки, связанной с иммобилизованным FcRH5. Если количество метки, связанной с иммобилизованным FcRH5, существенно снижается в тестируемом образце по сравнению с контрольным образцом, это указывает на то, что второе антитело конкурирует с первым антителом за связывание с FcRH5. В определенных вариантах реализации изобретения, иммобилизованное FcRH5 присутствует на поверхности клетки или в мембранном препарате, полученном из клеток, экспрессирующих FcRH5 на его поверхности.

В одном аспекте, очищенные анти-FcRH5 антитела могут быть дополнительно характеризованы при помощи серии анализов, включая, но не ограничиваясь этим, N-концевое секвенирование, аминокислотный анализ, неденатурирующую эксклюзионную жидкостную хроматографию высокого давления (ЖХВД), масс-спектрометрию, ионообменную хроматографию и дигестию папаином. В одном варианте реализации изобретения, предложены измененные антитела, которые обладают некоторыми, но не всеми эффекторными функциями, которые делают его желательным кандидатом для многих применений, в которых период полураспада антитела in vivo важен, хотя некоторые эффекторные функции (такие как комплемент и ADCC) являются ненужными или вредными. В определенных вариантах реализации изобретения, активности Fc антител измеряют, чтобы обеспечить, что только желаемые свойства сохраняются. Анализы цитотоксичности in vitro и/или in vivo могут быть проведены, чтобы подтвердить уменьшение/истощение CDC и/или ADCC активности. Например, Fc-рецептор (FcR) анализы связывания могут быть проведены, чтобы гарантировать, что антитело не имеет FcR связывания (поэтому, вероятно, не имеет ADCC активности), но сохраняет FcRn связывающую способность. Первичные клетки для опосредования ADCC, NK клеток, экспрессируют Fc(RIII только тогда моноциты экспрессируют Fc(RI, Fc(RII and Fc(RIII. FcR экспрессия гематопоэтичных клеток обобщены в Таблице 3 на странице 464 Ravetch and Kinet, Annu. Rev. Immunol. 9:457-92 (1991). Пример анализа in vitro для оценки ADCC активности рассматриваемой молекулы описан в патенте США 5,500,362 или 5,821,337. Полезные эффекторные клетки для таких анализов включают периферически мононуклеарные клетки крови (РВМС) и природные киллерные (NK) клетки. Альтернативно, или дополнительно, ADCC активность рассматриваемой молекулы может быть оценена in vivo, например, в животной модели, такой как описано в Clynes et al. PNAS (USA) 95:652-656 (1998). C1q анализы связывания могут быть также выполнены, чтобы подтвердить, что антитело не может связывать C1q и поэтому отсутствует CDC активность. Чтобы оценить активацию комплемента, может быть выполнен анализ CDC, например, как описано в Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996). Определения связывания FcRn и in vivo выведения/времени полужизни также могут быть выполнены с использованием методов, известных в данной области.

1. Афинность антител

В некоторых вариантах реализации изобретения, антитело, предложенное в данном документе, имеет константу диссоциации (Kd) ≤ 1 мкМ, ≤ 100 нм, ≤ 10 нм, ≤ 1 нМ, ≤ 0,1 нМ, ≤ 0,01 нМ или ≤ 0,001 нМ, и необязательно ≥ 10-13 М. (например 10-8 М или менее, например от 10-8 М до 10-13 М, например, от 10-9 м до 10-13М).

В некоторых вариантах реализации изобретения, Kd может быть измерена с помощью радиоактивно меченого антигенсвязывающего анализа (RIA) с версией Fab рассматриваемого антитела и его антигена, как описано в следующем анализе. Аффинность связывания в растворе антигена для Fabs может быть измерена путем уравновешивания Fab минимальной концентрацией (125I)-меченого антигена в присутствии последовательности титрования немеченого антигена, и затем захвата связанного антигена планшетой, покрытой анти-Fab антитела (см , например, Chen et al., J. Mol. Biol.293:865-881(1999)). Чтобы создать условия для анализа, MICROTITER® многолуночные планшеты (Thermo Scientific) могут быть покрыты в течение ночи 5 мкг/мл захватывающего анти-Fab антитела (Cappel Labs) в 50 мМ карбоната натрия (рН 9,6), а затем блокированы 2% (масс./об.) бычьим сывороточным альбумином в PBS в течение от двух до пяти часов при комнатной температуре (приблизительно 23°С). В не-адсорбирующей планшете (Nunc 269620 #), 100 пМ или 26 пМ [125I]-антигена смешивают с серийными разведениями рассматриваемого Fab (например, в соответствии с оценкой анти-VEGF антитела, Fab-12 в Presta et al., Cancer Res. 57:4593-4599 (1997)). Рассматриваемое Fab затем инкубируют в течение ночи; однако инкубирование может продолжаться в течение длительного периода (например, приблизительно 65 часов), чтобы обеспечить достижение равновесия. После этого смеси могут быть перенесены в захватную планшету для инкубации при комнатной температуре (например, в течение одного часа). Раствор может быть затем удален и планшет промывают восемь раз 0,1% полисорбата 20 (Tween-20®) в PBS. Когда планшеты высушивают, может быть добавлено 150 мкл/лунка сцинтиллятора (MICROSCINT-20™; Packard), и планшеты могут быть подсчитаны на TOPCOUNT™ гамма-счетчике (Packard) в течение десяти минут. Концентрации каждого Fab, которые дают менее чем или ровно 20% максимального связывания, могут быть выбраны для использования в анализах конкурентного связывания.

Согласно другому варианту реализации изобретения, Kd измеряют с помощью анализов поверхностного плазмонного резонанса с использованием анализов BIACORE®-2000 или BIACORE®-3000 (BIAcore, Inc., Piscataway, NJ) при 25°С с иммобилизованными антигенными CM5 чипами на ~ 10 единиц ответа (RU). Вкратце, карбоксиметилированные декстранные биосенсорные чипы (CM5, BIACORE, Inc.) могут быть активированы N-этил-N'-(3-диметиламинопропил)-карбодиимидом (EDC) и N-гидроксисукцинимидом (NHS) в соответствии с инструкциями поставщика. Антиген может быть разбавлен 10 мМ ацетата натрия, рН 4,8, 5 мкг/мл (~ 0,2 мкМ) перед впрыскиванием со скоростью потока 5 мкл/мин до достижения приблизительно 10 единиц отклика (RU) связанного белка. После впрыскивания антигена, 1 М этаноламин может быть впрыснут, чтобы блокировать непрореагировавшие группы. Для кинетических измерений двукратные серийные разведения Fab (от 0,78 нМ до 500 нМ) могут быть впрыснуты в PBS с 0,05% полисорбата 20 (TWEEN-20TM) поверхностно-активного вещества (PBST) при 25°С при скорости потока приблизительно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) могут быть рассчитаны с помощью простой один-к-одному модели связывания Ленгмюра (BIACORE® Evaluation Software версия 3.2), одновременно используя сенсограммы подгонки ассоциации и диссоциации. Константа равновесия диссоциации (Kd) может быть рассчитана как отношение koff/kon. См., например, Chen et al., J. Mol. Biol. 293:865-881 (1999). Если скорость ассоциации превышает 106 M-1 с-1 путем анализа поверхностного плазменного резонанса, приведенного выше, то скорость ассоциации может быть определена с помощью метода флуоресцентной закалки, который измеряет увеличение или уменьшение интенсивности флуоресценции (возбуждение = 295 нм; эмиссия = 340 нм, 16 нм полоса пропускания) при 25°С в 20 нМ анти-антиген антитела (Fab форма) в PBS, рН 7,2, в присутствии возрастающих концентраций антигена, как измерено в спектрометре, таком как спектрофотометр, оборудованный устройством измерения методом остановленной струи (Aviv Instruments) или спектрофотометр 8000-й серии SLM-AMINCO™ (ThermoSpectronic) с кюветой с перемешиванием.

2. Фрагменты антитела

В определенных вариантах реализации изобретения, предложенное в данном документе антитело представляет собой фрагмент антитела. Фрагменты антитела включают, не ограничиваясь приведенным, Fab, Fab’, Fab’-SH, F(ab’)2, Fv, и scFv фрагменты и другие фрагменты, описанные ниже. Для обзора некоторых фрагментов антител, см. Hudson et al.Nat. Med. 9:129-134 (2003). Для обзора scFv фрагментов, см., например, , в The Pharmacology of Monoclonal Antibody, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); см. также WO 93/16185; и патенты США №№ 5,571,894 и 5,587,458. Для обсуждения Fab and F(ab')2 фрагментов, содержащих остатки эпитопа связывания рецептора реутилизации и имеющих увеличенный период полужизни in vivo, см. патент США 5,869,046.

Диатело представляют собой фрагменты антител с двумя антиген-связывающими сайтами, которые могут быть двухвалентным или биспецифическими. См., например, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9:129-134 (2003); и Нollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Триабоди и тетрабоди также описаны в Hudson et al., Nat. Med. 9:129-134 (2003).

Однодоменные антитела являются фрагментами антител, содержащими весь или часть вариабельного домена тяжелой цепи или весь или часть вариабельного домена легкой цепи антитела. В определенных вариантах реализации изобретения, однодоменное антитело является человеческим однодоменным антителом (Domantis, Inc., Waltham, MA; см., например, патент США № 6,248,516 B1).

Фрагменты антитела могут быть получены с помощью различных методик, в том числе, но не ограничиваясь приведенным, протеолитическое расщепление интактного антитела, а также производства рекомбинантных клеток-хозяев (например E. coli или фага), как описано в данном документе.

3. Химерные и гуманизированные антитела

В определенных вариантах реализации изобретения, предложенное в данном документе антитело представляет собой химерное антитело. Описаны некоторые химерные антитела, например, в патенте США 4,816,567; и Morrison et al.,Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). В одном примере, химерное антитело содержит нечеловеческий вариабельный участок, (например, вариабельный участок, полученный от мыши, крысы, хомяка, кролика, или не являющегося человеком примата, например, обезьяны) и человеческую константную область. В дополнительном примере, химерное антитело является антителом "с переключением класса", в котором класс или подкласс был изменен от родительского антитела. Химерные антитела включают их антиген-связывающие фрагменты.

В определенных вариантах реализации изобретения, химерное антитело является гуманизированным антителом. Как правило, не-человеческое антитело является гуманизированным для снижения иммуногенности для людей, при этом сохраняя специфику и афинность родительского не-человеческого антитела. Как правило, гуманизированное антитело содержит один или несколько вариабельных доменов, в которых HVR, например, CDR, (или их части) являются производными не-человеческого антитела и FRs (или их части) являются производными последовательностей человеческого антитела. Гуманизированное антитело необязательно также будет содержать по меньшей мере часть человеческой константной области. В некоторых вариантах реализации изобретения, некоторые FR остатки в гуманизированном антителе замещены соответствующими остатками не-человеческого антитела (например, антитела, из которого получены остатки HVR), например, для восстановления или улучшения специфичности или сродства антитело.

Гуманизированные антитела и способы их получения описаны, например, в Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), и дополнительно описаны, например, в Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat’l Acad. Sci. USA 86:10029-10033 (1989); US Patent Nos. 5, 821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing SDR (a-CDR) трансплантация); Padlan, Mol. Immunol. 28:489-498 (1991) (описывает “изменение поверхности”); Dall’Acqua et al., Methods 36:43-60 (2005) (описывает “FR тасовку”); и Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83:252-260 (2000) (описыает подход “направленной селекции” к FR тасовке).

Человеческие каркасные участки, которые могут быть использованы для гуманизации, включают, не ограничиваясь приведенным: каркасные участки, выбранные с использованием метода "наилучшей подгонки" (см., например, Sims et al. J. Immunol. 151:2296 (1993)); каркасные участки, полученные из консенсусной последовательности человеческого антитела конкретной подгруппы вариабельных областей легкой или тяжелой цепи (см., например, Carter et al.Proc. Natl. Acad. Sci. USA, 89:4285 (1992); и Presta et al.J. Immunol., 151:2623 (1993)); человеческие зрелые (соматически мутированные) каркасные участки или каркасные участки человеческой зародышевой линии (см., например, Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); и каркасные участки, полученные путем скрининга FR библиотек (см., например, Baca et al., J. Biol. Chem. 272:10678-10684 (1997) и Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).

4. Человеческие антитела

В определенных вариантах реализации изобретения, предложенное в данном документе антитело представляет собой человеческое антитело. Человеческие антитела могут быть получены при помощи различных методов, известных в данной области. Человеческие антитела в общем описаны в van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).

Человеческие антитела могут быть получены путем введения иммуногена в трансгенное животное, который было модифицировано, чтобы произвести интактные человеческие антитела или интактные антитела с человеческими вариабельными областями в ответ на антигенную стимуляцию. Такие животные обычно содержат все или часть человеческих иммуноглобулиновых локусов, которые заменяют эндогенные иммуноглобулиновые локусы, или которые присутствуют внехромосомно или интегрированы в хромосомы животного случайным образом. У таких трансгенных мышей, эндогенные иммуноглобулиновые локусы, как правило, инактивированы. Обзор методов получения человеческого антитела из трансгенных животных, см. Lonberg, Nat. Biotech. 23:1117-1125 (2005). См. также, например, патенты США №№ 6,075,181 и 6,150,584, описывающие технологию XENOMOUSE™; патент США № 5,770,429, описывающий технологию HuMab®; патент США № 7,041,870, описывающий технологию K-M MOUSE®, и публикацию патентной заявки США № US 2007/0061900, описывающую технологию VelociMouse®). Человеческие вариабельные области интактного антитела, генерированные такими животными, могут быть дополнительно изменены, например, путем объединения с другим человеческим константным участком.

Человеческие антитела могут быть также получены способами на гибридомной основе. Были описаны человеческие миеломные и мышино-человеческие гетеромиеломные клеточные линии для производства человеческого моноклонального антитела. (См., например, Kozbor J. Immunol., 133: 3001 (1984); BrodЕСr et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); и Boerner et al., J. Immunol., 147: 86 (1991). Человеческие антитела, полученные посредством человеческой B-клеточной гибридомной технологии, также описаны в Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Дополнительные способы включают описанные, например в патенте США № 7,189,826 (описывает продуцирование моноклонального человеческого IgM антитела из гибридомных клеточных линий) и Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (описывает гибридомы человек-человек). Человеческая гибридомная технология (Trioma technology) также описана в Vollmers and Brandlein, Histology и Нistopathology, 20(3):927-937 (2005) и Vollmers and Brandlein, Methods and Findings in Experimental и Сlinical Pharmacology, 27(3):185-91 (2005).

Человеческие антитела могут быть также получены путем выделения последовательностей вариабельного домена Fv клона, выбранного из человеческих библиотек фагового дисплея. Такие последовательности вариабельных доменов могут затем быть скомбинированы с желательным человеческим константным доменом. Методы выделения человеческого антитела из библиотек антител описаны ниже.

5. Антитела, полученные из библиотек

Антитела, предложенные в данном документе, могут быть выделены путем скрининга комбинаторных библиотек на антитела с желаемой активностью или активностями. Например, в данной области известны различные методы для генерации библиотек фагового дисплея и для скрининга таких библиотек на антитела, обладающие желаемыми характеристиками связывания. Такие методы рассмотрены, например, в Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O’Brien et al., ed., Human Press, Totowa, NJ, 2001) и дополнительно описаны, например, в McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, в Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, NJ, 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004).

В некоторых методах фагового дисплея, репертуары VH и VL генов отдельно клонируют с помощью полимеразной цепной реакции (ПЦР) и рекомбинируют в случайном порядке фаговые библиотеки, которые затем могут быть подвергнуты скринингу на антигенсвязывающий фаг, как описано в Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Фаги, как правило, отображают фрагменты антитела, либо как одноцепочечные Fv (ScFv) фрагменты или как Fab фрагменты. Библиотеки из иммунизированных источников обеспечивают высокую аффинность антитела к иммуногену без необходимости построения гибридом. В качестве альтернативы, необученный репертуар можно клонировать (например, от человека), чтобы обеспечить единый источник антитела до широкого спектра не-ауто, а также аутоантигенов без иммунизации, как описано Griffiths et al., EMBO J, 12: 725-734 (1993). Наконец, необученный репертуар может быть также получен синтетическим путем клонирования нереаранжированных сегментов V-гена из стволовых клеток, и с помощью ПЦР-праймеров, содержащих случайную последовательность для кодирования высоко вариабельных областей CDR3 и для достижения перегруппировок in vitro, как описано Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992). Патентные публикации, описывающие фаговые библиотеки человеческих антител включают, например: патент США № 5,750,373 и публикации патентов США №№ 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936. и 2009/0002360. Антитела или фрагменты антител, выделенные из библиотек человеческих антител рассматривают в данном документе как человеческие антитела или фрагменты человеческих антител.

6. Мультиспецифические антитела

В определенных вариантах реализации изобретения, предложенное в данном документе антитело является мультиспецифическим антителом, например биспецифическим антителом. Мультиспецифические антитела представляют собой моноклональные антитела, имеющие специфичности связывания для по меньшей мере двух различных сайтов. В определенных вариантах реализации изобретения, одна из специфичностей связывания предназначена для FcRH5 и другая для любого другого антигена. В определенных вариантах реализации изобретения, одна из специфичностей связывания предназначена для FcRH5 и другая для СD3. См., например, патент США 5,821,337. В определенных вариантах реализации изобретения, биспецифические антитела могут связывать два различные эпитопа FcRH5. Биспецифические антитела могут быть также использованы для локализации цитотоксических агентов к клеткам, экспрессирующим FcRH5. Биспецифические антитела могут быть получены как полноразмерные антитела или фрагменты антител.

В некоторых вариантах реализации изобретения, FcRH5 антитела являются FcRH5 биспецифическими антителами. Биспецифические антитела являются антителами, которые обладают специфичностью связывания для по меньшей мере двух различных эпитопов. Иллюстративные биспецифичные антитела могут связываться с двумя различными эпитопами белка FcRH5, как описано в данном документе. Другие такие антитела могут скомбинировать сайт связывания FcRH5 с сайтом связывания для другого белка. Альтернативно, анти-FcRH5 плечо может быть объединен с плечом, которое связывается со стимулирующей молекулой на лейкоците, такой как молекула Т-клеточного рецептора (например CD3), или Fc рецепторы для IgG (FcγR), такие как FcγRI (CD64), FcγRII (CD32) and FcγRIII (CD16), с тем чтобы сконцентрировать и локализовать клеточные защитные механизмы FcRH5-экспрессирующих клеток. Биспецифические антитела могут быть также использованы для локализации цитотоксических агентов в клетки, которые экспрессируют FcRH5. Эти антитела обладают FcRH5-связывающим плечом и плечом, которое связывает цитотоксический агент (например, сапорин, анти-интерферон α алкалоида барвинка, А цепь рицина, метотрексат либо радиоактивный изотоп гаптен). Биспецифические антитела могут быть получены как полноразмерные антитела или фрагменты антител (например, F(ab')2 биспецифические антитела). В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

В некоторых вариантах реализации изобретения, FcRH5 биспецифическое антитело содержит первый рычаг, где первый рычаг связывает FcRH5 и второе плечо, где второе плечо связывает Fc. Второе плечо FcRH5 биспецифического антитела может быть любым анти-Fc антителом, известным в данной области. Например, WO 96/16673 описывает биспецифическое анти-ErbB2/анти-FcγRIII антитело и патент США № 5,837,234 раскрывает биспецифическое анти-ErbB2/анти-FcγRI антитело. Биспецифическое анти- ErbB2/Fcα антитело показано в WO98/02463. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитела связывает Ig-подобный домен 9 FcRH5c.

В некоторых вариантах реализации изобретения, FcRH5 биспецифическое антитело содержит первое плечо, где первое плечо связывает FcRH5 и второе плечо, где второе плечо связывает CD3. Второе плечо FcRH5 биспецифического антитела может быть любым анти-CD3 антителом, известным в данной области. Патенты США №№ ,821,337 и 6,407,213 описывают биспецифическое анти-ErbB2/анти-CD3 антитело. Дополнительные биспецифические антитела, которые связываются с эпитопом на антигене CD3 и вторым эпитопом, были описаны. См., например, патент США № 5,078,998 (анти-CD3/антиген опухолевой клетки); патент США № 5,601,819 (анти-CD3/IL-2R; анти-CD3/CD28; анти-CD3/CD45); патент США № 6,129,914 (анти-CD3/антиген злокачественных В-клеток); патент США № 7,112,324 (анти-CD3/CD19); патент США № 6,723,538 (анти-CD3/CCR5); патент США № . 7,235,641 (анти-CD3/ЕрСАМ); патент США № 7,262,276 (анти-CD3/антиген опухоли яичников); и патент США № 5,731,168 (анти-CD3/CD4IgG), которые включены в качестве ссылки во всей их полноте. В некоторых вариантах реализации изобретения, анти-CD3 антитело второго плеча представляет собой антитело, как описано в любом из WO 2005/118635, WO2007/042261, WO2008/119567, US5929212, US6750325, US6491916, US7994289, US7993641, US6706265, US5585097, US5968509, US5932448, US6129914, US7381803, US5834597, и US7862813, которые включены посредством ссылки во всей их полноте. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитела связывает Ig-подобный домен 9 FcRH5c.

Методы получения мультиспецифичного антитела включают, не ограничиваясь приведенным, рекомбинантную коэкспрессию двух пар тяжелых цепей и легких цепей иммуноглобулина, имеющих различные специфичности (см Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and Traunecker et al., EMBO J. 10: 3655 (1991)), и инженерию "ручка в отверстие" (см например, патент США № 5,731,168). Мультиспецифичные антитела также могут быть получены при помощи инженерно электростатически рулевых эффектов для получения Fc-гетеродимерны молекул антител (WO 2009/089004A1); сшивания двух или более антител или фрагментов (см например, патент США № 4,676,980, и Brennan et al., Science, 229: 81 (1985)); использование лейциновых молнии, чтобы получить би-специфические антитела (см. например, Kostelny et al., J. Immunol., 148(5):1547-1553 (1992)); с помощью технологии "диатело" для фрагментов биспецифического антитела (см например, Hollinger et al.,Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); и с помощью одноцепочечных Fv (sFv) димеров (см. например Gruber et al.,J. Immunol., 152:5368 (1994)); и получением триспецифичного антитела, как описано, например, в Tutt et al.J. Immunol. 147: 60 (1991).

Разработанные методами генной инженерии антитела с тремя или более функциональными антигенсвязывающими сайтами, в том числе "мультивалентные антитела" также включены в данный документ (см. например US 2006/0025576A1).

.Антитело или фрагмент в данном документе, также "Fab двойной активности" или "DAF", содержащий сайт связывания антигена, связывающего FcRH5, а также еще один, другой антиген (см. US 2008/0069820, например).

Согласно другому подходу, вариабельные домены антитела с желаемой специфичностью связывания (антитело-антиген связывающими участками) гибридизуют с последовательностями константных доменов иммуноглобулинов. Предпочтительно, гибридизацию проводят с константным доменом тяжелой цепи Ig, содержащим по меньшей мере часть шарнирных, CH2, и CH3 областей. Предпочтительно иметь первую константную область тяжелой цепи (CH1), содержащую сайт, необходимый для связывания легкой цепи, присутствующий в по меньшей мере в одном из гибридов. ДНК, кодирующие гибриды иммуноглобулиновых тяжелых цепей и, при желании, иммуноглобулиновых легких цепей, встраивают в отдельные экспрессирующие векторы и совместно трансфицируют в подходящую клетку-хозяин. Это обеспечивает большую гибкость при корректировке взаимных соотношений трех полипептидных фрагментов в вариантах реализации изобретения, когда неравные соотношения трех полипептидных цепей, используемых в конструкции, дают оптимальный выход целевого биспецифического антитела. Однако, можно вставить кодирующие последовательности для двух или всех трех полипептидных цепей в один вектор экспрессии, когда экспрессия по меньшей мере двух полипептидных цепей в равных соотношениях приводит к высоким выходам или когда соотношения не имеют значительного воздействия на выход целевой комбинации цепи.

В некоторых вариантах реализации изобретения, биспецифические антитела состоят из гибридной тяжелой цепи иммуноглобулина с первой специфичностью связывания в одном плече, и гибридной пары тяжелой цеп и легкой цепи иммуноглобулина (обеспечивающей вторую специфичность связывания) в другом плече. Было обнаружено, что такая асимметричная структура облегчает отделение нужного биспецифического соединения от нежелательных комбинаций иммуноглобулиновых цепей, поскольку присутствие легкой цепи иммуноглобулина только в одной половине биспецифической молекулы обеспечивает легкий способ разделения. Этот подход описан в WO 94/04690. Дополнительное подробное описание генерации биспецифических антител см., например, Suresh et al., Methods in Enzymology 121:210 (1986).

В соответствии с другим подходом, описанным в патенте США № 5,731,168, поверхность раздела между парой молекул антитела может быть получена методами генной инженерии, чтобы максимизировать процент гетеродимеров, которые выделяют из культуры рекомбинантных клеток. Предпочтительная поверхность раздела содержит по меньшей мере часть домена CH3. В этом методе одну или несколько небольших боковых цепей аминокислот из поверхности раздела первой молекулы антитела заменяют более крупными боковыми цепями (например, тирозином или триптофаном). Компенсационные "полости" идентичного или сходного размера более крупной боковой цепи (ей) создаются на поверхности раздела второй молекулы антитела путем замены более крупных боковых цепей аминокислот меньшими (например, аланином или треонином). Это обеспечивает механизм повышения выхода гетеродимера по сравнению с другими нежелательными конечными продуктами, такими как гомодимеры. Биспецифические антитела, которые получают в соответствии с этим подходом, называются в данном документе антителами "hole-into-knob".

Биспецифические антитела включают сшитые или "гетероконъюгатные" антитела. Например, одно из антител в гетероконъюгате может быть связано с авидином, а другое с биотином. Такие антитела были, например, предложены для нацеливания клеток иммунной системы на нежелательные клетки (патент США № 4,676,980), и для лечения ВИЧ-инфекции (WO 91/00360, WO 92/200373, и EP 03089). Гетероконъюгатные антитела могут быть получены с использованием любых удобных поперечносшивающих методов. Подходящие агенты поперечной сшивки хорошо известны в данной области и описаны в патенте США № 4,676,980, а также при помощи ряда поперечносшивающих методов.

Методы получения биспецифических антител из фрагментов антител также были описаны в литературе. Например, биспецифические антитела могут быть получены с использованием химического связывания. Brennan et al., Science 229:81 (1985) описал способ, в котором интактные антитела протеолитически расщепляют с получением F(ab')2 фрагментов. Эти фрагменты восстанавливают в присутствии дитиольного комплексообразующего агента, арсенита натрия, для стабилизации вицинальных дитиолов и предотвращения образования межмолекулярных дисульфидных связей. Полученные Fab'-фрагменты затем превращают в производные тионитробензоата (TNB). Одно из производных Fab'-TNB затем превращают в Fab'-тиол восстановлением меркаптоэтиламином и смешивают с эквимолярным количеством другого производного Fab'-TNB с образованием биспецифического антитела. Полученные биспецифические антитела могут быть использованы в качестве агентов для селективной иммобилизации ферментов.

Fab'-SH-фрагменты из E. coli могут быть непосредственно выделены и химически связаны с образованием биспецифического антитела Shalaby et al., J. Exp. Med. 175: 217-225 (1992) описывают получение молекулы полностью гуманизированного биспецифического антитела F(ab')2. Каждый Fab'-фрагмент отдельно секретировали из E. coli и подвергали прямому химическому связыванию in vitro с образованием биспецифического антитела. Биспецифическое антитело, полученное таким образом, могло связываться с клетками с чрезмерной экспрессией рецептора ErbB2 и нормальных человеческих Т-клеток, а также запускать литическую активность цитотоксических лимфоцитов человека против мишеней опухоли молочной железы человека.

Различные способы получения и выделения фрагментов биспецифических антител непосредственно из культуры рекомбинантных клеток также были описаны. Например, биспецифические антитела были получены с использованием лейциновых молний. Kostelny et al., J. Immunol. 148(5):1547-1553 (1992). Пептиды лейциновых молний из белков Fos и Jun были связаны с частями Fab' двух разных антител посредством генной гибридизации. Гомодимеры антител восстанавливали в шарнирной области с образованием мономеров, а затем снова окисляли с образованием гетеродимеров антител. Этот метод также может быть использован для производства гомодимеров антител. Технология "диатела", описанная Hollinger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993), предоставила альтернативный механизм получения фрагментов биспецифических антител. Фрагменты содержат VH, соединенные с V линкером, который является слишком коротким, чтобы позволить спаривание между двумя доменами на той же цепи. Соответственно, VH и VL домены одного фрагмента вынуждены спариваться с комплементарными VL и V доменами другого фрагмента, тем самым образуя два антигенсвязывающих сайта. Также сообщалась другая стратегия получения фрагментов биспецифических антител с использованием одноцепочечных Fv (sFv) димеров. См. Gruber et al., J. Immunol., 152:5368 (1994).

Описаны антитела с более чем двумя валентностями. Например, могут быть получены триспецифические антитела. Tutt et al., J. Immunol. 147:60 (1991).

8. Варианты антител

В определенных вариантах реализации изобретения, описаны варианты аминокислотной последовательности антитела, предложенного в данном документе. Например, может быть желательным улучшить аффинность связывания и/или другие биологические свойства антитела. Варианты аминокислотной последовательности антитела могут быть получены путем введения соответствующих изменений в нуклеотидную последовательность, кодирующую антитело, или путем пептидного синтеза. Такие модификации включают, например, делеции из, и/или вставки в и/или замещения остатков в аминокислотной последовательности антитела. Любая комбинация делеции, инсерции и замещения может быть выполнена, чтобы получить конструкт, при условии, что конечный конструкт обладает желаемыми характеристиками например, антиген-связывающими.

а) Варианты замещения, инсерции и делеции

В определенных вариантах реализации изобретения, предложены варианты антитела, содержащего одну или более аминокислотных замещений. Рассматриваемые сайты для заместительного мутагенеза включают HVRs и FRs. Консервативные замещения представлены в Таблице 1 под заголовком "предпочтительные замещения". Более существенные изменения приведены в Таблице1 под заголовком "иллюстративные замещения", и, как описано дополнительно ниже, со ссылкой на классы аминокислотных боковых цепей. Аминокислотные замещения могут быть введены в рассматриваемые антитела и продукты, которые подвергали скринингу на предмет желаемой активности, например, сохраненного/улучшенного связывания антигена, снижения иммуногенности, или улучшения ADCC или СDC.

ТАБЛИЦА 1

Исходный остаток Иллюстративные замещения Предпочтительные замещения
Ala (A) Val; LЕС; Ile Val
Arg (R) Lys; Gln; Asn Lys
Asn (N) Gln; His; Asp, Lys; Arg Gln
Asp (D) Glu; Asn Glu
Cys (C) Ser; Ala Ser
Gln (Q) Asn; Glu Asn
Glu (E) Asp; Gln Asp
Gly (G) Ala Ala
His (H) Asn; Gln; Lys; Arg Arg
Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu
Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile
Lys (K) Arg; Gln; Asn Arg
Met (M) Leu; Phe; Ile Leu
Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr (Y) Trp; Phe; Thr; Ser Phe
Val (V) Ile; Leu; Met; Phe; Ala; NorlЕСcine Leu

Аминокислоты могут быть сгруппированы в соответствии с общими свойствами боковой цепи:

(1) гидрофобные: норлейцин, Met, Ala, Val, Leu, Ile;

(2) нейтральные гидрофильные: Cys, Ser, Thr, Asn, Gln;

(3) кислые: Asp, Glu;

(4) основные: Его, Lys, Arg;

(5) остатки, влияющие на ориентацию цепи: Gly, Pro;

(6) ароматические: Trp, Tyr, Phe.

Неконсервативные замещения повлекут замену члена одного из этих классов на другой класс.

Один тип заместительного варианта предполагает замещение одного или более остатков гипервариабельной области родительского антитела (например гуманизированного или человеческого антитела). Как правило, полученный в результате вариант(ы), выбранные для дополнительного исследования, будут иметь модификации (например, улучшение) определенных биологических свойств (например, увеличение афинности, снижения иммуногенности) по сравнению с родительским антителом и/или будет иметь существенно сохраненные определенные биологические свойства родительского антитело. Иллюстративный заместительный вариант является аффинно зрелым антителом, которое может быть удобно создано, например, с использованием методов аффинности созревания на основе фагового дисплея, такого как описано в данном документе. Вкратце, один или более остатков HVR подвергают мутации и вариант антитела отображают на фаге и подвергают скринингу на предмет конкретной биологической активности (например аффинности связывания).

Изменения (например, замещения) могут быть выполнены в HVR, например, чтобы улучшить афинность антител. Такие изменения могут быть выполнены в HVR "горячих точках", т.е. остатках, кодируемых кодонами, которые подвергаются мутации при высоких частотах при соматическом процессе созревания (см например, Chowdhury, Methods Mol. Biol. 207:179-196 (2008)), и/или SDRs (a-CDRs), с полученным в результате вариантом VH или VL, который тестируют на афинность связывания. Созревание афинности путем конструирования и повторного отбора из вторичных библиотек было описано, например, в Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O’Brien et al., ed., Human Press, Totowa, NJ, (2001)). В некоторых вариантах реализации созревания аффинности, вариабельность вводят в вариабельные гены, выбранные для созревания с помощью любого из разнообразных методов (например, подверженного ошибкам ПЦР, перестановки цепей или олигонуклеотид-направленного мутагенеза). Затем создают вторичную библиотеку. Затем эту библиотеку скринировали для идентификации любых вариантов антитела с желательной аффинностью. Другой способ введения вариабельности включает HVR-направленные подходы, в которых несколько остатков HVR (например, 4-6 остатков одновременно) рандомизированы. HVR остатки, участвующие в связывании антигена, могут быть конкретно определены, например, с помощью аланин-сканирующего мутагенеза или моделирования. CDR-H3 и CDR-L3, в частности, часто становятся мишенями.

В определенных вариантах реализации изобретения, замещения, инсерции или делеции, могут иметь место внутри одного или нескольких HVR до тех пор, пока такие изменения не будут существенно уменьшать способность антитела связывать антиген. Например, консервативные изменения (например, консервативные замещения, как предложено в данном документе), которые существенно не снижают аффинность связывания, могут быть выполнены в HVR. Такие изменения могут быть вне HVR «горячих точек» или SDRs. В определенных вариантах реализации изобретения варианта VH и VL последовательностей, приведенных выше, каждый HVR либо не изменен, либо содержит более чем одно, два или три аминокислотных замещений.

Полезный способ идентификации остатков либо участков антитела, которое может быть направлено для мутагенеза, называется "аланин сканирующим мутагенезом", как описано Cunningham and Wells (1989) Science, 244:1081-1085. В этом методе остаток или группу остатков-мишеней (например, заряженных остатков, таких как rg, asp, his, lys, and glu) идентифицируют и замещают нейтральной или негативно заряженной аминокислотой (например, аланином или полиаланином), чтобы определить, влияет ли это на взаимодействие антитела с антигеном. Дополнительные замещения могут быть введены в аминокислотных местах, показывающих функциональную чувствительность к начальным замещениям. Альтернативно или дополнительно, кристаллическую структуру комплекса антиген-антитело используют для идентификации точек контакта между антителом и антигеном. Такие контактные остатки и соседние остатки могут быть направлены или ликвидированы в качестве кандидатов для замещения. Варианты могут быть подвергнуты скринингу для определения, имеют ли они желаемые свойства.

Инсерции аминокислотных последовательностей включают амино- и/или карбокси-концевые гибридизации в диапазоне длин от одного остатка до полипептидов, содержащих сто или более остатков, а также инсерции вне последовательностей единичных или множественных остатков аминокислот. Примеры концевых инсерций включают антитело с N-концевым остатком метионила. Другие инсерционные варианты молекулы антитела включают гибридизацию N- или С-конца антитела к ферменту (например для ADEPT) или полипептида, который увеличивает время полужизни сыворотки антитела.

b) Варианты гликозилирования

В определенных вариантах реализации изобретения, антитело, предложенное в данном документе, изменено, чтобы увеличить или уменьшить степень, в которой антитело гликозилировано. Добавление или делеция сайтов гликозилирования антитела может быть достигнуто посредством изменения аминокислотной последовательности таким образом, что один или более сайтов гликозилирования создается либо удаляется.

Если антитело содержит Fc участок, углевод, который присоединен к нему, может быть изменен. Нативные антитела, которые вырабатываются клетками млекопитающих, обычно содержат разветвленный, биантеннарный олигосахарид, как правило, связанный с помощью N-связи в Asn297 CH2 домена Fc участка. См., например, Wright et al.TIBTECH 15:26-32 (1997). Олигосахариды могут включать различные углеводы, например, маннозу, N-ацетил глюкозамин (GlcNAc), галактозу и сиаловую кислоту, а также фукозу, присоединенную к GlcNAc в "стволе" биантеннарной структуры олигосахаридов. В некоторых вариантах реализации изобретения, модификации олигосахаридов в антителе, предложенном в данном документе, могут быть выполнены для того, чтобы создать варианты антитела с некоторыми улучшенными свойствами.

В одном варианте реализации изобретения, предложены варианты антитела, имеющие углеводную структуру, в которой отсутствует фукоза, присоединенная (непосредственно или опосредованно) к Fc участку. Например, количество фукозы в таком антителе может составлять от 1% до 80%, от 1% до 65%, от 5% до 65% или от 20% до 40%. Количество фукозы определяют путем вычисления среднего количества фукозы в сахарной цепи на Asn297, по отношению к сумме всех гликоструктур, прикрепленных к Asn 297 (например, комплексных, гибридных и высокоманнозных структур), как измерено при помощи MALDI-TOF масс-спектрометрии, как описано в WO 2008/077546, например. Asn297 относится к аспарагиновому остатку, который находится приблизительно в положении 297 в Fc участке (ЕС нумерация остатков Fc участка); однако, Asn297 также могут быть расположены на приблизительно ± 3 аминокислот выше или ниже положения 297, т.е. между положениями 294 и 300, ввиду незначительных изменений в последовательности в антителе. Такие варианты фукозилирования могут иметь улучшенную функцию ADCC. См., например, патентные публикации США 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Примеры публикаций, относящиеся к “дефукозилированным” или “имеющим дефицит фукозы” вариантам антител включают: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Примеры клеточных линий, способных продуцировать дефукозилированные антитела, включают Lec13 CHO клетки, лишенные фукозилирования белка (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); патентная заявка США № US 2003/0157108 A1, Presta, L; и WO 2004/056312 A1, Adams et al., в особенности Пример 11) и нокаутированные клеточные линии, такие как ген альфа-1,6-фукозилтрансферазы, FUT8, нокаутированные клетки СНО (см., например, Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); и WO2003/085107).

Варианты антител дополнительно обеспечены разделенными пополам олигосахаридами, например, в которых биантеннарный олигосахарид, присоединенный к Fc участку антитела, разделен пополам GlcNAc. Такие варианты антител могут иметь уменьшенное фукозилирование и/или улучшенную функцию ADCC. Примеры таких вариантов антител описаны, например, в WO 2003/011878 (Jean-Mairet et al.); в патенте США № 6602684 (Umana et al.); и US 2005/0123546 (Umana et al.). Также предложены варианты антител с по меньшей мере одним остатком галактозы в олигосахариде, прикрепленном к Fc участку. Такие варианты антител могут иметь улучшенную функцию CDC. Такие варианты антител описаны, например, в WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); и WO 1999/22764 (Raju, S.).

c) Варианты Fc участка

В определенных вариантах реализации изобретения, одна или несколько модификаций аминокислот могут быть введены в Fc участок антитела, предложенного в данном документе, тем самым формируя вариант Fc участка. Вариант Fc участка может содержать человеческую последовательность Fc участка (например, Fc участок человеческого IgG1, IgG2, IgG3 или IgG4), содержащий аминокислотную модификацию (например, замещение) в одном или более аминокислотных положений.

В определенных вариантах реализации изобретения, данное изобретение предусматривает вариант антитела, который обладает некоторыми, но не всеми эффекторными функциями, которые делают его желаемым кандидатом для применений, в которых период полужизни антитела in vivo является важным, но некоторые эффекторные функции (такие как комплемента и ADCC) являются ненужными или вредными. In vitro и/или in vivo анализы цитотоксичности могут быть проведены, чтобы подтвердить уменьшения/истощения CDC и/или ADCC деятельности. Например, анализы связывания Fc-рецептора (FcR) могут быть проведены, чтобы гарантировать, что антитело не имеет FcγR связывания (поэтому, вероятно, не имеет ADCC активности), но сохраняет FcRn связывающую способность. Первичные клетки для опосредования ADCC, NK-клетки, экспрессируют только Fc(RIII, в то время как моноциты экспрессируют Fc(RI, Fc(RII и Fc(RIII. FcR экспрессия гематопоэтических клеток подытожена в Таблице 3 на странице 464 Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Неограничивающие примеры анализов in vitro для оценки ADCC активности рассматриваемой молекулы описаны в патенте США № 5,500,362 (см., например, Hellstrom, I. et al.Proc. Nat’l Acad. Sci. USA 83:7059-7063 (1986)) и Нellstrom, I et al., Proc. Nat’l Acad. Sci. USA 82:1499-1502 (1985); 5,821,337 (см. Bruggemann, M. et al., J. Exp. Med. 166:1351-1361 (1987)). Альтернативно, могут быть использованы методы нерадиоактивных анализов (см, например, тест нерадиоактивной цитотоксичности ACTI™для проточной цитометрии (CellTechnology, Inc. Mountain View, CA; и CytoTox 96® нерадиоактивной цитотоксичности (Promega, Madison, WI). Полезные эффекторные клетки для таких анализов включают мононуклеарные клетки периферической крови (РВМС) и природные киллерные (NK) клетки. Альтернативно или дополнительно, ADCC-активность рассматриваемой молекулы может быть оценена in vivo, например, в животной модели, такой как раскрыто в Clynes et al.Proc. Nat’l Acad. Sci. USA 95:652-656 (1998). C1q анализы связывания могут быть выполнены, чтобы подтвердить, что антитело не может связывать C1q и поэтому отсутствует CDC активность. См., например, C1q и С3c связывающую ELISA в WO 2006/029879 и WO 2005/100402. Для оценки активации комплемента, может быть выполнен анализ CDC (см, например, Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996); Cragg, M.S. et al., Blood 101:1045-1052 (2003); и Cragg, M.S. and M.J. Glennie, Blood 103:2738-2743 (2004)). Связывание FcRn и in vivo/полураспада определения также может быть выполнена с использованием известных в данной области методов (см, например, Petkova, S.B. et al., Int’l. Immunol. 18(12):1759-1769 (2006)).

Антитела с пониженной эффекторной функцией включают антитела с замещением одного или более остатков Fc участка 238, 265, 269, 270, 297, 327 и 329 (патент США № 6,737,056). Такие Fc мутанты включают Fc мутанты с замещениями в двух или более аминокислотных положениях 265, 269, 270, 297 и 327, в том числе так называемый "DANA" Fc мутант с замещением остатков 265 и 297 на аланин (патент США № 7,332,581).

Некоторые варианты антител с улучшенным или уменьшенным связыванием с FcRs описаны. (См., например, патент США № 6737056; WO 2004/056312, и Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001)).

В определенных вариантах реализации изобретения, вариант антитела включает Fc участок с одним или несколькими аминокислотными замещениями, которые улучшают ADCC, например, замещения в положениях 298, 333, и/или 334 Fc участка (ЕС нумерация остатков).

В некоторых вариантах реализации изобретения, изменения выполнены в участке Fc, и они приводят к измененному (т.е. либо улучшенному или уменьшенному) C1q связыванию и/или комплементу цитотоксичности (CDC), например, как описано в патенте США № 6194551, WO 99/51642, и Idusogie et al. J. Immunol. 164: 4178-4184 (2000).

Антитела с увеличенными периодами полужизни и улучшенным связыванием с неонатальным Fc-рецептором (FcRn), который отвечает за перенос материнских IgG к плоду (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), описаны в US2005/0014934A1 (Hinton et al.). Эти антитела содержат Fc участок с одним или несколькими замещениями в нем, которые улучшают связывание Fc участка с FcRn. Такие варианты Fc включают варианты с замещениями в одном или нескольких остатков Fc участка: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 или 434, например, замещение остатка 434 Fc участка (патент США № 7371826).

См.те также Duncan & Winter, Nature 322:738-40 (1988); патент США № 5648260; патент США №5624821; и WO 94/29351, касающиеся других примеров вариантов Fc участка.

d) Варианты антитела, сконструированные с цистеином

В определенных вариантах реализации изобретения, может быть желательно создать сконструированные с цистеином антитела, например, "thioMAbs", в которых один или несколько остатков антитела замещены остатками цистеина. В конкретных вариантах реализации изобретения замещенные остатки встречаются в доступных участках антитела. Путем замещения этих остатков на цистеин, реактивные тиольные группы, таким образом, расположены на участках, доступных антителу, и могут быть использованы для конъюгации антитела к другим фрагментам, таким как фрагменты лекарственного средства или фрагменты линкер-лекарственное средство, чтобы создать иммуноконъюгат, как дополнительно описано в данном документе. В определенных вариантах реализации изобретения, любой один или более из следующих остатков может быть замещен цистеином: V205 (Kabat нумерация) легкой цепи; A118 (нумерация ЕС) тяжелой цепи; и S400 (нумерация ЕС) в тяжелой цепи Fc участка. Сконструированные с цистеином антитела могут быть получены, как описано, например, в патенте США № 7521541.

e) Производные антител

В определенных вариантах реализации изобретения, антитело, предложенное в данном документе, может быть дополнительно модифицировано, чтобы содержать дополнительные небелковые молекулы, которые известны в данной области и легко доступны. Фрагменты, подходящие для дериватизации антитела, включают, но не ограничиваются ими, водорастворимые полимеры. Неограничивающие примеры водорастворимых полимеров включают, не ограничиваясь приведенным, полиэтиленгликоль (ПЭГ), сополимеры этиленгликоля/пропиленгликоля, карбоксиметилцеллюлозу, декстран, поливиниловый спирт, поливинилпирролидон, поли-1,3-диоксолан, поли-1,3,6-триоксан, сополимер этилена/малеинового ангидрида, полиаминокислоты (гомополимеры либо статистические сополимеры), и декстран или поли(п-винилпирролидон)полиэтиленгликоль, гомополимеры пропиленгликоля, сополимеры полипропиленоксида/этиленоксида, полиоксиэтилированные полиолы (например, глицерин), поливиниловый спирт и их смеси. Полиэтиленгликоль пропионовый альдегид может иметь преимущества в производстве из-за его стабильности в воде. Полимер может иметь любую молекулярную массу и может быть разветвленным или неразветвленным. Количество полимеров, присоединенных к антителу, может варьироваться, и если более чем один полимер присоединен, они могут быть одинаковыми или различными молекулами. В общем, количество и/или тип полимеров, используемых для дериватизации, могут быть определены на основе соображений, включая, но не ограничиваясь этим, конкретные свойства или функции антитело, которое подлежит улучшению, будет ли использоваться производное антитела в терапии при определенных условиях, и т.д.

В другом варианте реализации изобретения предложены конъюгаты антитела и небелковых фрагментов, которые могут быть выборочно нагреты посредством воздействия излучения. В одном варианте реализации изобретения небелковый фрагмент представляет собой углеродную нанотрубку (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). Излучение может быть любой длины волны, и включает, но не ограничиваясь приведенным, длины волн, которые не вредят обычным клеткам, но которые нагревают небелковый фрагмент до температуры, при которой клетки, близкие к антитело-небелковому фрагменту, погибают.

B. Рекомбинатные способы и композиции

Антитела могут быть получены с использованием рекомбинантных способов и композиций, например, как описано в патенте США № 4816567. В одном варианте реализации изобретения предложена выделенная нуклеиновая кислота, кодирующая анти-FcRH5 антитело, описанное в данном документе. Такая нуклеиновая кислота может кодировать аминокислотную последовательность, содержащую VL и/или аминокислотную последовательность, содержащую VH антитела (например, легких и/или тяжелых цепей антитела). В дополнительном варианте реализации изобретения предложены один или более векторов (например, векторы экспрессии), содержащие такие нуклеиновые кислоты. В дополнительном варианте реализации изобретения предложена клетка-хозяин, содержащая такие нуклеиновые кислоты. В одном таком варианте реализации изобретения, клетка-хозяин содержит (например, была трансформирована): (1) вектор, содержащий нуклеиновую кислоту, кодирующую аминокислотную последовательность, содержащую VL антитела, и аминокислотную последовательность, содержащую VH антитела, или (2) первый вектор, содержащий нуклеиновую кислоту, кодирующую аминокислотную последовательность, содержащую VL антитела, и второй вектор, содержащий нуклеиновую кислоту, кодирующую аминокислотную последовательность, содержащую VH антитела. В одном варианте реализации изобретения клетка-хозяин является эукариотической, например клеткой яичника китайского хомячка (СНО) или лимфоидной клеткой (например, Y0, NS0, SP20 клетка). В одном варианте реализации изобретения предложен способ получения анти-FcRH5 антитела, где способ включает культивирование клетки-хозяина, содержащей нуклеиновую кислоту, кодирующую антитело, как указано выше, в соответствии с условиями, подходящими для экспрессии антитела, и необязательно восстановление антитела из клетки-хозяина (или культуральной среды клетки-хозяина).

Для рекомбинантного получения анти-FcRH5антитела, нуклеиновую кислоту, кодирующая антитело, например, как описано выше, выделяют и встраивают в один или более векторов для дополнительного клонирования и/или экспрессии в клетку-хозяин. Такая нуклеиновая кислота может быть легко выделена и секвенирована, используя обычные процедуры (например, с использованием олигонуклеотидных зондов, которые способны специфически связываться с генами, кодирующими тяжелые и легкие цепи антитела).

Подходящие клетки-хозяева для клонирования или экспрессии векторов, кодирующих антитело, включают прокариотические или эукариотические клетки, описанные в данном документе. Например, антитела могут быть получены в бактериях, в частности, когда не нужны функция гликозилирования и Fc-эффекторная функция. Для экспрессии фрагментов антител и полипептидов в бактериях, см., например, патенты США №№ 5648237 5789199, и 5840523. (См. также Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), сс. 245-254, где описана экспрессия фрагментов антитела в E. coli). После экспрессии, антитело может быть выделено из бактериальной клеточной пасты в растворимой фракции и силам ли быть дополнительно очищено.

В дополнение к прокариотам, эукариотические микробы, такие как нитчатые грибы или дрожжи, являются подходящими клонирования или экспрессии хозяевами для векторов, кодирующих антитело, в том числе грибы и дрожжевые штаммы, чьи маршруты гликозилирования были "гуманизированы", приводя в результате к получению антитела с частично или полностью человеческим характером гликозилирования. См. Gerngross, Nat. Biotech. 22:1409-1414 (2004), and Li et al., Nat. Biotech. 24:210-215 (2006).

Подходящие клетки-хозяева для экспрессии гликозилированного антитела также получают из многоклеточных организмов (беспозвоночных и позвоночных). Примеры клеток беспозвоночных включают клетки растений и насекомых. Были идентифицированы многочисленные бакуловирусные штаммы, которые могут быть использованы в сочетании с клетками насекомых, в частности, для трансфекции клеток Spodoptera frugiperda.

Культуры растительных клеток также могут быть использованы в качестве хозяев. См., например, патенты США №№ 5959177, 6040498, 6420548, 7125978, и 6417429 (описание PLANTIBODY™ технологии производства антитела в трансгенных растениях).

Клетки позвоночных могут быть также описаны как хозяева. Например, клеточные линии млекопитающих, адаптированные для роста в суспензии, могут быть полезными. Другими примерами полезных линий млекопитающих клетка-хозяин являются линия почек обезьян CV1, трансформированная SV40 (COS-7); линия человеческой эмбриональной почки (293 или 293 клетки, как описано, например, в Graham et al., J. Gen Virol. 36:59 (1977)); клетки почки новорожденного хомяка(BHK); клетки Сертоли мышей (TM4 клетки, как описано, например, в Mather, Biol. Reprod. 23:243-251 (1980); клетки почек обезьян (CV1); клетки почки Африканской зеленой мартышки (VERO-76); клетки человеческой карциномы шейки матки (HELA); клетки почек собак (MDCK; клетки печени серой крысы (крысы buffalo) (BRL 3A); клетки человеческого легкого (W138); клетки человеческой печени (Hep G2); опухоли молочной железы мыши (MMT 060562); TRI клетки, как описано, например, в Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 клетки; и FS4 клетки. Другие полезные линии клеток-хозяев млекопитающих включают клетки яичников китайского хомячка (CHO), включая DHFR - CHO клетки (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); и миеломные клеточные линии, такие как Y0, NS0 и Sp2/0. Обзор некоторых линий клеток-хозяев млекопитающих, подходящих для производства антител, см., например, Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268 (2003).

C. Анализы

Анти-FcRH5 антитела, предложенные в данном документе, могут быть идентифицированы, подвержены скринингу на, или охарактеризованы на предмет их физических/химических свойств и/или биологической активности при помощи различных анализов, известных в данной области.

В одном аспекте, антитело, предложенное в данном документе, может быть протестировано на его активность связывания антигена, например, с помощью известных способов, таких как ELISA, FACS Biacore®, или Вестерн-блоттинг.

В другом аспекте, конкурентные анализы могут быть использованы для идентификации антитела, которое конкурирует с любым из антител, описанных в данном документе, для связывания с FcRH5. В определенных вариантах реализации изобретения, такое конкурирующее антитело связывается с тем же эпитопом (например, линейным или конформационным эпитопом), который связан с антителом, описанным в данном документе. Подробные примеры методов картирования эпитопа, с которым связывается антитело, предоставлены в Morris (1996) “Epitope Mapping Protocols,” в Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).

В иллюстративном конкурентном анализе иммобилизованный FcRH5 инкубируют в растворе, содержащем первое меченое антитело, связывающее FcRH5 (например, любое из антител, описанных в данном документе), и второе немеченое антитело, которое тестируют на его способность конкурировать с первым антителом для связывания с FcRH5. Второе антитело может присутствовать в гибридомном супернатанте. В качестве контроля, иммобилизованное FcRH5 инкубируют в растворе, содержащем первое меченое антитело, но не второе немеченое антитело. После инкубации в условиях, разрешающих связывание первого антитела и FcRH5, избыток несвязанного антитела удаляют, и количество метки, связанной с иммобилизованным FcRH5, измеряют. Если количество метки, связанной с иммобилизованным FcRH5, существенно снижается в тестируемом образце по сравнению с контрольным образцом, это указывает на то, что второе антитело конкурирует с первым антителом за связывание с FcRH5. См. Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY). В некоторых вариантах реализации изобретения, FcRH5 представляет собой FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

D. Иммуноконъюгаты

Также в данном документе предложены иммуноконъюгаты, содержащие анти-FcRH5 антитело, предложенное в данном документе, конъюгированное с одним или более цитотоксических агентов, таких как химиотерапевтические средства или лекарственные средства, ингибирующих рост агенты, токсины (например, белковые токсины, ферментативно активные токсины бактериального, грибкового, растительного или животного происхождения, или их фрагменты), либо радиоактивные изотопы (например, радиоконъюгат). В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

Иммуноконъюгаты позволяют направленную доставку фрагмента лекарственного средства к опухоли, и, в некоторых вариантах реализации изобретения, внутриклеточное накопление в ней, где системное введение неконъюгированных лекарственных средств может привести к неприемлемым уровням токсичности в отношении нормальных клеток (Polakis P. (2005) Current Opinion in Pharmacology 5:382-387).

Конъюгаты антитело-лекарственное средство (ADC) являются направленными химиотерапевтическими молекулами, которые сочетают в себе свойства как антитела, так и цитотоксических лекарственных средств, направляя высокоактивные цитотоксические лекарственные средства на антиген-экспрессирующие опухолевые клетки (Teicher, B.A. (2009) Current Cancer Drug Targets 9:982-1004), таким образом, усиливая терапевтический индекс путем максимизации эффективности и минимизации нецелевой токсичности (Carter, P.J. and Senter P.D. (2008) The Cancer Jour. 14(3):154-169; Chari, R.V. (2008) Acc. Chem. Res. 41:98-107.

ADC соединения, предложенные в данном документе, включают соединения с противоопухолевой активностью. В некоторых вариантах реализации изобретения, ADC соединения включают конъюгированное антитело, то есть ковалентно связанное с фрагментом лекарственного средства. В некоторых вариантах реализации изобретения, антитело ковалентно связано с молекулой лекарственного средства через линкер. Конъюгаты антитела и лекарственного средства (ADC), предложенные в данном документе, селективно доставляют эффективную дозу лекарственного средства в опухолевую ткань в результате чего более высокая селективность, то есть более низкая эффективная доза, может быть достигнута при увеличении терапевтического индекса ("терапевтическое окно").

Фрагмент лекарственного средства (D) конъюгатов антитело-лекарственное средство (ADC) может содержать любое соединение, фрагмент или группу, которая имеет цитотоксический или цитостатический эффект. Фрагменты лекарственного средства могут придавать их цитотоксические и цитостатические эффекты при помощи механизмов, включая, но не ограничиваясь приведенным, тубулиновое связывание, связывание или интеркаляцию ДНК и ингибирование РНК-полимеразы, синтез белка, и/или топоизомеразы. Иллюстративные фрагменты лекарственных средств включают, не ограничиваясь приведенным, мейтансиноид, доластатин, ауристатин, калихеамицин, пирролобензодиазепин (PBD), неморубицин и его производные, PNU-159682, антрациклин, дуокармицин, алкалоид барвинка, таксан, трихотецен, CC1065, камптотецин, элифанид, и стереоизомеры, изостеры, аналоги и их производные, которые обладают цитотоксической активностью. Неограничивающие примеры таких иммуноконъюгатов дополнительно обсуждаются в деталях ниже.

1. Иллюстративные конъюгаты антитело-лекарственное средство

Иллюстративный вариант реализации конъюгата антитело-лекарственное средство (ADC) соединения содержит антитело (Ab), которое нацелено на опухолевую клетку, фрагмент лекарственного средства (D), и линкерный фрагмент (L), который присоединяет Ab к D. В некоторых вариантах реализации изобретения, антитело присоединено к линкерному фрагменту (L) через один или более аминокислотных остатков, таких как лизин и/или цистеин.

Иллюстративная ADC имеет Формулу I:

где р составляет от 1 до приблизительно 20. В некоторых вариантах реализации изобретения, количество молекул лекарственного средства, которые могут быть конъюгированы с антителом, ограничено числом свободных остатков цистеина. В некоторых вариантах реализации изобретения, свободные остатки цистеина вводят в аминокислотную последовательность антитела с помощью методов, описанных в данном документе. Иллюстративные ADC Формулы I включают, не ограничиваясь приведенным, антитела, которые имеют 1, 2, 3, или 4 сконструированные с цистеином аминокислоты (Lyon, R. et al (2012) Methods in Enzym. 502:123-138). В некоторых вариантах реализации изобретения, один или несколько свободных остатков цистеина уже присутствуют в антителе, без использования методов генной инженерии, и в этом случае существующие свободные остатки цистеина могут быть использованы для конъюгирования антитела и лекарственного средства. В некоторых вариантах реализации изобретения, антитело подвергают воздействию восстановительных условий перед конъюгацией антитела для того, чтобы создать один или более свободных остатков цистеина. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

а) Иллюстративные линкеры

"Линкер" (L) является бифункциональным или многофункциональным фрагментом, который может быть использован, чтобы связать один или несколько фрагментов лекарственных средств (D) с антителом (Ab), чтобы сформировать конъюгат антитело-лекарственное средство (ADC) Формулы I. В некоторых вариантах реализации изобретения, конъюгаты антитело-лекарственное средство (ADC) могут быть получены с использованием линкера, имеющего реакционноспособные функциональные группы для ковалентного присоединения к лекарственному средству и антителу. Например, в некоторых вариантах реализации изобретения, цистеин тиол антитела (Ab) может образовывать связь с реактивной функциональной группой линкера или промежуточного соединения лекарственное средство-линкер с получением ADC.

В одном аспекте, линкер имеет функциональную группу, которая способна реагировать со свободным цистеином, присутствующем на антителе, с образованием ковалентной связи. Неограничивающие примеры таких реактивных функциональных групп включают малеимид, галогенацетамиды, α-галогенацетил, активированные сложные эфиры, такие как сложные сукцинимидные эфиры, 4-нитрофениловые сложные эфиры, пентафторфенильные сложные эфиры, тетрафторфенильные сложные эфиры, ангидриды, хлорангидриды, сульфонилхлориды, изоцианаты и изотиоцианаты. См., например, метод конъюгации на странице 766 of Klussman, et al (2004), Bioconjugate Chemistry 15(4):765-77373, и Примеры в нем.

В некоторых вариантах реализации изобретения, линкер имеет функциональную группу, которая способна реагировать с электрофильной группой, присутствующей на антителе. Такие иллюстративные электрофильные группы включают, не ограничиваясь приведенным, альдегидные и кетонные карбонильные группы. В некоторых вариантах реализации изобретения, гетероатом реактивной функциональной группы линкера может реагировать с электрофильной группой на антителе и образовывать ковалентную связь со звеном антитела. Неограничивающие примеры таких реакционноспособных функциональных групп включают, не ограничиваясь приведенным, гидразид, оксим, амино, гидразин, тиосемикарбазон, гидразидкарбоксилат и арилгидразид.

Линкер может содержать один или несколько компонентов линкера. Иллюстративные компоненты линкера включают 6-малеимидокапроил ("МС"), малеимидопропаноил ("MP"), валин-цитруллин ("val-cit” или “vc"), аланин-фенилаланин ("ala-phe"), п-аминобензилоксикарбонил ("PAB"), N-сукцинимидил 4-(2-пиридилтио)пентаноат ("SPP"), и 4- (N-малеимидометил) циклогексан-1 карбоксилат ("МСС"). Различные компоненты линкера известны в данной области, некоторые из них описаны ниже.

Линкер может быть “расщепляемым линкером“, облегчающим высвобождение лекарственного средства. Неограничивающие примеры расщепляемых линкеров включают кислотолабильные линкеры (например, содержащие гидразон), протеаза-чувствительные (например, пептидаза-чувствительные) линкеры, фотолабильные линкеры или дисульфид-содержащие линкеры (Chari et al., Cancer Research 52:127-131 (1992); US 5208020).

В определенных вариантах реализации изобретения, линкер имеет следующую Формулу II:

II

где А представляет собой "растягивающее звено", а представляет собой целое число от 0 до 1; W представляет собой "аминокислотное звено", и W представляет собой целое число от 0 до 12; Y является "спейсерным звеном", а у представляет собой 0, 1 или 2. ADC, содержащий линкер Формулы II, имеет Формулу I (А): Ab-(Aa-Ww-Yy-D)p, где AB, D, и р имеют значения, указанные выше для Формулы I. Иллюстративные варианты реализации таких линкеров описаны в патенте США № 7498298, который специально включен в данный документ путем ссылки.

В некоторых вариантах реализации изобретения, линкерный компонент содержит "растягивающее звено" (A), которое связывает антитело с другим линкерным компонентом или фрагментом лекарственного средства. Неограничивающие примеры растягивающих звеньев приведены ниже (где волнистая линия указывает на сайты ковалентного присоединения к антителу, лекарственному средству или дополнительным линкерным компонентам):

MC

MP

mPEG

В некоторых вариантах реализации изобретения, линкерный компонент содержит "аминокислотное звено" (W). В некоторых таких вариантах реализации изобретения, аминокислотное звено позволяет расщепление линкера с помощью протеазы, что облегчает высвобождение лекарственного средства из иммуноконъюгата при воздействии внутриклеточных протеаз, таких как лизосомальные ферменты (Doronina et al. (2003) Nat. Biotechnol. 21:778-784). Иллюстративные аминокислотные звенья включают, не ограничиваясь приведенным, дипептиды, трипептиды, тетрапептиды и пентапептиды. Иллюстративные дипептиды включают, не ограничиваясь приведенным, валин-цитруллин (vc или val-cit), аланин-фенилаланин (af или ala-phe); фенилаланин-лизин (fk или phe-lys); фенилаланин-гомолизин (phe-homolys); и N-метил-валин-цитруллин (Me-val-cit). Иллюстративные трипептиды включают, не ограничиваясь приведенным, глицин-валин-цитруллин (gly-val-cit) и глицин-глицин-глицин (gly-gly-gly). Аминокислотное звено может содержать аминокислотные остатки, которые встречаются в природе и/или минорные аминокислоты и/или не встречающиеся в природе аминокислотные аналоги, кислоты, такие как цитруллин. Аминокислотные звенья могут быть разработаны и оптимизированы для ферментативного расщепления с помощью конкретного фермента, например, ассоциированной с опухолью протеазы, катепсина B, C и D, или плазминной протеазы.

Как правило, линкеры пептидного типа могут быть получены путем образования пептидной связи между двумя или более аминокислотами и/или пептидными фрагментами. Такие пептидные связи могут быть получены, например, согласно способу синтеза в жидкой фазе (например, E. and K. (1965) “The Peptides”, volume 1, pp 76-136, Academic Press).

В некоторых вариантах реализации изобретения, линкерный компонент содержит "спейсерное звено" (Y), которое связывает антитело и фрагмент лекарственного средства, непосредственно, либо через растягивающее звено и/или аминокислотное звено. Спейсерное звено может быть "саморасщепляющимся" или "несаморасщепляющимся". "Несаморасщепляющееся" спейсерное звено является звеном, в котором часть или все спейсерное звено остается связанным с молекулой лекарственного средства при расщеплении ADC. Примеры несаморасщепляющихся спейсерных звеньев включают, не ограничиваясь приведенным, глициновое спейсерное звено и глицин-глициновое спейсерное звено. В некоторых вариантах реализации изобретения, ферментативное расщепление ADC, содержащего глицин-глицин спейсерное звено, с помощью протеазы, связанной с опухолевой клеткой, приводит к высвобождению фрагмента глицин-глицин-лекарственное средство из остальной части ADC. В некоторых таких вариантах реализации изобретения, фрагмент глицин-глицин-лекарственное средство подвергают стадии гидролиза в опухолевой клетке, таким образом, отщепляя глицин-глициновое спейсерное звено от молекулы лекарственного средства.

"Саморасщепляющееся" спейсерное звено позволяет высвобождение фрагмента лекарственного средства. В определенных вариантах реализации изобретения, спейсерное звено линкера содержит п-аминобензиловое звено. В некоторых таких вариантах реализации изобретения, р-аминобензиловый спирт присоединен к аминокислотному звену посредством амидной связи, и карбамат, метилкарбамат, или карбонат получают между бензиловым спиртом и лекарственным средством (H Hamann et al. (2005) Expert Opin. Ther. Patents (2005) 15:1087-1103). В некоторых вариантах реализации изобретения, спейсерное звено содержит р-аминобензилоксикарбонил (PAB). В некоторых вариантах реализации изобретения, ADC, содержащее саморасщепляющийся линкер, имеет структуру:

где Q представляет собой -C1-C8 алкил, -O-(C1-C8 алкил), галоген, нитро или циано; m представляет собой целое число в диапазоне от 0 до 4; Х может быть одним или более дополнительных спейсерных звеньев или может отсутствовать; и р находится в диапазоне от 1 до приблизительно 20. В некоторых вариантах реализации изобретения, р находится в диапазоне от 1 до 10, от 1 до 7, от 1 до 5 или от 1 до 4. Неограничивающие иллюстративные X спейсерные звенья включают:

и ; где R1 и R2 независимо выбраны из Н и С1-C6 алкила. В некоторых вариантах реализации изобретения, R1 и R2 каждый представляют собой -CH3.

Другие примеры саморасщепляющихся спейсеров включают, не ограничиваясь приведенным, ароматические соединения, которые в электронном виде похожи на PAB группу, такие как производные 2-аминоимидазол-5-метанола (патент США 7375078; Hay et al. (1999) Bioorg. Med. Chem. Lett. 9:2237) и орто- или пара-аминобензилацетали. В некоторых вариантах реализации изобретения, можно использовать спейсеры, которые подвергают циклизации при гидролизе амидной связи, такие как замещенные и незамещенные амиды 4-аминомасляной кислоты (Rodrigues et al (1995) Chemistry Biology 2:223), соответственно замещенные [2,2,1] и бицикло [2.2.2] кольцевые системы (Storm et al (1972) J. Amer. Chem. Soc. 94:5815) и амиды 2-аминофенилпропионовой кислоты (Amsberry, et al (1990) J. Org. Chem. 55:5867). Связывание лекарственного средства с α-углеродным остатком глицина является еще одним примером саморасщепляющегося спейсера, который может быть полезен в ADC (Kingsbury et al (1984) J. Med. Chem. 27:1447).

В некоторых вариантах реализации изобретения, линкер L может быть дендритного типа линкером для ковалентного присоединения более одного лекарственного фрагмента к антителу через разветвленный, многофункциональный линкерный фрагмент (Sun et al (2002) Bioorganic & Medicinal Chemistry Letters 12:2213-2215; Sun et al (2003) Bioorganic & Medicinal Chemistry 11:1761-1768). Дендритные линкеры могут увеличивать молярное соотношение лекарственного средства и антитела, т.е. нагрузку, которая связана с эффективностью ADC. Таким образом, когда антитело имеет только одну реактивную тиольную группы цистеина, множество молекул лекарственного средства могут быть присоединены через дендритный линкер. Неограничивающие примеры линкеров показаны в контексте ADC Формулы I:

val-cit

MC-val-cit

MC-val-cit-PAB

;

где R1 и R2 независимо выбраны из Н и С1-C6 алкила. В некоторых вариантах реализации изобретения, R1 и R2 каждый представляет собой -CH3.

Phe-homoLys-PAB-Ab;

где n представляет собой 0 - 12. В некоторых вариантах реализации изобретения, n представляет собой 2 - 10. В некоторых вариантах реализации изобретения, n представляет собой 4 - 8.

Дополнительные неограничивающие иллюстративные ADCs включают структуры:

, ,

, ,

,

где X представляет собой:

;

Y представляет собой:

;

каждый R независимо представляет собой H или C1-C6 алкил; и n представляет собой 1 - 12.

В некоторых вариантах реализации изобретения, линкер замещен группами, которые модулируют растворимость и/или реактивность. В качестве неограничивающего примера, заряженный заместитель, такой как сульфонат (-SO3-) или аммоний, может увеличить растворимость в воде линкерного реагента и облегчать реакцию сочетания линкерного реагента с антителом и/или молекулой лекарственного средства, или облегчить реакцию сочетания Ab-L (антитело-линкер промежуточное соединение) с D, или D-L (лекарственное средство-линкер промежуточное соединение) с Ab, в зависимости от способа синтеза, используемого для получения ADC. В некоторых вариантах реализации изобретения, часть линкера соединена с антителом и часть линкер соединена с лекарственным средством, а затем Ab-(линкерная часть)a соединена с лекарственным средством (линкерная часть)b для формирования ADC Формулы I

Соединения, предложенные в данном документе, явно охватывают, но не ограничиваются ими, ADC, полученные с помощью следующих линкерных реагентов: бис-малеимидо-триоксиэтилен гликоль (BMPEO), N-(β-малеимидопропилoкси)-N-гидрокси-сукцинимидный сложный эфир (BMPS), N-(ε-малеимидокапроилокси) сукцинимидный сложный эфир (EMCS), N-[γ-малеимидобутирилокси] сукцинимидный сложный эфир (GMBS), 1,6-гексан-бис-винилсульфон (HBVS), сукцинимидил 4-(N-малеимидометил)циклогексан-1-карбокси (6-амидокапроат) (LC-SMCC), м-малеимидобензоил-N-гидроксисукцинимид (MBS), 4-(4-N-малеимидофенил) гидразида масляной кислоты (MPBH), сукцинимидил 3-(бромоацетамидо) пропионат (SBAP), сукцинимидил иодацетат (SIA), сукцинимидил (4-иодацетил) аминобензойной кислоты (SIAB), N-сукцинимидил-3-(2-пиридилдитио) пропионат (SPDP), N-сукцинимидил-4-(2-пиридилтио) пентаноат (SPP), сукцинимидил 4-(N-малеимидометил) циклогексан-1-карбоксилат (SMCC), сукцинимидил 4-(п-малеимидофенил) бутират (SMPB), сукцинимидил 6-[(бета-малеимидопропионамидо) гексаноат] (SMPH), иминотиолан (IT), сульфо-EMCS, сульфо-GMBS, сульфо-KMUS, сульфо-MBS, сульфо-SIAB, сульфо-SMCC, и сульфо-SMPB, и сукцинимидил-(4-винилсульфон) бензоат (SVSB), в том числе бис-малеимидные реагенты: дитиобисмалеимидоэтан (DTME), 1,4-бисмалеимидобутан (ВМВ), 1,4 бисмалеимидил-2,3-дигидроксибутан (BMDB), бисмалеимидогексан (ВМН), бисмалеимидоэтан (BMOE), BM(PEG)2 (показан ниже), и BM(PEG)3 (показан ниже); бифункциональные производные сложных имидоэфиров (такие как диметиладипимидат HCl), активные сложные эфиры (такие как дисукцинимидилсуберат), альдегиды (такие как глутаровый альдегид), бис-азидо соединения (такие как бис (п-азидобензоил) гександиамин), производные бис-диазония (такие как бис-(п-диазонийбензоил) этилендиамин), диизоцианаты (такие как толуол-2,6-диизоцианат) и бис-активные соединения фтора (такие как 1,5-дифтор-2,4-динитробензол). В некоторых вариантах реализации изобретения, бис-малеимидные реагенты позволяют присоединение тиольной группы цистеина в антителе к тиолсодержащим фрагментам лекарственного средства, линкеру, или промежуточному соединению линкер-лекарственное средство. Другие функциональные группы, которые реагируют с тиольными группами включают, не ограничиваясь приведенным, иодацетамид, бромацетамид, винилпиридин, дисульфид, пиридил дисульфид, изоцианат, и изотиоцианат.

Некоторые полезные линкерные реагенты могут быть получены из различных коммерческих источников, таких как Pierce Biotechnology, Inc. (Rockford, IL), Molecular Biosciences Inc.(Boulder, CO), или синтезированные в соответствии с процедурами, описанными в уровне техники; например, в Toki et al (2002) J. Org. Chem. 67:1866-1872; Dubowchik, et al. (1997) Tetrahedron Letters, 38:5257-60; Walker, M.A. (1995) J. Org. Chem. 60:5352-5355; Frisch et al (1996) Bioconjugate Chem. 7:180-186; US 6214345; WO 02/088172; US 2003130189; US2003096743; WO 03/026577; WO 03/043583; и WO 04/032828.

Углерод-14-меченая 1-изотиоцианатобензил-3-метилдиэтилен триаминпентауксусная кислота (MX-DTPA) представляет собой пример хелатообразующего агента для конъюгации радионуклида и антитела. См., например, WO94/11026.

b) Фрагменты лекарственного средства

(1) Майтансин и майтансиноиды

В некоторых вариантах реализации изобретения, иммуноконъюгат содержит антитело, конъюгированное с одним или несколькими молекулами майтансиноидов. Майтансиноиды являются производными майтансина, и ингибиторами митоза, которые действуют, ингибируя полимеризацию тубулина. Майтансин впервые был выделен из восточно-африканского кустарника Maytenus serrata (патент США № 3896111). Впоследствии было обнаружено, что некоторые микробы также производят майтансиноиды, такие как майтансинол и С-3 мейтансиноловые сложные эфиры (патент США № 4151042). Синтетические майтансиноиды описаны, например, в патентах США №№ 4137230; 4248870; 4256746; 4260608; 4265814; 4294757; 4307016; 4308268; 4308269; 4309428; 4313946; 4315929; 4317821; 4322348; 4331598; 4361650; 4364866; 4424219; 4450254; 4362663; и 4371533.

Майтансиноидные фрагменты лекарственных средств являются привлекательными фрагментами лекарственных средств в конъюгатах антитело-лекарственное средство, потому что они: (i) относительно доступны, чтобы получить их путем ферментации или химической модификации или дериватизацией продуктов брожения, (ii) поддаются дериватизации с функциональными группами, подходящими для конъюгации через не-дисульфидные линкеры с антителами, (iii) стабильны в плазме, и (iv) эффективны против различных линий опухолевых клеток.

Некоторые майтансиноиды, приемлемые для использования в качестве майтансиноидных фрагментов лекарственных средств, известны в данной области, и могут быть выделены из природных источников в соответствии с известными способами или получены с использованием методов генной инженерии (см, например, Yu et al (2002) PNAS 99:7968-7973). Майтансиноиды также могут быть получены синтетически с помощью известных методов.

Майтансиноидные молекулы лекарственного средства включают, не ограничиваясь приведенным, молекулы, имеющие модифицированное ароматическое кольцо, такое как: C-19-дехлоро (патент США № 4256746) (полученная, например, с помощью литий-алюминий гидридного восстановления ансамитоцина Р2); С-20-гидрокси (или С-20-деметил) +/- С-19-дехлоро (патенты США №№ 4361650 и 4307016) (полученные, например, путем деметилирования с использованием Streptomyces или Actinomyces, или с помощью LAH дехлорирования); и С-20-деметокси, С-20-ацилокси (OCOR), +/- дехлоро (патент США № 4,294,757) (получен, например, путем ацилирования с помощью ацилхлоридов), и те, которые имеют модификации в других положениях ароматического кольца.

Майтансиноидные молекулы лекарственного средства включают те, которые имеют модификации, такие как: C-9-SH SH (патент США № 4424219) (полученный, например, с помощью реакции майтансинола с H2S или P2S5); С-14-алкоксиметил (деметокси/CH2 OR) (патент США 4331598); С-14-гидроксиметил или ацилоксиметил (CH2OH или CH2OAc) (патент США № 4450254). (Полученного, например, из Nocardia); С-15-гидрокси / ацилокси (US 4364866) (полученная, например, путем превращения майтансинола при помощи Streptomyces); С-15-метокси (патенты США №№ 4313946 и 4315929) (например, выделенные из Trewia nudlflora); С-18-N-деметил (патенты США №№ 4362663 и 4322348) (полученные, например, с помощью деметилирования майтансинола при помощи Streptomyces); и 4,5-дезокси (патент США 4371533) (полученная, например, с помощью трихлорида титана/восстановления LAH майтансинола).

Многие положения майтансиноидных соединений являются полезными в качестве положений линкеров. Например, сложноэфирная связь может быть образована с помощью реакции с гидроксильной группой с использованием обычных способов связывания. В некоторых вариантах реализации изобретения, реакция может протекать в положении С-3, имеющем гидроксильную группу, положении С-14, модифицированном гидроксиметилом, положении С-15, модифицированном гидроксильной группой, и положении C-20, имеющем гидроксильную группу. В некоторых вариантах реализации изобретения, связь образуется в положении С-3 майтансинола или аналога майтансинола.

Майтансиноидные фрагменты лекарственных средств включают имеющие структуру:

где волнистая линия указывает на ковалентное присоединение атома серы фрагмента майтансиноидного лекарственного средства к линкеру ADC. Каждый R независимо от других может быть H или C1-C6 алкилом. Алкиленовая цепь, соединяющая амидную группу с атомом серы, может быть метанилом, этанилом или пропилом, например, m представляет собой 1, 2, или 3 (патент США 633410, патент США 5208020; Chari et al (1992) Cancer Res. 52:127-131; Liu et al (1996) Proc. Natl. Acad. SciUSA 93:8618-8623).

Все стереоизомеры майтансиноидного фрагмента лекарственного средства рассматриваются для ADC, предложенного в данном документе, т.е. любая комбинация R и S конфигурации у хирального атома углерода (US 7276497; US 6913748; US 6441163; US 633410 (RE39151); US 5208020; Widdison et al (2006) J. Med. Chem. 49:4392-4408, которые включены в качестве ссылки во всей их полноте). В некоторых вариантах реализации изобретения, майтансиноидный фрагмент лекарственного средства имеет следующую стереохимию:

Иллюстративные варианты реализации майтансиноидных фрагментов лекарственного средства включают, не ограничиваясь приведенным, DM1; DM3; и DM4, со структурами:

где волнистая линия указывает на ковалентное присоединение атома серы лекарственного средства к линкеру (L) конъюгата антитело-лекарственное средство.

Другие иллюстративные майтансиноидные конъюгаты антитело-лекарственное средство имеют следующие структуры и сокращения (где Ab представляет собой антитело и р составляет от 1 до приблизительно 20. В некоторых вариантах реализации изобретения, р составляет от 1 до 10, р составляет от 1 до 7, р равно от 1 до 5, или р составляет от 1 до 4):

Ab -SPP-DM1

Ab-SMCC-DM1

Иллюстративные конъюгаты антитело-лекарственное средство, где DM1 связан через BMPEO линкер с тиольной группой антитела, имеют структуру и сокращение:

где Ab представляет собой антитело; n представляет собой 0, 1, или 2; и p представляет собой от 1 до приблизительно 20. В некоторых вариантах реализации изобретения, p представляет собой от 1 до 10, p представляет собой от 1 до 7, p представляет собой от 1 до 5, или p представляет собой от 1 до 4.

Иммуноконъюгаты, содержащие майтансиноиды, способы их получения, и их терапевтическое применение описаны, например, в патентах США №№ 5208020 и 5416064; США 2005/0276812; и европейском патенте ЕР 0 425 235 B1, раскрытие которых таким образом, специально включено в качестве ссылки. См. также Liu et al.Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996); and Chari et al.Cancer Research 52:127-131 (1992).

В некоторых вариантах реализации изобретения, конъюгаты антитело-майтансиноид могут быть получены путем химического связывания антитела и молекулы майтансиноида без значительного уменьшения биологической активности антитела или майтансиноидной молекулы. См, например патенте США № 5208020 (раскрытие которого явно включено в данный документ в качестве ссылки). В некоторых вариантах реализации изобретения, ADC в среднем с 3-4 майтансиноидными молекулами, конъюгированными на молекулу антитела, показал эффективность при повышении цитотоксичности клеток-мишеней без негативного влияния на функцию или растворимость антитела. В некоторых случаях, даже одна молекула токсина/антитела, как ожидается, усиливает цитотоксичность по сравнению с использованием голого антитела.

Связывающие группы для получения конъюгатов антитело-майтансиноид включают, например, описанное в данном документе, и те, которые раскрыты в патенте США № 5208020; патенте ЕР 0 425 235 B1; Chari et al.Cancer Research 52:127-131 (1992); US 2005/0276812 A1; and US 2005/016993 A1, содержание которых этим специально включено в виде ссылки.

(2) Ауристатины и доластатины

Фрагменты лекарственных средств включают доластатины, ауристатины и их аналоги и производные (US 5635483; US 5780588; US 5767237; US 6124431). Ауристатины являются производными соединения морского моллюска доластатина-10. Не желая быть связанными какой-либо конкретной теорией, доластатины и ауристатины. как было показано, мешают динамике микротрубочек, GTP гидролизу, и ядерному и клеточному делению (Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) и имеют противораковую (US 5663149) и противогрибковую активность (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965). Доластатин/ауристатиновый фрагмент лекарственного средства может быть присоединен к антителу через N (амино) конец или С (карбоксильный) конец пептидной молекулы лекарственного средства (WO 02/088172; Doronina et al (2003) Nature Biotechnology 21(7):778-784; Francisco et al (2003) Blood 102(4):1458-1465).

Иллюстративные варианты реализации ауристатина включают связанные через N-конец монометилауристатиновые фрагменты лекарственных средств DE и DF, описанные в US 7498298 и US 7659241, раскрытия которых специально включены путем ссылки во всей их полноте:

DE

DF

где волнистая линия DE и DF указывает на сайт ковалентного связывания антитела или компонента антитело-линкер, и независимо в каждом месте:

R2 выбран из H и С1-C8 алкила;

R3 выбран из H, C1-C8 алкила, C3-C8 карбоцикла, арила, C1-C8 алкил-арила, C1-C8 алкила-(C3-C8 карбоцикла), C3-C8 гетероцикла и С1-C8 алкил-(C3-C8 гетероцикла);

R4 выбран из H, C1-C8 алкила, C3-C8 карбоцикла, арила, C1-C8 алкил-арила, C1-C8 алкил-(C3-C8 карбоцикла), C3-C8 гетероцикла и С1-C8 алкил-(C3-C8 гетероцикла);

R5 выбран из H и метила;

либо R4 и R5 совместно образуют карбоциклическое кольцо и имеют формулу -(CRaRb)n-, где Ra и Rb независимо выбраны из Н, C1-C8 алкила и С3-C8 карбоцикла и N выбран из 2, 3, 4, 5 и 6;

R6 выбран из H и С1-C8 алкила;

R7 выбран из H, C1-C8 алкила, C3-C8 карбоцикла, арила, C1-C8 алкил-арила, C1-C8 алкила-(C3-C8 карбоцикла), C3-C8 гетероцикла и С1-C8 алкил-(C3-C8 гетероцикла);

каждый R8 независимо выбран из H, OH, C1-C8 алкила, C3-C8 карбоцикла и O-(C1-C8 алкила);

R9 выбран из H и С1-C8 алкила;

R10 выбран из арила или C3-C8 гетероцикла;

Z представляет собой O, S, NH, или NR12, где R12 представляет собой C1-C8 алкил;

R11 выбран из H, C1-C20 алкила, арила, C3-C8 гетероцикла, -(R13O)m-R14, или -(R13O)m-CH(R15)2;

m представляет собой целое число в диапазоне 1-1000;

R13 представляет собой C2-C8 алкил;

R14 представляет собой Н или С1-C8 алкил;

каждый случай появления R15 независимо представляет собой H, COOH, -(CH2)n-N(R16)2, -(CH2)n-SO3H, или -(CH2)n-SO3-C1-C8 алкил;

каждый случай появления R16 независимо представляет собой H, C1-C8 алкил, или -(CH2)n-COOH;

R18 выбран из -C(R8)2 -C(R8)2-арила, -C(R8)2-C(R8)2-(C3-C8 гетероцикла), и -C(R8)2-C(R8)2-(C3-C8 карбоцикла); и

n представляет собой целое число в диапазоне 0 - 6.

В одном варианте реализации изобретения, R3, R4 и R7 независимо представляют собой изопропил или втор-бутил и R5 представляет собой -H или метил. В иллюстративном варианте реализации, R3 и R4 каждый представляет собой изопропил, R5 представляет собой -H, и R7 представляет собой втор-бутил.

В еще одном варианте реализации изобретения, R2 и R6 каждый представляет собой метил, и R9 представляет собой -H.

В еще одном варианте реализации изобретения, каждый случай появления R8 представляет собой -OCH3.

В некоторых вариантах реализации изобретения, R3 и R4 каждый представляет собой изопропил, R2 и R6 каждый представляет собой метил, R5 представляет собой -H, R7 представляет собой втор-бутил, каждый случай появления R8 представляет собой -OCH3, и R9 представляет собой -H.

В одном варианте реализации изобретения, Z представляет собой -O- или -NH-.

В одном варианте реализации изобретения, R10 представляет собой арил.

В иллюстративном варианте реализации, R10 представляет собой -фенил.

В иллюстративном варианте реализации, если Z представляет собой -O-, R11 представляет собой -H, метил или трет-бутил.

В одном варианте реализации изобретения, если Z представляет собой -NH, R11 представляет собой -CH(R15)2, где R15 представляет собой -(CH2)n-N(R16)2, и R16 представляет собой -C1-C8 алкил или -(CH2)n-COOH.

В другом варианте реализации изобретения, если Z представляет собой -NH, R11 представляет собой -CH(R15)2, где R15 представляет собой -(CH2)n-SO3H.

Иллюстративным вариантом реализации ауристатина Формулы DE является MMAE, где волнистая линия указывает на ковалентное связывание с линкером (L) конъюгата антитело-лекарственный препарат:

MMAE

Иллюстративным вариантом реализации ауристатина Формулы DF является MMAF, где волнистая линия указывает на ковалентное связывание с линкером (L) конъюгата антитело-лекарственный препарат:

MMAF

Другие иллюстративные варианты реализации изобретения включают монометилвалиновые соединения, имеющие фенилаланиновые карбокси модификации C-конца пентапептидного ауристатинового лекарственного фрагмента (WO 2007/008848) и монометилвалиновые соединения, имеющие фенилаланиновые модификации боковой цепи на C-конце пентапептидного ауристатинового лекарственного фрагмента (WO 2007/008603).

Неограничивающие иллюстративные варианты реализации ADC Формулы I, содержащие MMAE или MMAF и различные линкерные компоненты, имеют следующие структуры и сокращения (где “Ab” представляет собой антитело; p составляет от 1 до приблизительно 8, “Val-Cit” представляет собой валин-цетруллиновый дипептид; и “S” представляет собой атом серы:

Ab-MC-vc-PAB-MMAF

Ab-MC-vc-PAB-MMAE

Ab-MC-MMAE

Ab-MC-MMAF

Неограничивающие иллюстративные варианты реализации ADCs Формулы I, содержащих MMAF и различные линкерные компоненты, дополнительно включают Ab-MC-PAB-MMAF и Ab-PAB-MMAF. Иммуноконъюгаты, содержащие MMAF, прикрепленные к антителу при помощи линкерной связи, которые не расщепляются протеолитически, как было показано, обладают активностью, сравнимой с активностью иммуноконъюгатов, содержащих MMAF, присоединенные к антителу при помощи протеолитически расщепляемого линкера (Doronina et al. (2006) Bioconjugate Chem. 17:114-124). В некоторых таких вариантах реализации изобретения, высвобождение лекарственного препарата, как полагают, осуществляется путем распада антитела в клетке.

Как правило, фрагменты лекарственного средства на основе пептидов могут быть получены путем образования пептидной связи между двумя или более аминокислотами и/или пептидными фрагментами. Такие пептидные связи могут быть получены, например, в соответствии со способом синтеза в жидкой фазе (см, например, Е E. and K. “The Peptides”, volume 1, pp 76-136, 1965, Academic Press). Ауристатин/доластатиновые фрагменты лекарственных средств могут, в некоторых вариантах реализации изобретения, быть получены в соответствии с методами, описанными в: US 7498298; US 5635483; US 5780588; Pettit et al (1989) J. Am. Chem. Soc. 111:5463-5465; Pettit et al (1998) Anti-Cancer Drug Design 13:243-277; Pettit, G.R., et al.Synthesis, 1996, 719-725; Pettit et al (1996) J. Chem. Soc. Perkin Trans. 1 5:859-863; and Doronina (2003) Nat. Biotechnol. 21(7):778-784.

В некоторых вариантах реализации изобретения, ауристатин/доластатиновые фрагменты лекарственных средств Формул DE, такие как MMAE, и DF, такие, как MMAF, и их промежуточные соединения и производные лекарственное средство-линкер, такие как MC-MMAF, MC-MMAE, MC-vc-PAB-MMAF, and MC-vc-PAB-MMAE, могут быть получены с помощью методов, описанных в патенте США 7498298; Doronina et al. (2006) Bioconjugate Chem. 17:114-124; and Doronina et al. (2003) Nat. Biotech. 21:778-784 и затем конъюгированы с рассматриваемым антителом.

(3)Калихеамицин

В некоторых вариантах реализации изобретения, иммуноконъюгат содержит антитело, конъюгированное с одной или несколькими молекулами калихеамицина. Калихеамициновое семейство антибиотиков и их аналог, способны производить разрывы двухцепочечной ДНК в субпикомолярных концентрациях (Hinman et al., (1993) Cancer Research 53:3336-3342; Lode et al., (1998) Cancer Research 58:2925-2928). Калихеамицин имеет внутриклеточные сайты действия, но, в некоторых случаях, не легко пройти через клеточную мембрану. Таким образом, клеточное поглощение этих агентов через антитело-опосредованной интернализацию может в некоторых вариантах реализации изобретения, значительно повышать их цитотоксические эффекты. Неограничивающие иллюстративные способы получения конъюгатов антитело-лекарственное средство с калихеамициновым фрагментом лекарственных средств описаны, например, в US 5712374; US 5714586; US 5739116; и US 5767285.

(4) Пирролобензодиазепины

В некоторых вариантах реализации изобретения, ADC содержит пирролобензодиазепин (PBD). В некоторых вариантах реализации изобретения, PDB димеры распознают и связывают специфичные ДНК последовательности. Изначально сообщали о природном продукте антрамицине, PBD, в 1965 г. (Leimgruber, et al., (1965) J. Am. Chem. Soc., 87:5793-5795; Leimgruber, et al., (1965) J. Am. Chem. Soc., 87:5791-5793). После этого, сообщали о ряде PBDs, как о встречающихся в природе, так и об аналогах (Thurston, et al., (1994) Chem. Rev. 1994, 433-465 включая димеры тримерного PBD клеточного каркаса (US 6884799; US 7049311; US 7067511; US 7265105; US 7511032; US 7528126; US 7557099). Не имея намерения быть связанными какой-либо конкретной теорией, полагают, что димерная структура придает подходящую трехмерную форму для изоспиральности с малой бороздкой B-формы DNA, приводя к точной подгонке на сайте связывания (Kohn, In Antibiotics III. Springer-Verlag, New York, pp. 3-11 (1975); Hurley и Needham-VanDevanter, (1986) Acc. Chem. Res., 19:230-237). Димерные PBD соединения с C2 арильными заместителями, как было показано, являются полезными в качестве цитотоксических агентов (Hartley et al (2010) Cancer Res. 70(17):6849-6858; Antonow (2010) J. Med. Chem. 53(7):2927-2941; Howard et al (2009) Bioorganic and Med. Chem. Letters 19(22):6463-6466).

PBD димеры были конъюгированы с антителами и полученные ADC, как было показано, имею противораковые свойства. Неограничивающие иллюстративные сайты связывания на PBD димере включают пятичленное пирроло кольцо, связующее звено между PBD звеньями и N10-C11-иминогруппу (WO 2009/016516; US 2009/304710; US 2010/047257; US 2009/036431; US 2011/0256157; WO 2011/130598).

Неограничивающие иллюстративные PBD димерные компоненты ADCs имеют Формулу A:

A

и ее соли и сольваты, где:

волнистая линия указывает на сайт ковалентного связывания с линкером;

пунктирные линии указывают на необязательное присутствие двойной связи между C1 и С2 или С2 и С3;

R2 независимо выбран из H, OH, =O, =CH2, CN, R, OR, =CH-RD, =C(RD)2, O-SO2-R, CO2R и COR, и необязательно дополнительно выбран из галогена или дигалогена, где RD независимо выбран из R, CO2R, COR, CHO, CO2H, и галогена;

R6 и R9 независимо выбраны из Н, R, OH, OR, SH, SR, NH2, NHR, NRR’, NO2, Me3Sn и галогена;

R7 независимо выбран из H, R, OH, OR, SH, SR, NH2, NHR, NRR’, NO2, Me3Sn и галогена;

Q независимо выбран из O, S и NH;

R11 представляет собой либо H, либо R или, если Q представляет собой О, SO3M, где M представляет собой катион металла;

R и R’ каждый независимо выбраны из независимо замещенных C1-8 алкила, C1-12 алкила, C3-8 гетероциклила, C3-20 гетероциклила, и С5-20 арильных групп, и необязательно в отношении группы NRR’, R и R’ вместе с атомом азота, к которому они прикреплены, образуют необязательно замещенное 4-, 5-, 6- или 7-членное гетероциклическое кольцо;

R12, R16, R19 и R17 являются такими, как определено для R2, R6, R9 и R7 соответственно;

R″ представляет собой С3-12 алкиленовую группу, цепь которой может быть прервана одним или более гетероатомами, например O, S, N(H), NMe и/или ароматическими кольцами, например бензолом или пиридином, где кольца являются необязательно замещенными; и

X и Х’ независимо выбраны изO, S и N(H).

В некоторых вариантах реализации изобретения, R и R’ каждый независимо выбран из независимо замещенных C1-12 алкила, C3-20 гетероцикла, и С5-20 арильных групп, и необязательно в отношении группы NRR’, R и R’ вместе с атомом азота, к которому они прикреплены, образуют необязательно замещенное 4-, 5-, 6- или 7-членное гетероциклическое кольцо.

В некоторых вариантах реализации изобретения, R9 и R19 представляют собой H.

В некоторых вариантах реализации изобретения, R6 и R16 представляют собой H.

В некоторых вариантах реализации изобретения, R7 и R17 оба представляют собой OR7A, где R7A представляет собой необязательно замещенный C1-4 алкил. В некоторых вариантах реализации изобретения, R7A is Me. В некоторых вариантах реализации изобретения, R7A представляет собой Ch2Ph, где Ph представляет собой фенильную группу.

В некоторых вариантах реализации изобретения, X представляет собой О.

В некоторых вариантах реализации изобретения, R11 представляет собой Н.

В некоторых вариантах реализации изобретения, существует двойная связь между C2 и С3 в каждом мономерном звене.

В некоторых вариантах реализации изобретения, R2 и R12 независимо выбраны из Н и R. В некоторых вариантах реализации изобретения, R2 и R12 независимо представляют собой R. В некоторых вариантах реализации изобретения, R2 и R12 независимо представляют собой необязательно замещенные C5-20 арил или С5-7 арил или С8-10 арил. В некоторых вариантах реализации изобретения, R2 и R12 независимо представляют собой необязательно замещенные фенил, тиенил, нафтил, пиридил, хинолинил, или изохинолинил. В некоторых вариантах реализации изобретения, R2 и R12 независимо выбраны из =O, =CH2, =CH-RD, и =C(RD)2. В некоторых вариантах реализации изобретения, R2 и R12 каждый представляет собой =CH2. В некоторых вариантах реализации изобретения, R2 и R12 каждый представляет собой H. В некоторых вариантах реализации изобретения, R2 и R12 каждый представляет собой =O. В некоторых вариантах реализации изобретения, R2 и R12 каждый представляет собой =CF2. В некоторых вариантах реализации изобретения, R2 и/или R12 независимо представляют собой =C(RD)2. В некоторых вариантах реализации изобретения, R2 и/или R12 независимо представляют собой =CH-RD.

В некоторых вариантах реализации изобретения, если R2 и/или R12 представляет собой =CH-RD, то каждая группа может независимо иметь любую конфигурацию, показанную ниже:

В некоторых вариантах реализации изобретения, =CH-RD находится в конфигурации (I).

В некоторых вариантах реализации изобретения, R″ представляет собой С3 алкиленовую группу или C5 алкиленовую группу.

В некоторых вариантах реализации изобретения, иллюстративный PBD димерный компонент ADC имеет структуру Формулы A(I):

A(I);

где n представляет собой 0 или 1.

В некоторых вариантах реализации изобретения, иллюстративный PBD димерный компонент ADC имеет структуру Формулы A(II):

A(II);

где n представляет собой 0 или 1.

В некоторых вариантах реализации изобретения, иллюстративный PBD димерный компонент ADC имеет структуру Формулы A(III):

A(III);

где RE и RE” каждый независимо выбраны из H либо RD, где RD определен, как указано выше; и

где n представляет собой 0 или 1.

В некоторых вариантах реализации изобретения, n представляет собой 0. В некоторых вариантах реализации изобретения, n представляет собой 1. В некоторых вариантах реализации изобретения, RE и/или RE” представляет собой Н. В некоторых вариантах реализации изобретения, RE и RE” представляют собой H. В некоторых вариантах реализации изобретения, RE и/или RE” представляет собой RD, где RD необязательно замещен C1-12 алкилом. В некоторых вариантах реализации изобретения, RE и/или RE” представляет собой RD, где RD представляет собой метил.

В некоторых вариантах реализации изобретения, иллюстративный PBD димерный компонент ADC имеет структуру Формулы A(IV):

A(IV);

где Ar1 и Ar2 каждый независимо представляют собой необязательно замещенный C5-20 арил; где Ar1 и Ar2 могут быть одинаковыми или различными; и

где n представляет собой 0 или 1.

В некоторых вариантах реализации изобретения, иллюстративный PBD димерный компонент ADC имеет структуру Формулы A(V):

A(V);

где Ar1 и Ar2 каждый независимо представляет собой необязательно замещенный C5-20 арил; где Ar1 и Ar2 могут быть одинаковыми или различными; и

где n представляет собой 0 или 1.

В некоторых вариантах реализации изобретения, Ar1 и Ar2 каждый независимо выбран из независимо замещенных фенила. фуранила, тиофенила и пиридила. В некоторых вариантах реализации изобретения, Ar1 и Ar2 каждый независимо представляет собой необязательно замещенный фенил. В некоторых вариантах реализации изобретения, Ar1 и Ar2 каждый независимо представляет собой необязательно замещенный тиен-2-ил или тиен-3-ил. В некоторых вариантах реализации изобретения, Ar1 и Ar2 каждый независимо представляет собой необязательно замещенный хинолинил или изохинолинил. Хинолиниловая или изохинолиниловая группа могут быть связаны с каркасом PBD посредством любого доступного положения кольца. Например, хинолинил может быть хинолин-2-илом, хинолин-3-илом, хинолин-4-илом, хинолин-5-илом, хинолин-6-илом, хинолин-7-илом и хинолин-8-илом. В некоторых вариантах реализации изобретения, хинолинил выбран из хинолин-3-ила и хинолин-6-ила. Изохинолинил может быть изохинолин-1-илом, изохинолин-3-илом, изохинолин-4-илом, изохинолин-5-илом, изохинолин-6-илом, изохинолин-7-илом и изохинолин-8-илом. В некоторых вариантах реализации изобретения, изохинолинил выбран из изохинолин-3-ила и изохинолин-6-ила.

Дополнительные неограничивающие иллюстративные PBD димерные компоненты ADCs имеют Формулу B:

B

и ее соли и сольваты, где:

волнистая линия указывает на сайт ковалентного связывания с линкером;

волнистая линия, связанная с OH, указывает на S либо R конфигурацию;

RV1 и RV2 независимо выбраны из Н, метила, этила и фенила (где фенил может быть необязательно замещен на фторо, в особенности в 4 положении) и С5-6 гетероциклила; где RV1 и RV2 могут быть одинаковыми или различными; и

n представляет собой 0 или 1.

В некоторых вариантах реализации изобретения, RV1 и RV2 независимо выбраны из Н, фенила и 4-фторофенила.

В некоторых вариантах реализации изобретения, линкер может быть присоединен в одном из различных сайтов фрагмента PBD димерного лекарственного средства, включая N10 имин B кольца, C-2 эндо/экзо положении C кольца, или связь при помощи связующего звена A колец (см. структуры C(I) и С(II) ниже).

Неограничивающие иллюстративные PBD димерные компоненты ADCs включают Формулы C(I) и С(II):

C(I)

C(II)

Формулы C(I) и С(II) показаны в их N10-C11 иминной форме. Иллюстративные PBD фрагменты лекарственного средства также включают карбиноламиновые и защищенные карбиноламиновые формы, как показано в таблице ниже:


Имин

Карбиноламин

защищенный карбиноламин

где:

X представляет собой CH2 (n=1-5), N, или O;

Z и Z’ независимо выбраны из OR и NR2, где R представляет собой первичную, вторичную или третичную алкильную цепь, содержащую 1 - 5 атомов углерода;

R1, R’1, R2 и R’2 каждый независимо выбраны из H, C1-C8 алкила, C2-C8 алкенила, C2-C8 алкинила, C5-20 арила (включая замещенные арилы), C5-20 гетероарильных групп, -NH2, -NHMe, -OH, и -SH, где, в некоторых вариантах реализации изобретения, алкильные, алкенильные и алкинильные цепи содержат до 5 атомов углерода;

R3 и R’3 независимо выбраны из Н, или, NHR, и NR2, где R представляет собой первичную, вторичную или третичную алкильную цепь, содержащую 1 - 5 атомов углерода;

R4 и R’4 независимо выбраны из Н, Me, и OMe;

R5 выбран из C1-C8 алкила, C2-C8 алкенила, C2-C8 алкинила, C5-20 арила (включая арилы, замещенные галогены, нитро, циано, алкокси, алкил, гетероциклил) и С5-20 гетероарильных групп, где, в некоторых вариантах реализации изобретения, алкильные, алкенильные и алкинильные цепи содержат до 5 атомов углерода;

R11 представляет собой Н, C1-C8 алкил, или защитную группу (такую как ацетил, трифтороацетил, трет-бутоксикарбонил (BOC), бензилоксикарбонил (CBZ), 9-флуоренилметиленоксикарбонил (Fmoc), или фрагмент, содержащий саморасщепляющееся звено, такое как валин-цитруллин-PAB);

R12 представляет собой Н, C1-C8 алкил, или защитную группу;

где атом водорода одного из R1, R’1, R2, R’2, либо R12 или атом водорода -OCH2CH2(X)nCH2CH2O- спейсер между A кольцами замещен связью, связанной с линкером ADC.

Иллюстративные PDB димерные части ADC включают, не ограничиваясь приведенным (волнистая линия указывает на сайт ковалентного присоединения к линкеру):

PBD димер;

Неограничивающие иллюстративные варианты реализации ADCs, содержащих PBD димеры, имеют следующие структуры:

PBD димер-val-cit-PAB-Ab;

PBD димер-малеимид-ацеталь-Ab;

PBD димер-Phe-homoLys-PAB-Ab, где:

n представляет собой 0 - 12. В некоторых вариантах реализации изобретения, n представляет собой 2 - 10. В некоторых вариантах реализации изобретения, n представляет собой 4 - 8. В некоторых вариантах реализации изобретения, n выбран из 4, 5, 6, 7, и 8.

Линкеры PBD димер-val-cit-PAB-Ab и PBD димер-Phe-homoLys-PAB-Ab могут быть расщеплены протеазой, в то время как линкер PBD димер-малеимид-ацеталя является кислотолабильным.

PBD димеры и ADC, содержащие PBD димеры, могут быть получены в соответствии со способами, описанными в уровне техники. См., например, WO 2009/016516; US 2009/304710; US 2010/047257; US 2009/036431; US 2011/0256157; WO 2011/130598.

(5) Антрациклины

В некоторых вариантах реализации изобретения, ADC включают антрациклин. Антрациклины представляют собой антибиотические соединения, которые обладают цитотоксической активностью. Не желая быть связанными какой-либо конкретной теорией, исследования показали, что антрациклины могут функционировать, чтобы убить клетки при помощи ряда различных механизмов, включая: 1) интеркаляцию молекул лекарственного средства в ДНК клетке, тем самым ингибируя синтез ДНК-зависимых нуклеиновых кислот; 2) продуцирование лекарственным средством свободных радикалов, которые затем вступают в реакцию с клеточными макромолекулами, чтобы вызвать повреждение клеток, и/или 3) взаимодействие молекул лекарственных средств с клеточной мембраной (см, например, C. Peterson et al., “Transport And Storage Of Anthracycline In Experimental Systems И Нuman Leukemia” in Anthracycline Antibiotics In Cancer Therapy; N.R. Bachur, “Free Radical Damage” id. at pp.97-102). Из-за их цитотоксического потенциала антрациклины были использованы при лечении многочисленных раковых заболеваний, таких как лейкоз, рак молочной железы, рак легкого, рак яичников, аденокарцинома и саркомы (см., например, P.H- Wiernik, in Anthracycline: Current Status And New Developments p 11).

Неограничивающие иллюстративные антрациклины включают доксорубицин, эпирубицин, идаруцибин, дауномицин, неморубицин и их производные. Иммуноконъюгаты и пролекарства даунорубицина и доксорубицина были получены и исследованы (Kratz et al (2006) Current Med. Chem. 13:477-523; Jeffrey et al (2006) Bioorganic & Med. Chem. Letters 16:358-362; Torgov et al (2005) Bioconj. Chem. 16:717-721; Nagy et al (2000) Proc. Natl. Acad. Sci. USA 97:829-834; Dubowchik et al (2002) Bioorg. & Med. Chem. Letters 12:1529-1532; King et al (2002) J. Med. Chem. 45:4336-4343; EP 0328147; US 6630579). Конъюгат антитело-лекарственное средство BR96-доксорубицин специфично реагирует с ассоциированным с опухолью антигеном Lewis-Y и было оценено в исследованиях фазы I and II (Saleh et al (2000) J. Clin. Oncology 18:2282-2292; Ajani et al (2000) Cancer Jour. 6:78-81; Tolcher et al (1999) J. Clin. Oncology 17:478-484).

PNU-159682 является эффективным метаболитом (или производным) неморубицина (Quintieri, et al. (2005) Clinical Cancer Research 11(4):1608-1617). Неморубицин является полусинтетическим аналогом доксорубицина с 2-метоксиморфолино группой на гликозид амино доксорубицина и прошел доклинические исследования (Grandi et al (1990) Cancer Treat. Rev. 17:133; Ripamonti et al (1992) Brit. J. Cancer 65:703; ), включая анализы фазы II/III на печеночно-клеточный рак (Sun et al (2003) Proceedings of the American Society for Clinical Oncology 22, Abs1448; Quintieri (2003) Proceedings of the American Association of Cancer Research, 44:1st Ed, Abs 4649; Pacciarini et al (2006) Jour. Clin. Oncology 24:14116).

Неограничивающие иллюстративные ADC, содержащие неморубицин или производные неморубицина, показаны на Формуле Ia:

где R1 представляет собой атом водорода, гидрокси или метокси группу и R2 представляет собой С1-C5 алкокси группу, или ее фармацевтически приемлемую соль;

L1 и Z вместе представляют собой линкер (L) как описано в данном документе;

T представляет собой антитело (Ab), как описано в данном документе; и

m представляет собой от 1 до приблизительно 20. В некоторых вариантах реализации изобретения, m представляет собой 1 - 10, 1 - 7, 1 - 5, или 1 - 4.

В некоторых вариантах реализации изобретения, R1 и R2 оба представляют собой метокси (-OMe).

Дополнительные неограничивающие иллюстративные ADC, содержащие неморубицин или производные неморубицина, показаны на Формуле Ib:

где R1 представляет собой атом водорода, гидрокси или метокси группу и R2 представляет собой С1-C5 алкокси группу, или ее фармацевтически приемлемую соль;

L2 и Z вместе представляют собой линкер (L), как описано в данном документе;

T представляет собой антитело (Ab), как описано в данном документе; и

m представляет собой от 1 до приблизительно 20. В некоторых вариантах реализации изобретения, m представляет собой 1 - 10, 1 - 7, 1 - 5, или 1 - 4

В некоторых вариантах реализации изобретения, R1 и R2 оба представляют собой метокси (-OMe).

В некоторых вариантах реализации изобретения, компонент неморубицина неморубицин-содержащего ADC представляет собой PNU-159682. В некоторых таких вариантах реализации изобретения, часть лекарственного средства ADC может иметь одну из следующих структур:

; или

;

где волнистая линия указывает на присоединение к линкеру (L).

Антрациклины, включая PNU-159682, могут быть сконъюгированы с антителами через несколько сайтов связывания и разнообразные линкеры (US 2011/0076287; WO2009/099741; US 2010/0034837; WO 2010/009124) , включая линкеры, описанные в данном документе.

Иллюстративные ADCs, содержащие неморубицин и линкер, включают, не ограничиваясь приведенным:

PNU-159682 малеимид-ацеталь-Ab;

PNU-159682-val-cit-PAB-Ab;

PNU-159682-val-cit-PAB-спейсер-Ab;

PNU-159682-val-cit-PAB-спейсер (R1R2)-Ab, где:

R1 и R2 независимо выбраны из Н и С1-C6 алкила; и

PNU-159682-малеимид-Ab.

Линкер PNU-159682 малеимид ацеталь-Ab является кислотолабильным, в то время как линкеры PNU-159682-val-cit-PAB-Ab, PNU-159682-val-cit-PAB-спейсер-Ab, и PNU-159682-val-cit-PAB-спейсер (R1R2)-Ab расщепляются протеазой.

(6) Другие фрагменты лекарственных средств

Фрагменты лекарственных средств также включают гелданамицин (Mandler et al (2000) J. Nat. Cancer Inst. 92(19):1573-1581; Mandler et al (2000) Bioorganic & Med. Chem. Letters 10:1025-1028; Mandler et al (2002) Bioconjugate Chem. 13:786-791);. и ферментативно активные токсины и их фрагменты, включая, но не ограничиваясь этим, цепь дифтерии А, несвязывающиеся активные фрагменты дифтерийного токсина, цепь А экзотоксина (из синегнойной палочки), цепь рицина А, цепь А абрина, цепь А модекцина, альфа-сарцин, белки китайского тунгового дерева, диантиновые белки, белки лаконоса американского (PAPI, PAPII, и PAP-S), ингибитор момордики харантской, курцин, кротин, ингибитор мыльнянки лекарственной, гелонин, митогеллин, рестриктоцин, феномицин, эномицин и трихотецены. См., например, WO 93/21232.

Фрагменты лекарственного средства включают соединения с нуклеолитической активностью (например, рибонуклеазной или ДНК-эндонуклеазной).

В определенных вариантах реализации изобретения, иммуноконъюгат может содержать высокорадиоактивный атом. Различные радиоактивные изотопы доступны для получения радиоконъюгированных антитела. Примеры включают A At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu. В некоторых вариантах реализации изобретения, когда иммуноконъюгат используют для детекции, он может содержать радиоактивный атом для сцинтиграфических исследований, например Tc99 или I123, или спиновую метку для визуализации методом ядерного магнитного резонанса (ЯМР) (также известную как магнитно-резонансная томография, МРТ ), такой как цирконий-89, йод-123, йод-131, индий-111, фтор-19, углерод-13, азот-15, кислород-17, гадолиний, марганец или железо. Цирконий-89 может быть комплексом различных металлических хелатообразователей и конъюгирован с антителом, например, для визуализации методом позитронно-эмиссионной томографии (WO 2011/056983).

Радио- или другие метки могут быть включены в иммуноконъюгат известными способами. Например, пептид может быть получен биосинтезом или химически синтезирован с использованием подходящих аминокислот-предшественников, содержащих, например, один или более фтор-19 атомов вместо одного или более атомов водорода. В некоторых вариантах реализации изобретения, метки, такие как Tc99, I123, Re186, Re188 и In111, могут быть присоединены через остаток цистеина в антителе. В некоторых вариантах реализации изобретения, иттрий-90 может быть присоединен через остаток лизина в антителе. В некоторых вариантах реализации изобретения, способ IODOGEN (Fraker et al (1978) Biochem. Biophys. Res. Commun. 80: 49-57) может быть использован для включения йода-123. "Monoclonal Antibodies in Immunoscintigraphy" (Chatal, CRC Press 1989) описывает некоторые другие методы.

В определенных вариантах реализации изобретения, иммуноконъюгат может содержать антитело, конъюгированное с активирующим пролекарство ферментом. В некоторых таких вариантах реализации изобретения, активирующий пролекарство фермент преобразует пролекарство (например, пептидильное химиотерапевтическое средство, см WO 81/01145) в активное лекарственное средство, такое как противораковое лекарственное средство. Такие иммуноконъюгаты полезны, в некоторых вариантах реализации изобретения, в антитело-зависимой ферментно-опосредованной пролекарственной терапии («ADEPT»). Ферменты, которые могут быть конъюгированы с антителом, включают, не ограничиваясь приведенным, щелочные фосфатазы, которые полезны для превращения фосфат-содержащих пролекарств в свободные лекарственные средства; арилсульфатазы, которые полезны для превращения сульфат-содержащих пролекарств в свободные лекарственные средства; цитозиндеаминазу, которая полезна для превращения нетоксичного 5-фтороцитозина в противораковое лекарственное средство, 5-фторурацил; протеазы, такие как сераттиопротеаза, термолизин, субтилизин, карбоксипептидазы и катепсины (например, катепсины В и L), которые являются полезными для превращения пептид-содержащих пролекарств в свободные лекарственные средства; D-аланилкарбоксипептидазы, которые полезны для превращения пролекарств, которые содержат заместители D-аминокислоты; расщепляющие углеводы ферменты, такие как бета-галактозидазы и нейраминидазы, которые являются полезными для превращения гликозилированных пролекарств в свободные лекарственные средства; β-лактамазы, которые являются полезными для превращения лекарственных средств, дериватизированных лактамами, в свободные лекарственные средства; и пенициллин амидазы, такие как пенициллин V амидаза и пенициллин G амидаза, которые являются полезными для превращения лекарственных средств, дериватизованных на их атомах азота аминов феноксиацетильной или фенилацетильной групп, соответственно, в свободные лекарственные средства. В некоторых вариантах реализации изобретения, ферменты могут быть ковалентно связаны с антителами при помощи методов рекомбинантной ДНК, хорошо известных в данной области. См., например, Neuberger et al., Nature 312:604-608 (1984).

c) Содержание лекарственного средства

Содержание лекарственного средства представлено при помощи р, среднее количество молекул лекарственного средства на антитело в молекуле Формулы I. Содержание лекарственного средства может составлять от 1 до 20 фрагментов лекарственного средства (D) на антителе. ADC Формулы I включают коллекции антител, конъюгированные с различными фрагментами лекарственных средств, от 1 до 20. Среднее количество фрагментов лекарственного средства на антитело в препаратах ADC из реакций конъюгации можно охарактеризовать с помощью обычных средств, таких как масс-спектроскопия, ELISA анализ, и ВЭЖХ. Количественное распределение ADC в терминах р также может быть определено. В некоторых случаях разделение, очистка, и характеристика однородного ADC, где р представляет собой определенное значение из ADC с другими содержаниями лекарственных средств, могут быть выполнены с помощью таких средств, как обращенно-фазовая ВЭЖХ или электрофорез.

Для некоторых конъюгатов антитело-лекарственное средство, р может быть ограничено количеством сайтов присоединения на антитело. Например, если присоединение представляет собой тиол цистеина, как в некоторых иллюстративных вариантах реализации изобретения выше, антитело может иметь только одно или несколько цистеиновых тиольных групп, или может иметь только одну или несколько тиольных достаточно реакционноспособных групп, через которые может быть прикреплен линкер. В определенных вариантах реализации изобретения, более высокое содержание лекарственного средства, например р> 5, может привести к агрегации, нерастворимость, токсичность или потеря клеточной проницаемости некоторых конъюгатов антитело-лекарственное средство. В определенных вариантах реализации изобретения, среднее содержание лекарственного средства для ADC находится в диапазоне от 1 до 8; от приблизительно 2 до приблизительно 6; или от приблизительно 3 до приблизительно 5. В самом деле, было показано, что для некоторых ADCs оптимальное соотношение фрагментов лекарственного средства и антитела может составлять менее, чем 8, и может составлять приблизительно от 2 до 5 (US 7498298).

В определенных вариантах реализации изобретения, менее, чем теоретический максимум фрагментов лекарственного средства конъюгированы с антителом в ходе реакции конъюгации. Антитело может содержать, например, остатки лизина, которые не реагируют с промежуточным соединением лекарственное средство-линкер или линкерным реагентом, как описано ниже. Как правило, антитела не содержат много свободных и реактивных тиольных групп цистеина, которые могут быть связаны с фрагментом лекарственного средства; действительно наибольшее количество тиольных остатков цистеина в антителе существует в виде дисульфидных мостиков. В определенных вариантах реализации изобретения, антитело может быть восстановлено восстанавливающим агентом, таким как дитиотреитол (DTT) или трикарбонилэтилфосфин (ТСЕР), в частичных или полных восстановительных условиях, чтобы генерировать реакционноспособные тиольные группы цистеина. В определенных вариантах реализации изобретения, антитело подвергают денатурирующим условиям, чтобы выявить реактивные нуклеофильные группы, такие как лизин или цистеин.

Загрузка (соотношение лекарственного средства/антитела) ADC может быть контролировано различными способами, например, путем: (i) ограничения молярного избытка промежуточного соединения лекарственное средство-линкер или линкерного реагента, по отношению к антителу, (ii) ограничения реакции конъюгации по времени или температуре, и (iii) частичных или ограничительных восстановительных условий для модификации тиола цистеина.

Следует понимать, что когда более чем одна нуклеофильная группа реагирует с промежуточным соединением лекарственное средство-линкер или линкерным реагентом, то полученный в результате продукт представляет собой смесь соединений ADC с распределением одного или нескольких фрагментов лекарственного средства, присоединенных к антителу. Среднее количество лекарственных средств в антителе может быть рассчитано из смеси при помощи двойного dual ELISA анализа антител, который является специфичным для антитела и специфичным для лекарственного средства. Отдельные молекулы ADC могут быть идентифицированы в смеси при помощи масс-спектроскопии и разделены с помощью ВЭЖХ, например гидрофобной хроматографии (См., например, McDonagh et al (2006) Prot. Engr. Design & Selection 19(7):299-307; Hamblett et al (2004) Clin. Cancer Res. 10:7063-7070; Hamblett, K.J., et al. “Effect of drug loading on the pharmacology, pharmacokinetics, and toxicity of an анти-CD30 antibody-drug conjugate,” Abstract No. 624, American Association for Cancer Research, 2004 Annual Meeting, March 27-31, 2004, Proceedings of the AACR, Volume 45, March 2004; Alley, S.C., et al. “Controlling the location of drug attachment in antibody-drug conjugates,” Abstract No. 627, American Association for Cancer Research, 2004 Annual Meeting, March 27-31, 2004, Proceedings of the AACR, Volume 45, March 2004). В определенных вариантах реализации изобретения, однородный ADC с одним значением нагрузки может быть выделен из конъюгированной смеси с помощью электрофореза или хроматографии.

d) Некоторые способы получения иммуноконъюгатов

ADC Формулы I могут быть получены несколькими способами с применением реакций органической химии, условий и реагентов, известных специалистам в данной области, в том числе: (1) реакции нуклеофильной группы антитела с двухвалентным линкерным реагентом с образованием Ab-L с помощью ковалентной связи, с последующей реакцией с лекарственным фрагментом D; и (2) реакцией нуклеофильной группы фрагмента лекарственного средства с двухвалентным линкерным реагентом с образованием D-L посредством ковалентной связи с последующей реакцией с нуклеофильной группой антитела. Иллюстративные способы получения ADC Формулы I с помощью последнего маршрута описаны в US 7498298, который специально включен в данный документ путем ссылки.

Нуклеофильные группы на антителе включают, не ограничиваясь приведенным: (i) N-концевые аминогруппы, (ii) группы боковой цепи амина, например лизин, (iii) тиольные группы боковой цепи, например цистеин, и (iv) сахарные гидроксильные или аминогруппы, где антитело гликозилировано. Аминные, тиольные, и гидроксильные группы являются нуклеофильными и способны реагировать с образованием ковалентных связей с электрофильными группами на линкерных фрагментах или линкерных реагентах, в том числе: (i) активные сложные эфиры, такие как NHS сложные эфиры, HOBt сложные эфиры, галогенформиаты и галиды кислот; (ii) алкил и бензил галиды, такие как галоацетамиды; и (iii) альдегидные, кетонные, карбоксильные и малеимидные группы. Некоторые антитела имеют восстанавливаемые межцепочечные дисульфиды, т.е. цистеиновые мостики. Антитела могут быть получены реактивными для конъюгации с линкерными реагентами путем обработки восстановителем, таким как DTT (дитиотреитол) или трикарбонилэтилфосфин (ТСЕР), таким образом, что антитело полностью или частично восстанавливается. Каждый цистеиновый мостик, таким образом, образует, теоретически, два реактивных тиольных нуклеофила. Дополнительные нуклеофильные группы могут быть введены в антитела путем модификации остатков лизина, например, с помощью реакции остатков лизина с 2-иминотиоланом (реагент Траута), в результате чего амин превращается в тиол. Реактивные тиольные группы могут быть также введены в антитело путем введения одного, двух, трех, четырех или более остатков цистеина (например, путем получения варианта антитела, содержащего один или более не-нативных аминокислотных остатков цистеина).

Конъюгаты антител и лекарственных средств, предложенные в данном документе, также могут быть получены по реакции между электрофильной группой по антителе, такой как альдегид или кетон карбонильной группы, с нуклеофильной группой на линкерном реагенте или лекарственного средства. Полезные нуклеофильные группы на линкерном реагенте включают, не ограничиваясь приведенным, гидразид, оксим, амино, гидразин, тиосемикарбазон, гидразинкарбоксилат и арилгидразид. В одном варианте реализации изобретения антитело модифицировано для введения электрофильных групп, способных реагировать с нуклеофильными заместителями на линкерном реагенте или лекарственном средстве. В другом варианте реализации изобретения сахара гликозилированного антитела могут быть окислены, например периодатными окислительными реактивами, чтобы сформировать альдегидные или кетон группы, которые могут реагировать с аминогруппой линкерных реагентов или фрагментами лекарственного средства. Полученные в результате группы иминных оснований Шиффа могут образовывать стабильные связи, или могут быть восстановлены, например боргидридными реагентами с образованием аминных стабильных связей. В одном варианте реализации изобретения, реакция углеводной части гликозилированного антитела с галактозооксидазой или метапериодатом натрия может привести к образованию карбонильных (альдегидных и кетонных) групп в антителе, которые могут реагировать с соответствующими группами на лекарственном средстве (Hermanson, Bioconjugate Techniques). В другом варианте реализации изобретения антитела, содержащие N-концевой серин или остатки треонина, могут реагировать с метапериодатом натрия, что приводит к образованию альдегида вместо первой аминокислоты (Geoghegan & Stroh, (1992) Bioconjugate Chem. 3:138-146; US 5362852). Такой альдегид может взаимодействовать с молекулой лекарственного средства или линкерным нуклеофилом.

Иллюстративные нуклеофильные группы на фрагменте лекарственных средств включают, не ограничиваясь приведенным: аминные, тиольные, гидроксильные, гидразидные, оксимные, гидразиновые, тиосемикарбазоновые, гидразинкарбоксилатные, и арилгидразидные группы, способные реагировать с образованием ковалентных связей с электрофильными группами на линкерных фрагментах и линкерных реагентах, включая: (i) активные сложные эфиры, такие как NHS сложные эфиры, HOBt сложные эфиры, галогенформиаты и галиды кислот; (ii) алкил и бензил галиды, такие как галогенацетамиды; (iii) альдегиды, кетоны, карбоксильные и малеимидные группы.

Неограничивающие иллюстративные поперечносшивающие реагенты, которые могут быть использованы для получения ADC, описаны в данном документе в разделе, озаглавленном «Иллюстративные линкеры." Способы использования таких поперечносшивающих реагентов для соединения двух фрагментов, в том числе белкового фрагмента и химического фрагмента, известны в данной области. В некоторых вариантах реализации изобретения, слитый белок, содержащий антитело и цитотоксический агент, может быть получен, например, с помощью рекомбинантных технологий или пептидного синтеза. Рекомбинантная ДНК молекула может содержать участки, кодирующие антитело и цитотоксическое части конъюгата, расположенные рядом друг с другом или отделенные друг от друга участком кодирования пептидного линкера, который не разрушает желаемые свойства конъюгата.

В еще одном варианте реализации изобретения антитело можно конъюгировать с "рецептором" (таким как стрептавидин) для использования при предварительной направленности на опухоль, где конъюгат антитело-рецептор вводят пациенту с последующим удалением несвязанного конъюгата из кровотока с использованием агента выведения, а затем введением "лиганда" (например, авидина), который конъюгирован к цитотоксическому агенту (например, лекарственному средству либо радионуклеотиду).

E. Способы и композиции для диагностики и детекции

В определенных вариантах реализации изобретения, любое из анти-FcRH5 антител, предложенных в данном документе, полезно для обнаружения присутствия FcRH5 (например, FcRH5) в биологическом образце. Термин "детектирование", как используют в данном документе, охватывает количественную или качественную детекцию. В определенных вариантах реализации изобретения, биологический образец включает клетку или ткань. В определенных вариантах реализации изобретения, такой биологический образец включает нормальные ткани и/или раковые ткани, которые экспрессируют FcRH5 на более высоких уровнях по сравнению с другими тканями, например, В-клетки и/или В-клеточно-связанные ткани. В некоторых вариантах реализации изобретения, анти-FcRH5антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антител связывает Ig-подобный домен 9 FcRH5c.

В одном аспекте, в данном документе предложены методы обнаружения присутствия FcRH5 в биологическом образце. В определенных вариантах реализации изобретения, способ включает приведение в контакт биологического образца с анти-FcRH5 антителом в условиях, разрешающих связывание анти-FcRH5 антитело с FcRH5, и детекцию того, образуется ли комплекс между анти-FcRH5 антителом и FcRH5. В одном аспекте, настоящее изобретение относится к способу диагностики расстройств, связанных с повышенной экспрессией FcRH5. В определенных вариантах реализации изобретения, способ включает приведение в контакт тестируемой клетки с анти-FcRH5 антителом; определение уровня экспрессии (количественно, или качественно) FcRH5 тестовой клетки путем детекции связывания анти-FcRH5 антитела с FcRH5; и сравнение уровня экспрессии FcRH5 тестовой клетки с уровнем экспрессии FcRH5 контрольной клетки (например, нормальной клетки того же тканевого происхождения в качестве тестовой клетки или клетки, экспрессирующей FcRH5 на уровне, сопоставимом с уровнем экспрессии нормальной клетки), где более высокий уровень экспрессии FcRH5 тестовой клетки по сравнению с контрольной клеткой указывает на наличие расстройства, связанного с повышенной экспрессией FcRH5. В определенных вариантах реализации изобретения, тестовую клетку получают от субъектов, у которых подозревают расстройство, связанное с повышенной экспрессией FcRH5. В определенных вариантах реализации изобретения, расстройство представляет собой клеточное пролиферативное расстройство, такое как рак или опухоль. В некоторых вариантах реализации изобретения, FcRH5 представляет собой FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

Иллюстративные клеточные пролиферативные расстройства, которые могут быть диагностированы с помощью антитела, описанного в данном документе, включают расстройство B-клеток и/или B-клеточное пролиферативное расстройство, включая, но не ограничиваясь приведенным, лимфому, множественную миелому, неходжкинскую лимфому (NHL), агрессивную NHL, рецидивную агрессивную NHL, рецидивную вялотекущую NHL, резистентную NHL, резистентную вялотекущую NHL, хронический лимфолейкоз (CLL), мелкоклеточную лимфоцитарную лимфому, лейкемию, волосатоклеточный лейкоз (HCL), острый лимфобластный лейкоз (ALL), и лимфому из клеток зоны мантии.

В одном варианте реализации изобретения предложено анти-FcRH5 антитело для использования в способе диагностики или детекции. В дополнительном аспекте, предложен способ детекции присутствия FcRH5 в биологическом образце. В определенных вариантах реализации изобретения, способ включает приведение в контакт биологического образца с анти-FcRH5 антителом, как описано в данном документе, в условиях, разрешающих связывание анти-FcRH5 антитела и FcRH5, и детекцию того, образуется ли комплекс между анти-FcRH5 антителом и FcRH5 в биологическом образце. Такой метод может быть методом in vitro или in vivo. В одном варианте реализации изобретения анти-FcRH5 антитело используют для выбора субъектов, для которых приемлема терапия анти-FcRH5 антителом, например, где FcRH5 является биомаркером для отбора пациентов. В дополнительном варианте реализации изобретения, биологический образец представляет собой клетку или ткань (например, материал для биопсии). В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

В дополнительном варианте реализации изобретения анти-FcRH5 антитело используют in vivo, чтобы детектировать, например, с помощью визуализации in vivo, FcRH5-позитивный рак у субъекта, например, для целей диагностики, прогнозирования, или установления рака, определения соответствующего курсы терапии или мониторинга ответа рака на терапию. Один из способов, известных в данной области для детекции in vivo представляет собой иммуно-позитронно-эмиссионной томографию (иммуно-ПЭТ), как описано, например, в van Dongen et al., The Oncologist 12:1379-1389 (2007) and Verel et al., J. Nucl. Med. 44:1271-1281 (2003). В таких вариантах реализации изобретения предложен способ детекции FcRH5-позитивного рака у субъекта, включающий введение меченого анти-FcRH5 антитела субъекту, имеющему или у которого подозревают FcRH5-позитивный рак, и детекцию меченого анти-FcRH5 антитела у субъекта, где детекция меченого анти-антитело FcRH5 свидетельствует об FcRH5-позитивном раке у субъекта. В некоторых из таких вариантов реализации изобретения, меченое анти-FcRH5 антитело содержит анти-FcRH5 антитело, конъюгированное с излучателем позитронов, например, 68Ga, 18F, 64Cu, 86Y, 76Br, 89Zr, and 124I. В конкретном варианте реализации изобретения, излучатель позитронов представляет собой 89Zr. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связываетизоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

В дополнительных вариантах реализации изобретения способ диагностики или детекции включает приведение в контакт первого анти-FcRH5 антитела, иммобилизованного на подложке, с биологическим образцом для тестирования на наличие FcRH5, подвергая подложку воздействию второго анти-FcRH5 антитела, и детекцию того, связано ли второе анти-FcRH5 с комплексом между первым анти-FcRH5 антителом и FcRH5 в биологическом образце. Подложка может быть любой поддерживающей средой, например, стеклом, металлом, керамикой, полимерными шариками, слайдами, чипсами и другими подложками. В определенных вариантах реализации изобретения, биологический образец содержит клетку, кровь, или ткань (например, материал биопсии).

Иллюстративные расстройства, которые могут быть диагностированы или детектированы по любому из указанных выше вариантов реализации изобретения включают виды FcRH5-позитивного рака, такие как FcRH5-позитивное В-клеточное пролиферативное заболевание, FcRH5-позитивный неоплазм плазмацита и FcRH5-позитивную множественную миелому. В некоторых вариантах реализации изобретения, FcRH5-позитивный рак детектирован анти-FcRH5 иммуногистохимией (IHC) или гибридизацией in situ (ISH). В некоторых вариантах реализации изобретения, FcRH5-позитивный рак представляет собой рак, экспрессирующий FcRH5 в соответствии с анализом обратной транскриптазы ПЦР (RT-ПЦР), который определяет иРНК FcRH5. В некоторых вариантах реализации изобретения, RT-ПЦР является количественный RT-ПЦР.

В определенных вариантах реализации изобретения, предложены анти-FcRH5 антитела . В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c. Метки включают, не ограничиваясь приведенным, метки или фрагменты, которые детектируются непосредственно (например, люминесцентные, хромофорные, электронноплотные, хемилюминесцентные, и радиоактивные метки), а также фрагменты, такие как ферменты или лиганды, которые детектированы опосредованно, например, через ферментативную реакцию или молекулярное взаимодействие. Иллюстративные метки включают, не ограничиваясь приведенным, радиоизотопы 32P, 14C, 125I, 3H, и 131I, флуорофоры, такие как хелаты редкоземельных металлов или флуоресцеин и его производные, родамин и его производные, дансил, умбеллиферон, люциферазы, например, люциферазы светлячка и бактериальные люциферазы (патент США № 4,737,456), люциферин, 2,3-дигидрофталазиндионы, пероксидаза хрена (HRP), щелочная фосфатаза, β-галактозидаза, глюкоамилаза, лизоцим, оксидазы сахаридов, например, оксидазу глюкозы, оксидазу галактозы и глюкозо-6-фосфатдегидрогеназу, гетероциклические оксидазы, такие как уриказа и ксантин оксидаза, в сочетании с ферментом, который использует пероксид водорода для окисления предшественника красителя, такого как HRP, лактопероксидаза или микропероксидаза, биотин/авидин, спиновые метки, метки бактериофагов, стабильные свободные радикалы, и т.д. В другом варианте реализации изобретения метка представляет собой позитронный излучатель. Позитронные излучают включают, но не ограничиваются ими, 68Ga, 18F, 64Cu, 86Y, 76Br, 89Zr, и 124I. В конкретном варианте реализации изобретения, позитронный излучатель представляет собой 89Zr.

F. Фармацевтические композиции

Фармацевтические композиции анти-FcRH5 антитела или иммуноконъюгата, как описано в данном документе, получают путем смешивания такого антитела или иммуноконъюгата, имеющих требуемую степень чистоты, с одним или более необязательным фармацевтически приемлемым носителем (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), в форме лиофилизированных композиций или водных растворов. Фармацевтически приемлемые носители, как правило, нетоксичны для реципиентов в используемых дозировках и концентрациях и включают, не ограничиваясь приведенным: буферы, такие как фосфат, цитрат и другие органические кислоты; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (такие как хлорид октадецилдиметилбензиламмония; хлорид гексаметония; хлорид бензалкония; хлорид бензетония; фенол, бутиловый или бензиловый спирт; алкилпарабены, такие как метил- или пропилпарабен; катехол; резорцин; циклогексанол; 3-пентанол; и м-крезол); низкомолекулярные (менее чем приблизительно 10 остатков) полипептиды; белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин, лизин; или моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатирующие агенты, такие как EDTA; сахара, такие как сахароза, маннит, трегалоза или сорбит; образующие соль противоионы, такие как натрий; комплексы металлов (например Zn-белковые комплексы); и/или неионные поверхностно-активные вещества, такие как полиэтиленгликоль (ПЭГ). Иллюстративные фармацевтически приемлемые носители в данном документе дополнительно включают внутритканевые лекарственные дисперсионные агенты, такие как растворимые нейтрально-активные гликопротеины гиалуронидазы (sHASEGP), например, человеческие растворимые PH-20 гликопротеины гиалуронидазы, такие, как rHuPH20 (HYLENEX®, Baxter International, Inc.). Некоторые иллюстративные sHASEGPs и способы использования, в том числе rHuPH20, описаны в патентных публикациях США №№ 2005/0260186 и 2006/0104968. В одном аспекте, sHASEGP комбинируют с одним или несколькими дополнительными глюкозамингликаназами, такими как хондроитиназы. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

Иллюстративное лиофилизированное композиции антитела или иммуноконъюгата описаны в патенте США № 6,267,958. Водные композиции антитела или иммуноконъюгата включают те, которые описаны в патенте США № 6,171,586 и WO2006/044908, последние композиции содержат гистидин-ацетатный буфер.

Композиция в данном документе также может содержать более одного активного ингредиента, необходимо для конкретного показания, подлежащего лечению, предпочтительно с комплементарной активностью, которые не оказывают отрицательного воздействия друг на друга.

Активные ингредиенты могут быть заключены в микрокапсулы, полученные, например, способами коацервации или межфазной полимеризации, например, микрокапсулы гидроксиметилцеллюлозы или желатина и поли(метилметакрилата), соответственно, в коллоидных системах доставки лекарственных средств (например, липосомы, микросферы альбумина, микроэмульсии, наночастицы и нанокапсулы) или в макроэмульсии. Такие методы описаны в Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).

Могут быть получены лекарственные средства с замедленным высвобождением. Подходящие примеры препаратов с замедленным высвобождением включают полупроницаемые матрицы из твердых гидрофобных полимеров, содержащих антитело и/или иммуноконъюгат, где матрицы находятся в виде формованных изделий, например, пленок или микрокапсул.

Композиции, которые будут использовать для введения in vivo. обычно являются стерильными. Стерильность может быть легко достигнута, например, путем фильтрации через стерильные фильтрующие мембраны.

G. Терапевтические способы и композиции

Любое из анти-FcRH5 антител (например, FcRH5 биспецифические антитела) и/или иммуноконъюгаты, предложенные в данном описании, могут быть использованы в способах, например, терапевтических способах. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

В одном аспекте анти-FcRH5 антитело (например, FcRH5 биспецифическое антитело) и/или иммуноконъюгат, предложенные в данном описании, используют в способе ингибирования пролиферации FcRH5-позитивной клетки, включающем воздействие клетки на анти-FcRH5 антитело (например, FcRH5 биспецифическое антитело) и/или иммуноконъюгат, в условиях. разрешающих связывание анти-FcRH5 антитела (например, FcRH5 биспецифического антитела) и/или иммуноконъюгата и FcRH5 (например, FcRH5c) на поверхности клетки, тем самым препятствуя пролиферации клетки. В определенных вариантах реализации изобретения, способ представляет собой способ in vitro или in vivo. В дополнительных вариантах клетка является В-клеточным пролиферативным расстройством. В определенных вариантах реализации изобретения, клеточное пролиферативное расстройство связано с повышенной экспрессией и/или активностью FcRH5 (например, FcRH5c). Например, в определенных вариантах реализации изобретения, В-клеточное пролиферативное расстройство связано с повышенной экспрессией FcRH5 на поверхности В-клетки. В определенных вариантах реализации изобретения, В-клеточное пролиферативное расстройство представляет собой опухоль или рак. В некоторых вариантах реализации изобретения, В-клеточное пролиферативное расстройство является неоплазмом плазмацита. В некоторых вариантах реализации изобретения, неоплазм плазмацита представляет собой множественную миелому, плазмоцитому, и/или MGUS. Примеры В-клеточных пролиферативных расстройств для лечения антителами и/или иммуноконъюгатами в соответствии с данным изобретением включают, не ограничиваясь приведенным, лимфому, множественную миелому неходжкинскую лимфому (NHL), агрессивную NHL, рецидивную агрессивную NHL, рецидивную вялотекущую NHL, резистентную NHL, резистентную вялотекущую NHL, хронический лимфолейкоз (CLL), мелкоклеточную лимфоцитарную лимфому, лейкемию, волосатоклеточный лейкоз (HCL), острый лимфобластный лейкоз (ОЛЛ), и/или лимфому клеток зоны мантии.

Наличие различных биомаркеров в образце может быть проанализировано несколькими методиками, многие из которых известны в данной области и понятны специалисту в данной области, в том числе, но не ограничиваясь этим, иммуногистохимию ("IHC"), анализ Вестерн-блоттинг, иммунопреципитацию, анализы молекулярного связывания, ELISA, ELIFA, сортировку флуоресцентно активированных клеток ("FACS"), MassARRAY, протеомику, количественные анализы крови (как, например, ELISA сыворотки), биохимические анализы ферментативной активности, гибридизацию, анализ саузерн-блоттинг, анализ норзерн-блоттинг, определение последовательности полного генома, полимеразную цепную реакцию ("ПЦР"), включая количественную ПЦР в режиме реального времени ("qRT-ПЦР") и другие методы детекции типа амплификации, такие как, например, разветвленные ДНК, SISBA, ТМА и т.п., РНК-Seq, FISH, микроматричный анализ, определение профиля генной экспрессии, и/или серийный анализ экспрессии генов ("SAGE"), а также любой из широкого разнообразия анализов, которые могут быть выполнены с помощью матричного анализа белков, генов и/или тканей. Типичные протоколы для оценки состояния генов и генных продуктов можно найти, например, в Ausubel et al., eds., 1995, Current Protocols In Molecular Biology, Units 2 (норзерн-блоттинг), 4 (саузерн-блоттинг), 15 (иммуноблоттинг) и 18 (ПЦР анализ). Также могут быть использованы мультиплексные иммунологические анализы, такие как те, которые доступны от Rules Based Medicine или Meso Scale Discovery (“MSD ").

Ингибирование пролиферации клеток in vitro может быть определено с использованием люминесцентного анализа жизнеспособности клеток CellTiter-Glo™, который коммерчески доступен от Promega (Madison, WI). Это анализ определяет количество жизнеспособных клеток в культуре на основе количественного анализа присутствующего АТФ, что свидетельствует о метаболически активных клетках. См. К Crouch et al. (1993) J. Immunol. Meth. 160:81-88, патент США № 6602677. Анализ может быть проведен в 96- или 384-луночном формате, что делает его пригодным для автоматизированного высокопроизводительного скрининга (HTS). См. Cree et al. (1995) AntiCancer Drugs 6:398-404. Процедура анализа включает добавление одного реагента (реагента CellTiter-Glo®) непосредственно в культивируемые клетки. Это приводит к лизису клеток и генерации люминесцентного сигнала, производимого люциферазной реакцией. Люминесцентный сигнал пропорционален количеству присутствующего АТФ, которое прямо пропорционально количеству живых клеток, присутствующих в культуре. Данные могут быть зарегистрированы устройством визуализации люминометра или камеры с зарядовой связью. Выход люминесценции выражают в виде относительных световых единиц (RLU).

В другом аспекте предложено анти-FcRH5 антитело (например, FcRH5 биспецифическое антитело) и/или иммуноконъюгат для использования в качестве лекарственного средства. В дополнительных аспектов, предложено анти-FcRH5 антитело (например, FcRH5 биспецифическое антитело) и/или иммуноконъюгат для использования в способе лечения. В определенных вариантах реализации изобретения, предложено анти-FcRH5 антитело (например, FcRH5 биспецифическое антитело) и/или иммуноконъюгат для использования при лечении FcRH5 (например, FcRH5c)-позитивного рака. В определенных вариантах реализации изобретения, в данном документе предложено анти-FcRH5 антитело (в том числе FcRH5 биспецифическое антитело) и/или иммуноконъюгат для использования в способе лечения субъекта, имеющего FcRH5 (например, FcRH5c)-позитивный рак, включающем введение субъекту эффективное количество анти-FcRH5 антитела и/или иммуноконъюгата. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-антитела связывается FcRH5 Ig-подобный домен 9 FcRH5c. В одном таком варианте реализации изобретения способ дополнительно включает введение субъекту эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже.

В дополнительном аспекте в данном документе предложены виды использования анти-FcRH5 антитела (например, FcRH5 биспецифического антитела) и/или иммуноконъюгата при производстве или получении медикамента. В одном варианте реализации изобретения медикамент предназначен для лечения FcRH5 (например, FcRH5c)-позитивного рака. В дополнительном варианте реализации изобретения медикамент предназначен для использования в способе лечения FcRH5 (например, FcRH5c)-позитивного рака, включающем введение субъекту, имеющему FcRH5 (например, FcRH5c)-позитивный рак, эффективного количества медикамента. В одном таком варианте реализации изобретения способ дополнительно включает введение субъекту эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

В дополнительном аспекте в данном документе предложены способы лечения FcRH5 (например, FcRH5c)-позитивного рака. В одном варианте реализации изобретения способ включает введение субъекту, имеющему такой FcRH5 (например, FcRH5c)-позитивный рак, эффективного количества анти-FcRH5 антитела (например, FcRH5 биспецифического антитела) и/или иммуноконъюгата. В одном таком варианте реализации изобретения способ дополнительно включает введение субъекту эффективного количества по меньшей мере одного дополнительного терапевтического агента, как описано ниже. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

FcRH5-позитивный рак в соответствии с любым из указанных выше вариантов реализации изобретения может быть, например, FcRH5-позитивным В-клеточным пролиферативным расстройством, FcRH5-позитивным неоплазмом плазмацита, и/или FcRH5- FcRH5-позитивной множественной миеломой. В некоторых вариантах реализации изобретения, FcRH5-позитивный рак детектируют при помощи анти-FcRH5 иммуногистохимии (IHC) или гибридизации in situ (ISH). В некоторых вариантах реализации изобретения, FcRH5-позитивный рак представляет собой рак, экспрессирующий FcRH5 в соответствии с анализом обратной транскриптазы ПЦР (RT-ПЦР), который определяет иРНК FcRH5. В некоторых вариантах реализации изобретения, RT-ПЦР представляет собой количественный анализ ПЦР.

В некоторых вариантах реализации изобретения любого из указанных выше вариантов реализации изобретения субъект может быть человеком.

В дополнительном аспекте в данном документе предложены фармацевтические композиции, содержащие любые анти-FcRH5 антитела и/или иммуноконъюгаты. предложенные в данном документе, например, для использования в любом из вышеперечисленных терапевтических способов. В одном варианте реализации изобретения, фармацевтическая композиция содержит любое из анти-FcRH5 антител (например, биспецифическое антитело) и/или иммуноконъюгатов, предложенных в данном документе, и фармацевтически приемлемый носитель. В другом варианте реализации изобретения, фармацевтическая композиция содержит любое из анти-FcRH5 антител (например, биспецифическое антитело) и/или иммуноконъюгатов, предложенных в данном документе, и по меньшей мере один дополнительный терапевтический агент, например, как описано ниже.

Антитела (например, биспецифическое антитело) и/или иммуноконъюгаты, предложенные в данном документе, могут быть использованы отдельно или в комбинации с другими агентами в терапии. Такие комбинированные лекарственные средства, отмеченные выше, охватывают комбинированное введение (где два или более терапевтических агентов включены в ту же или отдельные композиции), и введение по отдельности, в этом случае, введение антитела или иммуноконъюгата, предложенных в данном документе, может произойти до, одновременно, и/или после, введения дополнительного терапевтического агента и/или адъюванта. Антитела и/или иммуноконъюгаты, предложенные в данном документе, также могут быть использованы в комбинации с лучевой терапией.

Антитело (в том числе биспецифическое антитело) и/или иммуноконъюгат, предложенные в данном документе (и любой дополнительный терапевтический агент) могут быть введены любыми приемлемыми способами, в том числе парентерально, внутрилегочно и интраназально, и, при желании для местного лечения, введением внутрь пораженных тканей. Парентеральные инфузии включают внутримышечное, внутривенное, внутриартериальное, внутрибрюшинное или подкожное введение. Дозирование может быть выполнено при помощи любого приемлемого маршрута, например с помощью инъекций, таких как внутривенные или подкожные инъекции, частично в зависимости от того, является введение кратким или длительным. Различные схемы дозирования, включая, но не ограничиваясь ими, однократное или многократные введения в различные моменты времени, болюсное введение и импульсная инфузия, рассмотрены в данном документе.

Антитела (например, биспецифическое антитело) и/или иммуноконъюгаты, предложенные в данном документе, могут быть составлены в композицию, дозированы и введены таким образом, который соответствует надлежащей медицинской практике. Факторы для рассмотрения в данном контексте включают конкретное заболевание, которое лечат, конкретное млекопитающее, подлежащее лечению, клиническое состояние отдельного пациента, причину расстройства, место доставки агента, способ введения, схему введения и другие факторы, известные практикующим врачам. Антитело (например, биспецифическое антитело) и/или иммуноконъюгат не обязательно, но необязательно составляют в композицию с одним или несколькими агентами, используемыми в настоящее время для профилактики или лечения рассматриваемого расстройства. Эффективное количество таких других агентов зависит от количества антитела или иммуноконъюгата, присутствующего в композиции, типа расстройства или лечения и других факторов, описанных выше. Их, как правило, используют в тех же дозах и с такими же маршрутами введения, как описано в данном документе, или приблизительно от 1 до 99% дозировок, описанных в данном документе, или в любой дозировке и любым маршрутом, которые эмпирически/клинически определяют как подходящие.

Для профилактики или лечения заболевания, соответствующая доза антитела (например, биспецифического антитела) и/или иммуноконъюгата, предложенных в данном документе, (при использовании отдельно или в комбинации с одним или несколькими другими дополнительными терапевтическими агентами) будет зависеть от типа заболевания, подлежащего лечению, типа антитела или иммуноконъюгата, тяжести и хода заболевания, того, вводят ли антитело (например, биспецифическое антитело) и/или иммуноконъюгат в профилактических или лечебных целях, предшествующей терапии, истории болезни и реакции пациента на антитело или иммуноконъюгат, и на усмотрение лечащего врача. Антитело (например, биспецифическое антитело) и/или иммуноконъюгат соответствующим образом вводят пациенту одновременно или в виде серии терапий. В зависимости от типа и тяжести заболевания, приблизительно 1 мкг/кг до 15 мг/кг (например 0,1 мг/кг - 10 мг-/кг) антитела или иммуноконъюгата может быть первоначальной кандидатной дозой для введения пациенту, например, с помощью одного или нескольких отдельных введений или путем непрерывной инфузии. Одна типичная суточная доза может составлять от приблизительно 1 мкг/кг до 100 мг/кг или более, в зависимости от указанных выше факторов. Для повторных введений в течение нескольких дней или дольше, в зависимости от состояния, лечение, как правило будет продолжено до желаемого подавления симптомов заболевания. Одна иллюстративная дозировка антитела (например, биспецифического антитела) и/или иммуноконъюгата будет находиться в диапазоне от приблизительно 0,05 мг/кг до приблизительно 10 мг/кг. Таким образом, одна или несколько доз от приблизительно 0,5 мг/кг, 2,0 мг/кг, 4,0 мг/кг или 10 мг/кг (или любую их комбинацию) можно вводить пациенту. Такие дозы могут быть введены с перерывами, например раз в неделю или раз в три недели (например, таким образом, когда пациент получает от двух до двадцати, или например приблизительно шесть доз антитела). Можно вводить первоначальную более высокую ударную дозу, с последующими одной или несколькими более низкими дозами. Тем не менее, могут быть полезны другие режимы дозировки. Прогресс этой терапии легко контролировать при помощи обычных методов и анализов.

Понятно, что любая из вышеперечисленных композиций может быть получена или любой из терапевтических способов может быть выполнен с использованием как иммуноконъюгата, предложенного в данном документе, так и анти-FcRH5 антитела. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает FcRH5 Ig-подобный домен 9 FcRH5c.

H. Готовые изделия

В другом аспекте, предложенном в данном документе, предложено изделие, содержащее материалы, полезные для лечения, профилактики и/или диагноза расстройств, описанных выше. Готовое изделие содержит контейнер и этикетку или вкладыш в упаковку или связанную с контейнером. Подходящие контейнеры включают, например, бутылки, флаконы, шприцы и пакеты для внутривенного раствора и т.д. Контейнеры могут быть изготовлены из различных материалов, таких как стекло или пластик. Контейнер содержит композицию, которая сама по себе или скомбинирована с другой композиций, эффективной для лечения, профилактики и/или диагностики расстройств, и может иметь стерильное входное отверстие (например, контейнер может быть пакетом для внутривенного раствора или флакон, имеющий пробку, прокалываемую иглой для подкожных инъекций). По меньшей мере один активный агент в композиции представляет собой антитело или иммуноконъюгат, предложенные в данном документе. Этикетка или вкладыш в упаковку показывает, что композицию используют для лечения выбранного состояния. Дополнительно, изделие может содержать (а) первый контейнер с композицией, содержащейся в нем, где композиция содержит FcRH5 антитело (например, биспецифическое антитело) и/или FcRH5 иммуноконъюгат, предложенный в данном описании; и (b) второй контейнер с композицией, содержащейся в нем, где композиция содержит дополнительный цитотоксический или иной терапевтический агент. Готовое изделие в этом варианте реализации изобретения, предложенном в данном описании, может дополнительно содержать вкладыш в упаковку, указывающий, что композиции могут быть использованы для лечения конкретного состояния. Альтернативно или дополнительно, изделие может дополнительно содержать второй (или третий) контейнер, содержащий фармацевтически приемлемый буфер, например, бактериостатическую воду для инъекций (BWFI), забуференный фосфатом физиологический раствор, раствор Рингера или раствор декстрозы. Оно может дополнительно содержать другие материалы, желательные с коммерческой и потребительской точки зрения, включая другие буферы, разбавители, фильтры, иглы и шприцы. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает изоформный с-специфичный участок внеклеточного домена FcRH5c. В некоторых вариантах реализации изобретения, анти-FcRH5 антитело связывает Ig-подобный домен 9 FcRH5c.

II. ПРИМЕРЫ

Ниже приведены примеры методов и композиций в соответствии с данным изобретением. Понятно, что различные другие варианты реализации изобретения могут быть осуществлены, учитывая общее описание, представленное выше.

Материалы и методы

Иммуноген (E11-flag)

Аминокислоты 745-850 человеческого FcRH5c (SEQ ID №: 1), были клонированы в экспрессирующий вектор млекопитающего pRK5.NT.Flag с использованием стандартных протоколов и временно экспрессированы в клетках СНО. Рекомбинантный белок с N-концевой Flag-экспрессирующей меткой очищали с помощью анти-flag и гель-хроматографии на колонке Superdex S200.

Разработка и характеристика мышиного анти-FcRH5 E11 антитела

Balb/c мыши (Balb/c) иммунизировали 2 мкг человеческого белка ECD FcRH5 Е11 (аминокислотные остатки 743-850 SEQ ID №: 1) (Genentech, South San Francisco, CA), смешанного с MPL+TDM (Ribi) адъювантном с помощью инъекции в подушечку лапы. Мыши получали девять доз, с последующей ударной фазой, предшествующей слиянию в PBS отдельно через подушечку лапы и IV маршрутами за три дня до слияния.

Подколенные лимфатические узлы собирали и лимфоциты этих мышей, у которых все сыворотки показали сильные титры связывания с белком иммунизации при помощи ELISA и FACS, показали сильную реактивность к SVT2 клеткам, трансфицированным человеческим FcRH5 E11 ECD, сливали с x63-Ag8.653 клетками миеломы мыши (Американская коллекция типовых фигур, Rockville, MD) через электрослияние (Harvard Apparatus, Holliston, MA). Гибридные клетки инкубировали при 37°С, 77% CO2, в течение ночи в среде C (StemCell Technologies, Vancouver, BC, Canada), перед повторным суспендированием в полу-твердой среде D (StemCell Technologies), содержащей 0,01 мг/мл FITC, меченых анти-мышиным IgG Jackson ImmunoResearch, West Grove, PA) и высеянных в Omniwell планшеты (Thermo Fisher Scientific, Rochester, NY). Через девять дней после высеивания, флуоресцентные колонии были отобраны и перенесены в 96-луночные планшеты, содержащие среду Е (StemCell Technologies) с использованием Clonepix FL (Genetix, New Milton, Hampshire, UK). Супернатанты подвергали скринингу методом ELISA против мышиного анти-IgG (MP Biomedicals, Santa Ana, CA) через семь дней после отбора.

Гибридомы, демонстрирующие экспрессию мышиного IgG методом ELISA, были расширены и подвергнуты скринингу при помощи FACS против SVT2 клеток, чрезмерно экспрессирующих полноразмерный человеческий FcRH5, FcRH5 макак, и человеческий FcRH5 E11 ECD. Сильные FACS позитивные клоны субклонировали при помощи одноклеточной сортировки с использованием FACSAria (BD, Franklin Lakes, NJ). Конечные клоны, демонстрирующие самое высокое рассматриваемое ELISA и FACS связывание после одного или двух раундов субклонировании были расширены для крупномасштабного производства в биореакторах (Integra Biosciences, Chur, Switzerland). Супернатанты затем очищали при помощи аффинной хроматографии белком А, как описано ранее (Hongo et al. 2000).

Продуцирование bisFabs

BisFabs генерировали с помощью поперечной сшивки Fab’ анти-FcRH5 Mab и Fab' анти-CD3 (UCHT1.v9) Mab на шарнирные остатки цистеина. Для генерирования 2-Fab' фрагментов из гибридомы Abs были использованы различные условия дигестии: Abs mIgG1 изотипа расщепляли 1:50 (мас./мас.) пепсином при рН 3,5 в течение 1-2 ч при 37°C; мышиного IgG2a Abs дигестировали эндопептидазой лизина C при соотношении 11: 500 (мас./ мас.), рН 8, в течение 2-4 ч при 37°C; и мышиные IgG2b Abs дигестировали лизином С при соотношении 1:100 (мас./ мас.) в течение ночи при 37°C. Во всех случаях F(ab’)2 фрагмент был выделен из реакционной смеси путем захвата колонкой SP и элюирования 10 объемов колонки с линейным градиентом (0-100%) 1 М хлорида натрия. В указанных выше условиях дигестии mIgG1 и mIgG2b вырабатывали F(ab’)2 фрагмент, содержащий три остатка цистеина С в шарнире, в то время как F(ab’)2 с mIgG2a показал два цистеиновых остатка в петле. Для генерирования Fab’ одним реактивным Cys были использованы два различных метода. Для фрагментов, содержащих нечетное (3) количество шарнирных цистеинов (mIgG1 и mIgG2b) выделенный F(ab’)2s был восстановлен в 25 мМ ацетата натрия, рН 5, 150 мМ хлорида натрия, 2 мМ ЭДТА, 2 мМ ТСЕР в течение 2 - 6 часов при комнатной температуре. После завершения стадии восстановления, образец был разбавлен до концентрации 0,2 мг/мл, рН повышали до 7,5 добавлением Трис, рН 8 и 5 мм дегидроаскорбиновой кислоты (DHAA) добавляли для запуска процесса повторного окисления цистеинов. После инкубации в течение ночи при комнатной температуре наличие восстановленных тиолов оценивали путем зондирования с избытком NEM и анализа сдвига MW с помощью масс-спектрометрии. После подтверждения наличия только одного реактивного цистеина в молекуле, Fab’ очищали гель-фильтрацией для удаления небольших количеств гомодимеров.

Для F(ab’)2 фрагментов, полученных из mIgG2a и содержащих 2 остатка цистеина в шарнире, один реактивный цистеин был произведен путем частичного блокирования с N-этил-малеимидом (NEM), как описано в Scheer et al (в печати). Кратко, антитело дигестировали пепсином (1% мас./мас.) путем обработки в буфере ацетата натрия при рН 4,5. После гидролиза в течение 1 часа, то F(ab’)2 был выделен из обрабатываемой смеси путем захвата на катионообменной смоле HP SP-и очищен с помощью 10 CV солевого градиента 0-1 М NaCl. F(ab’)2 восстанавливали 1 мМ TCEP в буфере, содержащем 25 мм MES, рН 5,8, 2 мМ ЭДТА, и 300 мМ NaCl, и Fabs были окислены путем добавления 5 мМ дегидроаскорбиновой кислоты (DHAA) чтобы преобразовать дисульфидную связь между тяжелой цепью и легкой цепью.

Эффекторное плечо bisfabs (UCHT1.v9) генерировали путем дигестии пепсином, частичного блокирования NEM и конъюгирования в бисмалеимид, как описано выше (Scheer et al; в печати). Вкратце, две тиольные группы (Cys остатки) на шарнире затем подвергали взаимодействию с 1 эквивалентом N-этилмалеимида (NEM) (Sigma Aldrich). Различные анти-FCRH5 Fab’s, содержащие один реакционноспособный цистеин, инкубировали с анти-CD3 Fab’, конъюгированным с бисмалеимидным агентом поперечной сшивки в течение ночи при комнатной температуре. Поперечносшитые Fab-фрагменты ~ 100кДа были отделены от непрореагировавших видов при помощи гель-фильтрации, а затем охарактеризованы SDS-PAGE, масс-спектрометрией и аналитической гель-проникающей хроматографией.

Экспрессия и очистка TDB

TDBs были произведены двумя разными подходами: совместным культивированием бактерий, экспрессирующих каждое из двух плечей антител или путем экспрессии каждого плеча по отдельности и затем их гибридизации in vitro. Стратегии были описаны в Christoph Spiess et al. 2012 и описаны в РСТ/US10/58958, поданной 31 мая 2011 г., которая включена в виде ссылки. Вкратце, для стратегии совместного культивирования E. coli, экспрессирующих анти-CD3 (hole) и E. Сoli, экспрессиующих анти-опухоль - мишень (knob) были выращены вместе в колбах для встряхивания при заданном соотношении таким образом, что получали одинаковое количество каждого гемимера. Совместно культивированный бактериальный бульон затем собирали, клетки разрушали в микрофлюидизаторе и антитела очищали афинностью белка A. Было замечено, что во время микрофлюидизации и захвата белка А два плеча гибридизовали и формировали шарнирные межцепочечные дисульфидные мостики (Christoph Spiess et al. 2012). Альтернативно, гемимеры антитела выращивали отдельно путем ферментации с высокой плотностью клеток и независимо выделяли при помощи белок А хроматографии. Очищенные гемимеры затем объединяли при и молярном соотношении 1:1 и инкубировали в 50 мМ Трис, рН 8,5 в присутствии 2 мМ DTT в течение 4 часов, чтобы позволить гибридизацию и восстановление дисульфидов в шарнирной области. Диализ против того же буфера без DTT в течение 24-48 часов приводил к образованию дисульфидных связей между цепями. Для обоих стратегий продуцирования биспецифическое антитело очищали от загрязнений при помощи гидрофобной хроматографии (HIC), как описано в Christoph Spiess et al. 2012. Полученный в результате материал анализировали на уровни эндотоксина с использованием системы Endosafe protable etest и при необходимости, содержание эндотоксина было снижено путем промывки белка с 0,1% Triton X-114.

TDB характеристика

Молекулярная масса биспецифического антитела была проанализирована методом масс-спектрометрии (LC-ESI/TCF), как описано ранее (Jackman et al. 2010). Антитела также анализировали с помощью аналитической гель-фильтрации в Zenix SEC-300 колонке (Sepax Technologies USA) с использованием системы Agilent 1:100 ВЭЖХ. Наличие остаточных фрагментов антитела определяли количественно с помощью электрофореза с использованием 2100 Bioanalyzer и Protein 230 Chip.

Фракционирование эритроцитов

РВМС выделяли из крови здоровых добровольцев с помощью среды разделения лимфоцитов (MP biomedicals, Solon, OH). CD8 + клетки экстрагировали из РВМС с использованием человеческих CD8 + набор для выделения от Miltenyi (#130-094-156) путем негативной селекции.

Анализы цитотоксичнсти in vitro (цитотоксическое действие на T клетки)

Для анализов цитотоксичности in vitro 1x104 клеток-мишеней высеивали на 96-луночные планшеты и инкубировали в течение ночи. 3x104 CD8 + T-клетки были добавлены с или без TDB или BisFab и их инкубировали 48 часов при + 37°С. Т-клетки удаляли двукратным промыванием питательными средами. Жизнеспособность клеток измеряли с использованием люминисцентного анализа жизнеспособности клеток CellTiter-Glo® (Promega, Madison, WI).

Альтернативно, цитотоксичность in vitro контролировали с помощью проточной цитометрии. Клетки-мишени метили карбоксифлуоресцеин сукцинимидильным сложным эфиром (CFSE) в соответствии с протоколом производителя (Invitrogen, № C34554). CFSE меченые клетки-мишени и очищенные CD8 + Т-клетки из РВМС человека были смешаны в соотношении 3:1 E:T и инкубированы с TDB или BisFab в течение 48 часов. В конце инкубации клетки были сняты трипсином и собраны с планшета. Клетки повторно суспендировали в равном объеме PBS + 2% FBS + 1 мМ ЭДТА + пропидий йод (PI). Анализ проточной цитометрии выполняли на FACSCalibur в формате автоматизации. Количество живых клеток-мишеней подсчитывали путем стробирования на CFSE+/PI-негативных клетках. Процент цитотоксичности рассчитывали следующим образом: % цитотоксичности (количество живых клеток-мишеней мас./вод. TDB - количество живых клеток-мишеней мас./TDB) / (количество живых клеток-мишеней мас./вод. TDB) x 100.

Анализ T клеточной активации

Клетки-мишени и очищенные CD8 + Т-клетки смешивали в присутствии или в отсутствие СТР и активацию Т-клеток анализировали с помощью проточной цитометрии. В конце инкубации клетки окрашивали с CD8-FITC (BD Biosciences, 555634) и СD69-PE (BD Biosciences, 555531).

Связывание субклонированных супернатантов, моноклональных антител, bisFabs и TDBs

Для тестирования связывания с эндогенно FcRH5 экспрессирующими раковыми клетками или FcRH5 трансфецированными раковыми клетками, клетки были сняты с помощью ЭДТА/PBS. 1x105 клеток суспендировали в 100 мкл и инкубировали с первичным антителом (1 объем не-IgG количественно субклонированного супернатанта, 4 мкг/мл IgG количественно субклонированного супернатанта или 2 мкг/мкл очищенного моноклонального антитела). Клетки дважды промывали FACS буфером (PBS 1% BSA 2 мМ ЭДТА) и инкубировали с 1:1000 разведением козьего анти-мышиного вторичного меченного РЕ или 1:100 козьего анти-мышиного APC. Клетки дважды промывали FACS буфером и анализ проточной цитометрии выполняли на FACSCalibur. Непосредственную ксеноновую маркировку антител выполняли в соответствии с протоколом производителя (Invitrogen), если указан. Для анализа связывания с NK или В-клетками, 1 миллион человеческих РВМС инкубировали с 4 мкг/мл IgG количественно определенных субклонированных супернатантов в течение 60 мин, промывали и инкубировали с 1:100 разведением козьего анти-мышиного вторичного меченного APC. Затем клетки снова промывали дважды и окрашивали с использованием анти-CD56 (PE; BD Biosciences № 555516) и анти-CD19 (PE; BD Biosciences № 340364) перед проведением поточной цитометрии и анализом связывания с человеческим CD56 + и СD19 + клетки.

Результаты

Первоначально для получения изоформных специфичных антител к мембранному проксимальному Ig-домену, мышей иммунизировали рекомбинантным бакуловирусом, произведенным E11 белком (аминокислоты 745-848 SEQ ID №: 1) человеческого FcRH5c и С-концевой His-экспрессирующей метки). Этот стратегия иммунизации не приведет к значительному иммунному ответу на FcRH5 и не приводит к получению моноклонального анти-FcRH5 антитела. Вторая стратегия иммунизации представляла собой ДНК-иммунизацию плазмидом, кодирующим аминокислоты 745-977 FcRH5c (SEQ ID №: 1), кодирующим мембранный проксимальный Ig-домен, трансмембранный домен и внутриклеточные домены человеческого FcRH5. Эта стратегия иммунизации не приведет к значительному иммунному ответу на FcRH5 и не приведет к получению моноклонального анти-FcRH5 антитела. Третья стратегия иммунизации использовала пептиды, соответствующие мембранному проксимальному Ig-домену FcRH5, которые были гомологичны FcRH5 макак и негомологичны человеческим FcRH1, FcRH2, FcRH3 и FcRH4. Эта стратегия иммунизации не приводила к значительному иммунному ответу на FcRH5 и не приводила к получению моноклонального анти-FcRH5 антитела.

Для четвертой стратегии иммунизации E11 белок был произведен в СНО-клетках, состоящих из мембранного проксимального человеческого Ig-домена FcRH5 (аминокислотных остатков 745-850 SEQ ID №: 1) с N-концевой Flag экспрессирующей меткой. Указанный выше рекомбинантный белок использовали для иммунизации мышей. Иммунизацию, разработку и характеристику мышиного анти-FcRH5 E11 антитела проводили, как описано подробно выше.

После 6 доз рекомбинантного E11 (аминокислотные остатки 745-850 SEQ ID №: 1), сыворотку анализировали на связывание антитела FcRH5 с помощью FACS. Значительная реактивность была обнаружена в SVT2 клетках, которые экспрессируют полноразмерный человеческий FcRH5, полноразмерный FcRH5 макак, или человеческий Е11 домен трансмембранный домен и домены цитоплазмы, но не вектор, который трансфицировали SVT2 клетками, указывая на то, что FcRH5 реактивные антитела присутствовали в сыворотке всех 5 иммунизированных мышей.

После 9 доз, лимфоциты иммунизированных мышей были электрослиты с X63-Ag8 653 клеток мышиной миеломы. 323 IgG позитивные гибридомные субклоны были отобраны для дополнительного скрининга. Клоны тестировали на связывание с рекомбинантным E11 белком (аминокислотные остатки 745-850 SEQ ID №: 1), при помощи ELISA (не показан) и связывания с SVT2 клетками, которые экспрессируют человеческий полноразмерный FcRH5, полноразмерный FcRH5 макак или человеческий E11 домен трансмембранный домен и домены цитоплазмы FcRH5 при помощи FACS. В общей сложности были идентифицированы 26 клонов, связанные к клетками, которые экспрессируют человеческий FcRH5, и клетками, которые экспрессируют FcRH5 макак, что свидетельствует о межвидовой реактивности (таблица 2). Субклонированные супернатанты дополнительно характеризовали на связывание А) клеток множественной миеломы, трансфицированных человеческим FcRH5, В) клеток, которые экспрессируют человеческий FcRH5 эндогенно (клетки миеломы MOLP-2, периферийные человеческие CD19 + В-клетки от здоровых доноров), С) SVT2 клетки, трансфицированные для экспрессии человеческих FcRH1, FcRH2, FcRH3 или FcRH4, D) 293 клеток, которые экспрессируют усеченный вариант человеческого FcRH5 (отсутствуют 4 Ig-домена, включая E11; аминокислоты 464-850 SEQ ID №: 1) и Е) NK-клеток. Дополнительно, связывание супернатантов с растворимым FcRH5a анализировали при помощи ELISA. На основании этих анализа моноклональные антитела были выбраны для очистки.

Таблица 2.

Образец SVT2-huFcRH5 SVT2-cyFcRH5 SVT2-huE11
1B8 +++ ++ ++
4H8 +++ ++ ++
1H11 +++ ++ +
4G8 ++ + +
4D4 + + +
1C8 +++ ++ +
3C10 +++ ++ ++
3A4 +++ ++ ++
6D2 +++ +++ +
3G3 ++ + +++
1F4 ++ + +
3F10 ++ + +++
1G7 +++ ++ ++
3B12 ++ + +++
3G7 +++ ++ +
5A10 +++ ++ ++
1C12 ++ + +
3D12 ++ + ++
5H4 ++ ++ +
5H9 ++ ++ +++
3C5 ++ ++ +
2D10 + + +++
5B12 ++ + ++
1H2 + + +
5F1 ++ ++ ++
2H7 ++ +++ ++

Фигура 2 демонстрирует доза-диапазон связывания пяти очищенных E11 антител, не изоформного селективного анти-FcRH5 антитела (которое связывает Ig-подобные домены 4-5 FcRH5c) и контроля антитела, специфичного для N-концевой GD-метки к клеткам SVT2, экспрессирующим либо человеческий FcRH5 (Фигура 2А), либо FcRH5 макак (Фигура 2В). Антитела в этом анализе были непосредственно помечены APC-флюорофором в соответствии с протоколом производителя (Invitrogen № z25051, z25151, z25251). Связывание репрезентативного E11 антитела и человеческого FcRH5, трансфицированного EJM (Фигура 3А) и OPM2 (Фигура 3В) клеточными линиями множественной миеломы, как было обнаружено, является аналогичным аналогичным или лучшим по сравнению с описанным ранее не изоформным селективным FcRH5 антителом и 7D11 (оба связывают Ig-подобные домены 4-5 FcRH5c) (Elkins et al., 2012; Polson et al., 2006). MOLP-2 клетки являются одним из очень немногих известных клеточных линий множественной миеломы, экспрессирубщих низкие уровни FcRH5 эндогенно. , 5F1, 3G7 и 6D2 субклональные супернатанты окрашивали MOLP-2 клетки с интенсивностью, подобной 7D11 (Фигуры 3C-F).

Два отдельных теста были разработаны для решения зависимости связывания от присутствия мембранно-проксимального Ig-домена 9 (E11). Сначала был сгенерирован усеченный человеческий FcRH5c мутант, не имеющий Ig-доменов 6-9 (аминокислоты 464-850 SEQ ID №: 1), включая ожидаемый сайт связывания антитела, полученного путем E11 иммунизации. Эта конструкция с N-концевой GD-меткой была экспрессирована в клетках 293 и подвергнута воздействию 2,5 мкг/мл субклональных супернатантов, а затем PE меченого козьего анти-мышиного вторичного антитела (разведение 1: 1000). Ни один из испытанных подклонов не связывал 293 клетки, которые экспрессируют человеческий усеченный FcRH5c (Фигура 4А). В отличие от этого, связывание было обнаружено в клетках 293, которые экспрессируют дикого типа человеческое FcRH5c. Связывание gD или не изоформного селективного клона антитела не было изменено мутацией. Этот результат показывает, что сайт связывания антитела E11 был включен в Ig-домены 6-9.

Селективность изоформ дополнительно продемонстрирована путем тестирования связывания с растворимой FcRH5a изоформой. Для этого 293-клетки трансфицировали для экспрессии растворимый изоформы с С-концевой меткой HIS-экспрессии. Экспрессия FcRH5a белка была подтверждена Вестерн-блоттингом с использованием анти-HIS антитела. 65 кД полоса была обнаружена в кондиционированной среде от FcRH5a, но не вектор- трансфицированные клетки (не показаны). Для ELISA, планшеты покрывали анти-HIS иммобилизованным антителом и инкубировали 1 час 1:10 разбавленными кондиционированными средами, содержащими HIS-меченую растворимую FcRH5a изоформу. E11 моноклональные антитела были использованы для детекции 1 - 0,001 мкг/мл концентрации, инкубировали в течение 1 часа с последующей инкубацией с козьим анти-мышиным HRP антителом и, наконец, с ТМВ-субстратом. В то время, как клоны 2Н7 и , продемонстрировали значительную реактивность с растворимым FcRH5a, другие испытанные моноклональные антитела не показывают детектируемого связывания (Фигура 5А). Этот результат подтверждает, что Ig-домен 9 (Е11) требуется для связывания антитела 1G7, 3A4, 3В12, 5F1 и 3G7, и, следовательно, эти антитела являются селективными для полноразмерной FcRH5 изоформы (FcRH5c).

FcRH5 экспрессируется эндогенно в В-клетках ((Hatzivassiliou et al., 2001; Polson et al., 2006). Для оценки связывания субклонированных супернатантов и В-клеток РВМС экстрагировали из крови здоровых доноров. 1 миллион человеческих РВМС инкубировали с 4 мкг/мл субклонированных супернатантов в течение 60 мин, промывали и инкубировали 1:100 разведениемм козьего анти-мышиного вторичного меченого АРС антитела. Клетки затем промывали снова дважды и окрашивали PE-меченым анти-CD19 (BD Biosciences # 340364) перед проточной цитометрией и анализом связывания с CD19 + клетками. Большинство супернатантов индуцировали значительный сдвиг в сигнале APC в CD19 + клеток (Фигура 5B) по сравнению с контролем (без первичного антитела, анти-gD), указывающего на связывание с В-клетками.

Семейство молекул рецепторных Fc гомологов (FcRH) имеет высокую степень гомологии друг с другом (Miller et al., 2002). Гомология особенно высока между мембранными проксимальными областями, на которые нацелено E11 антитело (Miller et al., 2002). Чтобы исследовать перекрестную реактивность к членам семейства, FcRH1, FcRH2, FcRH3 и FcRH4 (все включая N-концевую gD-экспрессирующую метку) были экспрессированы в SVT2 клетках и клетки окрашивали субклональные супернатанты и козье анти-мышиное PE вторичное антитело. Экспрессия трансфицированных FcRH была подтверждена сигналом от анти-gD антитела во всех клеточных линиях. Ни один из супернатантов не связывался значительно с FcRH2 экспрессирующими клетками по сравнению с окрашиванием gD антитела (Фигура 6В). 1B8, 1H11, 3C10, 4G8 и 6D2 показали низкий уровень связывания с FcRH1 (Фигура 6А) и 1F4, связанное с FcRH4 (Фигура 6D). В целом, сигналы от FcRH3 экспрессирующих SVT2 клеток были низкими, включая gD контрольное антитело, что свидетельствует о низком уровне экспрессии. Низкий уровень связывания с FcRH3 экспрессирующими SVT2 клетками был детектирован 1F4 и 4H8 супернатантами (Фигура 6С).

Поскольку общий сигнал в FcRH3-экспрессирующих SVT2 клетках был низким, дополнительное тестирование было выполнено с использованием PBMCs от здоровых доноров. РВМС окрашивали, как описано выше, но вместо CD19, CD56 (BD Biosciences # 555516) был использован для перехода исследуемый популяции клеток в NK клетки. NK-клетки экспрессируют эндогенно FcRH3 (Polson et al., 2006) и, как и ожидалось, были окрашены описанным ранее моноклональным анти-антителом FcRH3 (Polson et al., 2006). Экспрессия FcRH1 была также обнаружена в CD56 + клетках, но ни один из субклональных супернатантов E11 значительно не окрашивал NK клетки (Фигура 7), что указывает на отсутствие перекрестной реактивности с эндогенно экспрессированным FcRH3.

Перекрестная реактивность членов семейства была повторно протестирована с помощью протокола, идентичного описанному выше в SVT2 клетках, но с использованием свежих реагентов и повторно трансфектирующих SVT2 клеток с FcRH1, FcRH2, FcRH3 и FcRH4. Повторное тестирование очищенного антитела, как описано выше, привело к существенно различным результатам, чем первая серия экспериментов. Эти обновленные результаты приведены в Таблице 4. Вместо того, чтобы показывать малую и отсутствие перекрестной реактивности с другими членами семейства FcRH, все, кроме одного антитела (1G7), показали значительное связывание с обоими FcRH5 и по меньшей мере одним или более другими членами семейства. Не будучи связанными какой-либо теорией, это количество перекрестной реактивности антитела является таким, которого можно было бы ожидать, учитывая сходство последовательностей последнего Ig-подобного домена в различных членах семейства FcRH.

CD8+ T-клетки являются одними из самых мощных иммунных эффекторных клеток. Активность Т-клеток может быть привлечена, чтобы убить опухолевые клетки с помощью биспецифического антитела (или фрагментов антител), которое одновременно связывает как Т-клетку, так и опухолевый антиген. Двойное связывание может привести к поликлональной активации Т-клеток и специфическому убийству опухолевых антиген-экспрессирующих клеток ((Liu et al., 1985; Shalaby et al., 1992). Несколько опухолевых мишеней и несколько платформ биспецифических антител продемонстрировали общую гибкость и доклинические возможности такого подхода. Важно, обещающая клиническая активность была продемонстрирована с CD19 направленным, Т-клеточноо-активирующим биспецифическим фрагментом ScFv антитела блинатумомабом (MT103; MicroMet). Лечение дозами всего лишь 60 мкг/м2/день приводит к длительной реакции в клинических испытаниях для лечения рецидивирующей неходжкинской лимфомы и острого лимфобластного лейкоза ((Bargou et al., 2008; Dreier et al., 2002).

Способность FcRH5 антитела активировать Т-клетки и опосредовать цитотоксический эффект в формате биспецифического антитела была исследована путем создания биспецифических bisFab молекул. Короче говоря, эти биспецифические молекулы генерируются путем протеолитического расщепления антитела, с последующим восстановлением, реакцией повторного окисления и конъюгации Fab-фрагментов с использованием бис-малеамида (Scheer et al., 2012b и как описано выше). Клон UCHT1 анти-CD3 антитела связывает человеческий CD3, содержащий Т-клеточный рецептор. UCHT1.v9 ранее было показан как эффективное связывающее Т-клетки плечо (Junttila et al., 2012 и как описано выше;.. Zhu et al., 1995) и, следовательно, был использован в FcRH5 bisFabs. Девять клонов анти-антител FcRH5 (1G7, 2Н7, 3G7, , 5F1, 6D2, 3В12, 3C10, 3F10) от иммунизации E11 были выбраны для плеча-мишени и конъюгированы с UCHT1.v9 чтобы получить CD3-FcRH5 биспецифические bisFab молекулы.

Дополнительно к молекулам bisFab, также полноразмерные биспецифическое антитела (Т-клеточно зависимые биспецифические антитела; TDBs) были получены с использованием технологии «knobs-into-holes» (Merchant et al., 1998), которая основана на паре комплементарных генно разработанных Fc участков, которые запускают гетеродимеризацию гемидимеров антител. Как и в случае bisFabs, UCHT1.v9 (Zhu et al., 1995) использовали в качестве анти-CD3 (hole). Для плеча-мишени (knob), использовали клоны антител от FcRH5 E11 иммунизации, не-изоформного селективного анти-FcRH5 клона (Elkins et al., 2012) или анти-HER2 клона 4D5 (трастузумаб) (Carter et al., 1992). Генерация и очистка TDBs был подробно описана ((Junttila et al., 2012; Scheer et al., 2012a и как описано выше.).

Способность биспецифических молекул опосредовать цитотоксический эффект на FcRH5 трансфицированные 293 клетки-мишени была исследована путем инкубации мишеней с CD8 + Т-клетками (эффекторные клетки) в течение 48 часов и измерения цитотоксического эффекта с помощью анализа Cell Titer Glo или FACS цитотоксического анализа (анализов, описанных выше). Все девять bisFabs, содержащих плечо-мишень анти-FcRH5 E11, были эффективными в опосредовании цитотоксического эффекта в отношении клеток-мишеней (ФИГ. 8А-В). Цитотоксическая активность была обнаружена как всего лишь 1-10 нг/мл концентрации и насыщенных при 10-100 нг/мл концентрациях. Максимальная цитотоксическая активность превышала 80% для большинства клонов. Цитотоксическая активность была аналогична по сравнению с HER2-TDB (ФИГ. 8А-В). Человеческий HER2 экспрессируется в 293 клетках на низком уровне (данные не показаны). Наоборот, цитотоксическая активность сильно превышала активность не-изоформного селективного FcRH5 БТР , которая способна убивать только приблизительно 20% из целей (ФИГ. 8А-В). Аналогичная робастная активность была обнаружена с использованием полноразмерного формата TDB, содержащего 2Н7, 3G7 и FcRH5-E11 клонов как плечей-мишеней (ФИГ. 8C-D). Никакой существенной разницы не было обнаружено между СТР и bisFab версиями 2Н7 и 3G7, указывающими, что Fc не является ни необходимой для активности, ни ингибирующей для цитотоксической активности. FcRH5 bisFabs и полноразмерные TDBs, содержащие 2Н7 и 3G7 в качестве плеча-мишени также были в состоянии эффективно опосредовать цитотоксическую активность в отношении MOLP2 клеток, которые экспрессируют эндогенно низкие уровни FcRH5 (ФИГ. 9А). За Т-клеточной активацией следовали реакции, измеряющие доли CD8 + клеток, которые экспрессируют CD69 на клеточной мембране. Т-клеточная активация соответствовала цитотоксической активности и была аналогична и для bisFabs, и для TDBs (ФИГ. 9В). Краткое описание результатов приведено на Таблице 3.

Таблица 3

Клон IHC конгломерат клеток IHC tonils Molp2 SVT2/чел. SVT2/ макак SVT2/ FcRH1 SVT2/ FcRH2 SVT2/ FcRH3 SVT2/ FcRH4 293/huFCRH5 WT 293/ мутантные B-клеточный Моноцит NK клетка IRTA2a
1H2.2 - - + +/- + - - - - + - - - - -
1H2.5 - - + +/- +/- - - - - + - - - - -
1F4.1 - - +/- +/- +/- - - - - + - +/- - - -
1F4.2 - - + +/- +/- - - - - + - + - - -
1G7.2 - - ++ ++ + - - - - + - + - - -
1G7.4 - - + ++ + - - - - + - +/- - - -
1C8.1 + - + ++ ++ - - - - + - ++ - - +/-
1C8.3 + - + ++ ++ - - - - + - ++ - - +/-
2H7.3 + + + +++ +++ - +/- - - + - + - - ++
2H7.4 + - ++ +++ +++ - +/- - - + - + - - ++
2D10.3 + + + + +/- - - - + - +/- - - +
2D10.4 + + + + +/- - - - + - + - - -
3F10.2 + - + + + - - - + - +/- - - -
3F10.7 + - + + + - - - + - + - - -
3A4.2 - - + ++ ++ - - - - + - + - - ++
3A4.4 - - ++ ++ ++ - - - - + - + - - ++
3G7.1 - - ++ + ++ - - - - + - ++ - - +
3B12.1 + + + ++ + - - - - + - ++ - - -
3B12.2 + + + ++ + - - - - + - ++ - - -
4G8.1 + - + ++ +/- - - - - + - + - - -
5F1.1 - - ++ ++ ++ - - - - +/- - + - - -
5F1.2 - - + ++ ++ - - - - + - + - - -
5A10.1 + + ++ +++ +++ - - - - + - + - - +++
6D2.2 - - ++ ++ ++ - - - - + - + - - +
3G3.5 + - + + + - - - - + - + - - -
3G3.7 + - + + + - - - - ++ - + - - -
3C10.3 + + + ++ + - - - - ++ - + - - +
3C10.4 + + + ++ + - - - - ++ - + - - +

Таблица 4

Клон SVT2/FcRH1 SVT2/FcRH2 SVT2/FcRH3 SVT2/FcRH4 SVT2/FcRH5
1G7.2mIgG1 - - - - +++
2H7.3mIgG2b - +++ +++ - +++
3G7.1.mIgG2a - ++ +++ - +++`
5F1.1.mIgG2a +/- +/- +++ - +++
5A10.1.mIgG2b - +++ +++ - +++
3B12.1.mIgG2b - - +++ - +++
3A4.2.hIgG1 - ++ +++ - +++
6D2.2.hIgG1 - +++ ++ - +++
1C8.1.hIgG1 - ++ +++ - +++
3C10.3.hIgG1 +++ +/- - - +++
3F10.7.hIgG1 - - ++ - ++

Ссылки

Bargou, R. et al (2008). Science 321, 974-977,

Carter, P. et ai (1992). Proc Natl Acad Sci U S A 89, 4285-4289.

Dreier, T. et al. (2002), Ini J Cancer 100, 690-697.

Elkins, K. et al (2012). Mo! Cancer Ther 11, 2222-2232.

Hatzivassiliou, G, et al (2001). immunity 14, 277-289.

Liu, M. A. et at. (1985). Proc Natl Acad Sci U S A 82, 8648-8652.

Merchant, A, M. et al, (1998). Nat Biotechnol 16, 677-681.

Miller, I et al. (2002). Blood 99, 2662-2669.

Poison, A. G. et al. (2006). Expression pattern of the human FeKH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia. International immunology 18, 1363-1373.

Shalaby, M. R, et al (1992). J Exp Med 175, 217-225.

Zhu, Z. et al. (1995). Int J Cancer 62, 319-324.

Хотя настоящее изобретение было описано несколько более подробно посредством иллюстраций и примеров, приведенных в целях ясности понимания, описания и примеры не должны быть истолкованы как ограничивающие объем данного изобретения. Раскрытие всей патентной и научной литературы, процитированной в данном документе, специально включено посредством ссылки в их полноте.

Вариабельный домен легкой цепи

1C8.1

DIVMTQSQRFMSTSLGDRVSVTCKASQNVITNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYTNYPMWTFGGGTRLEIKRTVA (SEQ ID №:110)

1G7.2

DIVMTQSHKIMSTSVGDRVSITCKASQDVSNIVVWFQQKPGQSPNLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSSPYTFGGGTKLEIKRTVAA (SEQ ID №:112)

2H7.3

EIVLTQSPATLSVTPGDSVSLSCRASQNIRNNLHWYQQKSHESPRLLIKFTSQSISGIPSRFTGSGSGTDFTLSINSVETEDFGMYFCQQSNNWPQYTFGGGTKLEIKRTVAA (SEQ ID №:114)

3A4.2

DIQMTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKFASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNNWPQYTFGGGTKLELKRTVAA (SEQ ID №:116)

3B12.1.1

DIQMTQSPASLSASVGETVTITCRASENIYSNLAWYQLKQGKSPQLLVYGAANLAEGVPSRISGSGSGTQYSLKINSLQSEDFGTYYCQHFWGIPWTFGGGTKLEIKRTVAA (SEQ ID №:118)

3C10

DIQMTQTPLSLPVTLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPTFGGGTKLELKRTVAA (SEQ ID №:120)

3F10

DIVMTQSPASLSASVGETVTITCRASENIYSNLAWYQLKQGKSPQLLVYGAANLAEGVPSRISGSGSGTQYSLKINSLQSEDFGTYYCQHFWGIPWTFGGGTKLEIKRTVAA (SEQ ID №:122)

3G3

DIVMTQSPASLSASVGETVTITCRASENIYSNLAWYQLKQGKSPQLLVYGAANLAEGVPSRISGSGSGTQYSLKINSLQSEDFGTYYCQHFWGIPWTFGGGTKLEIKRTVAA (SEQ ID №:124)

3G7.1.5

DIVLIQSPATLSVTLGGSVSLSCRASQSISNNLHWYQQKSHESPRLLIKFASQSISGIPSRFRGSGSGTDFTLTINSVETEDFGIYFCQQSNNWPQYTFGGGTKLELKRTVAA (SEQ ID №:126)

5A10.1.3

DIVLTQSPANLSVIPGDSVSLSCRASQNIRNNLHWYQQKSQESPRLLIKFASQSMSGTPSRFTGSGSGTDFTLTINTVETEDFGMYFCQQSNNWPQYTFGGGTKLEIKRTVAA (SEQ ID №:128)

5F1.1.5

QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNFANWVQEKPDHLFTGLIGGTSNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCVLWCSNLWVFGGGTKLTVLGQPKAA (SEQ ID №:130)

6D2

DIVMTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQSPKLLIFWPSTRHTGVPDRFTGSGSGTDFTLTIGNVQSEDLADYFCQQFSSLPHTFGGGTKLEIKRTVAA (SEQ ID №:132)

1G7’

DIVMTQSHKIMSTSVGDRVSITCKASQDVSNIVVWFQQKPGQSPNLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSSPYTFGGGTKLEIK (SEQ ID №:134)

Вариабельный домен тяжелой цепи

1C8.1

EVQLQQSGPELVKPGASMKISCEASGYSFTAYIMNWVKQSRGKNLEWIGLINPYNGETTYNQKFKGKATLTVDQSSSTAYMELLSLTSEDSAVYFCARGLYWFPYWGQGTLVTVSAASTKGPSVFPLAP (SEQ ID №:111)

1G7.2

EVQLQESGPGLVQPSQSLSITCTVSGFSLTRFGVHWVRQSPGKGLEWLGVIWRGGSTDYNAAFMSRLTITKDNSKSQVFFKLNSLKVDDTAIYYCSNHYYGSSDYALDNWGQGTSVTVSSASTKGPSVFPLAP (SEQ ID №:113)

2H7.3

EVQLQQSGPELWKPGASVKMSCKASGYTFTDYYMKWVKQTHGKSLEWIGDINPNNGETFYSQKFKGKATLTVDKSSTTAYMQLNSLTSEDSAVYYCARGLYRFDYWGQGTTLTVSSASTKGPSVFPLAP (SEQ ID №:115)

3A4.2

EVQLQQSGPELVKSGASVKMSCKASGYTFTDYYMKWVKQSHGKSLEWIGDINPYNGETFYNQKLKGKATLTVDKSSNTVFMQLNSLTSEDSAVYYCARGLYFFAYWGQGTTLTVSSASTKGPSVFPLAP (SEQ ID №:117)

3B12.1.1

EVQLQQSGPELVKPGASVKISCKTSGYTFTEYTIHWVKQSHGKSLERIGGINPNNDAVSYNQRFRGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAKLGRGYYFDYWGQGTTLTVSSASTKGPSVFPLAP (SEQ ID №:119)

3C10

QVQLQQPGAELVRPGASVKLSCKTSGYTFISYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDTSSSTAYMQLTSPTSEDSAVYYCTRSLYGYDASYFDYWGQGTTLTVSSASTKGPSVFPLAP (SEQ ID №:121)

3F10

QVQLQQSGPELVKPGASVKISCKTSGYTFTEYTIHWVKQSHGKSLERIGGINPNNDAISYNQKFRGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAKLGRGYYFDYWGRGTTLTVSSASTKGPSVFPLAP (SEQ ID №:123)

3G3

EVQLQQSGPELVKPGASVKISCKTSGYTFTEYTIHWVKQSHGKSLERIGGINPNNDAISYNQKFRGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAKLGRGYYFDYWGRGTTLTVSSASTKGPSVFPLAP (SEQ ID №:125)

3G7.1.5

EVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMKWVRQNHGKRLEWIGDINPYNGDTFYNQKFKDKATLTVDKSSSTAYMQFNSLTSEDSAVYYCARGLYFFHYWGQGTTLTVSSASTKGPSVFPLAP (SEQ ID №:127)

5A10.1.3

EVQLQQSGPELWKPGASVKMSCKASGYTFTDYYMKWVKQSHGKSLEWIGDINPNNGETFYNQKFKGKATLTVDKSTSTAYMELNSLTTEDSAVYYCARGLYRFDYWGQGTTLTVSSAASTKGPSVFPLAP (SEQ ID №:129)

5F1.1.5

QVQLQQSGADLVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCARTRNYGYVIDYWGQGTTLTVSSASTKGPSVFPLAP (SEQ ID №:131)

6D2

QVQLQQSGPELVKPGASVKISCKASGFSFTAYFMNWVKQSHGKSPEWIGRINPYNGETFFNQNFKDKATLTVDKSSNTAHMELLSLTSDDSAVYYCGRGLYYLNYWGQGTTLTVSSASTKGPSVFPLAP (SEQ ID №:133)

1G7’

QVQLKQSGPGLVQPSQSLSITCTVSGFSLTRFGVHWVRQSPGKGLEWLGVIWRGGSTDYNAAFMSRLTITKDNSKSQVFFKLNSLKVDDTAIYYCSNHYYGSSDYALDNWGQGISVTVSS (SEQ ID №:135)

Kabat CDR L1 (HVR-L1)

24 25 26 27 27A 27B 27C 27D 27E 27F 28 29 30 31 32 33 34 SEQ ID №:
1C8.1 K A S Q . . . . . . N V I T N V A 2
1G7.2 K A S Q . . . . . . D V S N I V V 3
2H7.3 R A S Q . . . . . . N I R N N L H 4
3A4.2 R A S Q . . . . . . S I S N N L H 5
3B12.1.1 R A S E . . . . . . N I Y S N L A 6
3C10 R S S Q S L V H R . N G N T Y L H 7
3F10 R A S E . . . . . . N I Y S N L A 8
3G3 R A S E . . . . . . N I Y S N L A 9
3G7.1.5 R A S Q . . . . . . S I S N N L H 10
5A10.1.3 R A S Q . . . . . . N I R N N L H 11
5F1.1.5 R S S T G T V . . . T T S N F A N 12
6D2 K A S Q . . . . . . D V G T A V A 13

Kabat CDR L2 (HVR-L2)

50 51 52 53 54 54A 54B 54C 54D 54E 55 56 SEQ ID №:
1C8.1 S A S Y R . . . . . Y S 14
1G7.2 S A S Y R . . . . . Y T 15
2H7.3 F T S Q S . . . . . I S 16
3A4.2 F A S Q S . . . . . I S 17
3B12.1.1 G A A N L . . . . . A E 18
3C10 K V S N R . . . . . F S 19
3F10 G A A N L . . . . . A E 20
3G3 G A A N L . . . . . A E 21
3G7.1.5 F A S Q S . . . . . I S 22
5A10.1.3 F A S Q S . . . . . M S 23
5F1.1.5 G T S N R . . . . . A P 24
6D2 W P S T R . . . . . H T 25

Kabat CDR L3 (HVR-L3)

89 90 91 92 93 94 95 95A 95B 95C 95D 95E 95F 96 97 SEQ ID №:
1C8.1 Q Q Y T N Y P M . . . . . W T 26
1G7.2 Q Q H Y S S P . . . . . . Y T 27
2H7.3 Q Q S N N W P Q . . . . . Y T 28
3A4.2 Q Q S N N W P Q . . . . . Y T 29
3B12.1.1 Q H F W G I P . . . . . . W T 30
3C10 S Q S T H V P . . . . . . P T 31
3F10 Q H F W G I P . . . . . . W T 32
3G3 Q H F W G I P . . . . . . W T 33
3G7.1.5 Q Q S N N W P Q . . . . . Y T 34
5A10.1.3 Q Q S N N W P Q . . . . . Y T 35
5F1.1.5 V L W C S N L . . . . . . W V 36
6D2 Q Q F S S L P . . . . . . H T 37

Kabat CDR H1 (HVR-H1)

31 32 33 34 35 35A 35B SEQ ID №:
1C8.1 A Y I M N . . 38
1G7.2 R F G V H . . 39
2H7.3 D Y Y M K . . 40
3A4.2 D Y Y M K . . 41
3B12.1.1 E Y T I H . . 42
3C10 S Y W I N . . 43
3F10 E Y T I H . . 44
3G3 E Y T I H . . 45
3G7.1.5 D Y Y M K . . 46
5A10.1.3 D Y Y M K . . 47
5F1.1.5 N Y L I E . . 48
6D2 A Y F M N . . 49

CDR H1 (HVR-H1)

26 27 28 29 30 31 32 33 34 35 35A 35B SEQ ID №:
1C8.1 G Y S F T A Y I M N . . 50
1G7.2 G F S L T R F G V H . . 51
2H7.3 G Y T F T D Y Y M K . . 52
3A4.2 G Y T F T D Y Y M K . . 53
3B12.1.1 G Y T F T E Y T I H . . 54
3C10 G Y T F I S Y W I N . . 55
3F10 G Y T F T E Y T I H . . 56
3G3 G Y T F T E Y T I H . . 57
3G7.1.5 G Y T F T D Y Y M K . . 58
5A10.1.3 G Y T F T D Y Y M K . . 59
5F1.1.5 G Y A F T N Y L I E . . 60
6D2 G F S F T A Y F M N . . 61

Kabat CDR H2 (HVR-H2)

50 51 52 52A 52B 52C 53 54 55 56 57 58 59 60 61 62 63 64 65 SEQ ID №:
1C8.1 L I N P . . Y N G E T T Y N Q K F K G 62
1G7.2 V I W . . . R G G S T D Y N A A F M S 63
2H7.3 D I N P . . N N G E T F Y S Q K F K G 64
3A4.2 D I N P . . Y N G E T F Y N Q K L K G 65
3B12.1.1 G I N P . . N N D A V S Y N Q R F R G 66
3C10 N I Y P . . S D S Y T N Y N Q K F K D 67
3F10 G I N P . . N N D A I S Y N Q K F R G 68
3G3 G I N P . . N N D A I S Y N Q K F R G 69
3G7.1.5 D I N P . . Y N G D T F Y N Q K F K D 70
5A10.1.3 D I N P . . N N G E T F Y N Q K F K G 71
5F1.1.5 V I N P . . G S G G T N Y N E K F K G 72
6D2 R I N P . . Y N G E T F F N Q N F K D 73

CDR H2 (HVR-H2)

49 50 51 52 52A 52B 52C 53 54 55 56 57 58 59 60 61 62 63 64 65 SEQ ID №:
1C8.1 G L I N P . . Y N G E T T Y N Q K F K G 74
1G7.2 G V I W . . . R G G S T D Y N A A F M S 75
2H7.3 G D I N P . . N N G E T F Y S Q K F K G 76
3A4.2 G D I N P . . Y N G E T F Y N Q K L K G 77
3B12.1.1 G G I N P . . N N D A V S Y N Q R F R G 78
3C10 G N I Y P . . S D S Y T N Y N Q K F K D 79
3F10 G G I N P . . N N D A I S Y N Q K F R G 80
3G3 G G I N P . . N N D A I S Y N Q K F R G 81
3G7.1.5 G D I N P . . Y N G D T F Y N Q K F K D 82
5A10.1.3 G D I N P . . N N G E T F Y N Q K F K G 83
5F1.1.5 G V I N P . . G S G G T N Y N E K F K G 84
6D2 G R I N P . . Y N G E T F F N Q N F K D 85

Kabat CDR H3 (HVR-H3)

95 96 97 98 99 100 100A 100B 100C 100D 100E 100F 100G 100H 100I 100J 100K 100L 100M 101 102 SEQ ID №:
1C8.1 G L Y . . . . . . . . . . . . . . W F P Y 86
1G7.2 H Y Y G S S D . . . . . . . . . Y A L D N 87
2H7.3 G L Y R . . . . . . . . . . . . . . F D Y 88
3A4.2 G L Y F . . . . . . . . . . . . . . F A Y 89
3B12.1.1 L G R G Y . . . . . . . . . . . . Y F D Y 90
3C10 S L Y G Y D A S . . . . . . . . . Y F D Y 91
3F10 L G R G Y . . . . . . . . . . . . Y F D Y 92
3G3 L G R G Y . . . . . . . . . . . . Y F D Y 93
3G7.1.5 G L Y F . . . . . . . . . . . . . . F H Y 94
5A10.1.3 G L Y R . . . . . . . . . . . . . . F D Y 95
5F1.1.5 T R N Y G Y V . . . . . . . . . . . I D Y 96
6D2 G L Y . . . . . . . . . . . . . . Y L N Y 97

CDR H3 (HVR-H3)

93 94 95 96 97 98 99 100 100A 100B 100C 100D 100E 100F 100G 100H 100I 100J 100K 100L 100M 101 102 SEQ ID №:
1C8.1 A R G L Y . . . . . . . . . . . . . . W F P Y 98
1G7.2 S N H Y Y G S S D . . . . . . . . . Y A L D N 99
2H7.3 A R G L Y R . . . . . . . . . . . . . . F D Y 100
3A4.2 A R G L Y F . . . . . . . . . . . . . . F A Y 101
3B12.1.1 A K L G R G Y . . . . . . . . . . . . Y F D Y 102
3C10 T R S L Y G Y D A S . . . . . . . . . Y F D Y 103
3F10 A K L G R G Y . . . . . . . . . . . . Y F D Y 104
3G3 A K L G R G Y . . . . . . . . . . . . Y F D Y 105
3G7.1.5 A R G L Y F . . . . . . . . . . . . . . F H Y 106
5A10.1.3 A R G L Y R . . . . . . . . . . . . . . F D Y 107
5F1.1.5 A R T R N Y G Y V . . . . . . . . . . . I D Y 108
6D2 G R G L Y . . . . . . . . . . . . . . Y L N Y 109

FcRH5c

MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAALERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSAEALTFEGATVTLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYYCTADNGFGPQRSEVVSLFVTVPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGSSSAPSGGEASFNLSLTAEHSGNYSCEANNGLVAQHSDTISLSVIVPVSRPILTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTLGKISAPSGGGASFNLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVASTPVSGSLFLASSAPHR (SEQ ID №:1).

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

<110> GENENTECH, INC.

<120> АНТИ-FCRH5 АНТИТЕЛА

<130> GNE-0413 WO

<140>

<141>

<150> 61/838,534

<151> 2013-06-24

<160> 136

<170> PatentIn версия 3.5

<210> 1

<211> 977

<212> PRT

<213> Homo sapiens

<400> 1

Met Leu Leu Trp Val Ile Leu Leu Val Leu Ala Pro Val Ser Gly Gln

1 5 10 15

Phe Ala Arg Thr Pro Arg Pro Ile Ile Phe Leu Gln Pro Pro Trp Thr

20 25 30

Thr Val Phe Gln Gly Glu Arg Val Thr Leu Thr Cys Lys Gly Phe Arg

35 40 45

Phe Tyr Ser Pro Gln Lys Thr Lys Trp Tyr His Arg Tyr Leu Gly Lys

50 55 60

Glu Ile Leu Arg Glu Thr Pro Asp Asn Ile Leu Glu Val Gln Glu Ser

65 70 75 80

Gly Glu Tyr Arg Cys Gln Ala Gln Gly Ser Pro Leu Ser Ser Pro Val

85 90 95

His Leu Asp Phe Ser Ser Ala Ser Leu Ile Leu Gln Ala Pro Leu Ser

100 105 110

Val Phe Glu Gly Asp Ser Val Val Leu Arg Cys Arg Ala Lys Ala Glu

115 120 125

Val Thr Leu Asn Asn Thr Ile Tyr Lys Asn Asp Asn Val Leu Ala Phe

130 135 140

Leu Asn Lys Arg Thr Asp Phe His Ile Pro His Ala Cys Leu Lys Asp

145 150 155 160

Asn Gly Ala Tyr Arg Cys Thr Gly Tyr Lys Glu Ser Cys Cys Pro Val

165 170 175

Ser Ser Asn Thr Val Lys Ile Gln Val Gln Glu Pro Phe Thr Arg Pro

180 185 190

Val Leu Arg Ala Ser Ser Phe Gln Pro Ile Ser Gly Asn Pro Val Thr

195 200 205

Leu Thr Cys Glu Thr Gln Leu Ser Leu Glu Arg Ser Asp Val Pro Leu

210 215 220

Arg Phe Arg Phe Phe Arg Asp Asp Gln Thr Leu Gly Leu Gly Trp Ser

225 230 235 240

Leu Ser Pro Asn Phe Gln Ile Thr Ala Met Trp Ser Lys Asp Ser Gly

245 250 255

Phe Tyr Trp Cys Lys Ala Ala Thr Met Pro Tyr Ser Val Ile Ser Asp

260 265 270

Ser Pro Arg Ser Trp Ile Gln Val Gln Ile Pro Ala Ser His Pro Val

275 280 285

Leu Thr Leu Ser Pro Glu Lys Ala Leu Asn Phe Glu Gly Thr Lys Val

290 295 300

Thr Leu His Cys Glu Thr Gln Glu Asp Ser Leu Arg Thr Leu Tyr Arg

305 310 315 320

Phe Tyr His Glu Gly Val Pro Leu Arg His Lys Ser Val Arg Cys Glu

325 330 335

Arg Gly Ala Ser Ile Ser Phe Ser Leu Thr Thr Glu Asn Ser Gly Asn

340 345 350

Tyr Tyr Cys Thr Ala Asp Asn Gly Leu Gly Ala Lys Pro Ser Lys Ala

355 360 365

Val Ser Leu Ser Val Thr Val Pro Val Ser His Pro Val Leu Asn Leu

370 375 380

Ser Ser Pro Glu Asp Leu Ile Phe Glu Gly Ala Lys Val Thr Leu His

385 390 395 400

Cys Glu Ala Gln Arg Gly Ser Leu Pro Ile Leu Tyr Gln Phe His His

405 410 415

Glu Gly Ala Ala Leu Glu Arg Arg Ser Ala Asn Ser Ala Gly Gly Val

420 425 430

Ala Ile Ser Phe Ser Leu Thr Ala Glu His Ser Gly Asn Tyr Tyr Cys

435 440 445

Thr Ala Asp Asn Gly Phe Gly Pro Gln Arg Ser Lys Ala Val Ser Leu

450 455 460

Ser Val Thr Val Pro Val Ser His Pro Val Leu Thr Leu Ser Ser Ala

465 470 475 480

Glu Ala Leu Thr Phe Glu Gly Ala Thr Val Thr Leu His Cys Glu Val

485 490 495

Gln Arg Gly Ser Pro Gln Ile Leu Tyr Gln Phe Tyr His Glu Asp Met

500 505 510

Pro Leu Trp Ser Ser Ser Thr Pro Ser Val Gly Arg Val Ser Phe Ser

515 520 525

Phe Ser Leu Thr Glu Gly His Ser Gly Asn Tyr Tyr Cys Thr Ala Asp

530 535 540

Asn Gly Phe Gly Pro Gln Arg Ser Glu Val Val Ser Leu Phe Val Thr

545 550 555 560

Val Pro Val Ser Arg Pro Ile Leu Thr Leu Arg Val Pro Arg Ala Gln

565 570 575

Ala Val Val Gly Asp Leu Leu Glu Leu His Cys Glu Ala Pro Arg Gly

580 585 590

Ser Pro Pro Ile Leu Tyr Trp Phe Tyr His Glu Asp Val Thr Leu Gly

595 600 605

Ser Ser Ser Ala Pro Ser Gly Gly Glu Ala Ser Phe Asn Leu Ser Leu

610 615 620

Thr Ala Glu His Ser Gly Asn Tyr Ser Cys Glu Ala Asn Asn Gly Leu

625 630 635 640

Val Ala Gln His Ser Asp Thr Ile Ser Leu Ser Val Ile Val Pro Val

645 650 655

Ser Arg Pro Ile Leu Thr Phe Arg Ala Pro Arg Ala Gln Ala Val Val

660 665 670

Gly Asp Leu Leu Glu Leu His Cys Glu Ala Leu Arg Gly Ser Ser Pro

675 680 685

Ile Leu Tyr Trp Phe Tyr His Glu Asp Val Thr Leu Gly Lys Ile Ser

690 695 700

Ala Pro Ser Gly Gly Gly Ala Ser Phe Asn Leu Ser Leu Thr Thr Glu

705 710 715 720

His Ser Gly Ile Tyr Ser Cys Glu Ala Asp Asn Gly Leu Glu Ala Gln

725 730 735

Arg Ser Glu Met Val Thr Leu Lys Val Ala Val Pro Val Ser Arg Pro

740 745 750

Val Leu Thr Leu Arg Ala Pro Gly Thr His Ala Ala Val Gly Asp Leu

755 760 765

Leu Glu Leu His Cys Glu Ala Leu Arg Gly Ser Pro Leu Ile Leu Tyr

770 775 780

Arg Phe Phe His Glu Asp Val Thr Leu Gly Asn Arg Ser Ser Pro Ser

785 790 795 800

Gly Gly Ala Ser Leu Asn Leu Ser Leu Thr Ala Glu His Ser Gly Asn

805 810 815

Tyr Ser Cys Glu Ala Asp Asn Gly Leu Gly Ala Gln Arg Ser Glu Thr

820 825 830

Val Thr Leu Tyr Ile Thr Gly Leu Thr Ala Asn Arg Ser Gly Pro Phe

835 840 845

Ala Thr Gly Val Ala Gly Gly Leu Leu Ser Ile Ala Gly Leu Ala Ala

850 855 860

Gly Ala Leu Leu Leu Tyr Cys Trp Leu Ser Arg Lys Ala Gly Arg Lys

865 870 875 880

Pro Ala Ser Asp Pro Ala Arg Ser Pro Ser Asp Ser Asp Ser Gln Glu

885 890 895

Pro Thr Tyr His Asn Val Pro Ala Trp Glu Glu Leu Gln Pro Val Tyr

900 905 910

Thr Asn Ala Asn Pro Arg Gly Glu Asn Val Val Tyr Ser Glu Val Arg

915 920 925

Ile Ile Gln Glu Lys Lys Lys His Ala Val Ala Ser Asp Pro Arg His

930 935 940

Leu Arg Asn Lys Gly Ser Pro Ile Ile Tyr Ser Glu Val Lys Val Ala

945 950 955 960

Ser Thr Pro Val Ser Gly Ser Leu Phe Leu Ala Ser Ser Ala Pro His

965 970 975

Arg

<210> 2

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 2

Lys Ala Ser Gln Asn Val Ile Thr Asn Val Ala

1 5 10

<210> 3

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 3

Lys Ala Ser Gln Asp Val Ser Asn Ile Val Val

1 5 10

<210> 4

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 4

Arg Ala Ser Gln Asn Ile Arg Asn Asn Leu His

1 5 10

<210> 5

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 5

Arg Ala Ser Gln Ser Ile Ser Asn Asn Leu His

1 5 10

<210> 6

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 6

Arg Ala Ser Glu Asn Ile Tyr Ser Asn Leu Ala

1 5 10

<210> 7

<211> 16

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 7

Arg Ser Ser Gln Ser Leu Val His Arg Asn Gly Asn Thr Tyr Leu His

1 5 10 15

<210> 8

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 8

Arg Ala Ser Glu Asn Ile Tyr Ser Asn Leu Ala

1 5 10

<210> 9

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 9

Arg Ala Ser Glu Asn Ile Tyr Ser Asn Leu Ala

1 5 10

<210> 10

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 10

Arg Ala Ser Gln Ser Ile Ser Asn Asn Leu His

1 5 10

<210> 11

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 11

Arg Ala Ser Gln Asn Ile Arg Asn Asn Leu His

1 5 10

<210> 12

<211> 14

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 12

Arg Ser Ser Thr Gly Thr Val Thr Thr Ser Asn Phe Ala Asn

1 5 10

<210> 13

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 13

Lys Ala Ser Gln Asp Val Gly Thr Ala Val Ala

1 5 10

<210> 14

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 14

Ser Ala Ser Tyr Arg Tyr Ser

1 5

<210> 15

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 15

Ser Ala Ser Tyr Arg Tyr Thr

1 5

<210> 16

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 16

Phe Thr Ser Gln Ser Ile Ser

1 5

<210> 17

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 17

Phe Ala Ser Gln Ser Ile Ser

1 5

<210> 18

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 18

Gly Ala Ala Asn Leu Ala Glu

1 5

<210> 19

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 19

Lys Val Ser Asn Arg Phe Ser

1 5

<210> 20

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 20

Gly Ala Ala Asn Leu Ala Glu

1 5

<210> 21

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 21

Gly Ala Ala Asn Leu Ala Glu

1 5

<210> 22

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 22

Phe Ala Ser Gln Ser Ile Ser

1 5

<210> 23

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 23

Phe Ala Ser Gln Ser Met Ser

1 5

<210> 24

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 24

Gly Thr Ser Asn Arg Ala Pro

1 5

<210> 25

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 25

Trp Pro Ser Thr Arg His Thr

1 5

<210> 26

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 26

Gln Gln Tyr Thr Asn Tyr Pro Met Trp Thr

1 5 10

<210> 27

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 27

Gln Gln His Tyr Ser Ser Pro Tyr Thr

1 5

<210> 28

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 28

Gln Gln Ser Asn Asn Trp Pro Gln Tyr Thr

1 5 10

<210> 29

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 29

Gln Gln Ser Asn Asn Trp Pro Gln Tyr Thr

1 5 10

<210> 30

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 30

Gln His Phe Trp Gly Ile Pro Trp Thr

1 5

<210> 31

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 31

Ser Gln Ser Thr His Val Pro Pro Thr

1 5

<210> 32

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 32

Gln His Phe Trp Gly Ile Pro Trp Thr

1 5

<210> 33

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 33

Gln His Phe Trp Gly Ile Pro Trp Thr

1 5

<210> 34

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 34

Gln Gln Ser Asn Asn Trp Pro Gln Tyr Thr

1 5 10

<210> 35

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 35

Gln Gln Ser Asn Asn Trp Pro Gln Tyr Thr

1 5 10

<210> 36

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 36

Val Leu Trp Cys Ser Asn Leu Trp Val

1 5

<210> 37

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 37

Gln Gln Phe Ser Ser Leu Pro His Thr

1 5

<210> 38

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 38

Ala Tyr Ile Met Asn

1 5

<210> 39

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 39

Arg Phe Gly Val His

1 5

<210> 40

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 40

Asp Tyr Tyr Met Lys

1 5

<210> 41

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 41

Asp Tyr Tyr Met Lys

1 5

<210> 42

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 42

Glu Tyr Thr Ile His

1 5

<210> 43

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 43

Ser Tyr Trp Ile Asn

1 5

<210> 44

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 44

Glu Tyr Thr Ile His

1 5

<210> 45

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 45

Glu Tyr Thr Ile His

1 5

<210> 46

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 46

Asp Tyr Tyr Met Lys

1 5

<210> 47

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 47

Asp Tyr Tyr Met Lys

1 5

<210> 48

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 48

Asn Tyr Leu Ile Glu

1 5

<210> 49

<211> 5

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 49

Ala Tyr Phe Met Asn

1 5

<210> 50

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 50

Gly Tyr Ser Phe Thr Ala Tyr Ile Met Asn

1 5 10

<210> 51

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 51

Gly Phe Ser Leu Thr Arg Phe Gly Val His

1 5 10

<210> 52

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 52

Gly Tyr Thr Phe Thr Asp Tyr Tyr Met Lys

1 5 10

<210> 53

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 53

Gly Tyr Thr Phe Thr Asp Tyr Tyr Met Lys

1 5 10

<210> 54

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 54

Gly Tyr Thr Phe Thr Glu Tyr Thr Ile His

1 5 10

<210> 55

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 55

Gly Tyr Thr Phe Ile Ser Tyr Trp Ile Asn

1 5 10

<210> 56

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 56

Gly Tyr Thr Phe Thr Glu Tyr Thr Ile His

1 5 10

<210> 57

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 57

Gly Tyr Thr Phe Thr Glu Tyr Thr Ile His

1 5 10

<210> 58

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 58

Gly Tyr Thr Phe Thr Asp Tyr Tyr Met Lys

1 5 10

<210> 59

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 59

Gly Tyr Thr Phe Thr Asp Tyr Tyr Met Lys

1 5 10

<210> 60

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 60

Gly Tyr Ala Phe Thr Asn Tyr Leu Ile Glu

1 5 10

<210> 61

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 61

Gly Phe Ser Phe Thr Ala Tyr Phe Met Asn

1 5 10

<210> 62

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 62

Leu Ile Asn Pro Tyr Asn Gly Glu Thr Thr Tyr Asn Gln Lys Phe Lys

1 5 10 15

Gly

<210> 63

<211> 16

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 63

Val Ile Trp Arg Gly Gly Ser Thr Asp Tyr Asn Ala Ala Phe Met Ser

1 5 10 15

<210> 64

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 64

Asp Ile Asn Pro Asn Asn Gly Glu Thr Phe Tyr Ser Gln Lys Phe Lys

1 5 10 15

Gly

<210> 65

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 65

Asp Ile Asn Pro Tyr Asn Gly Glu Thr Phe Tyr Asn Gln Lys Leu Lys

1 5 10 15

Gly

<210> 66

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 66

Gly Ile Asn Pro Asn Asn Asp Ala Val Ser Tyr Asn Gln Arg Phe Arg

1 5 10 15

Gly

<210> 67

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 67

Asn Ile Tyr Pro Ser Asp Ser Tyr Thr Asn Tyr Asn Gln Lys Phe Lys

1 5 10 15

Asp

<210> 68

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 68

Gly Ile Asn Pro Asn Asn Asp Ala Ile Ser Tyr Asn Gln Lys Phe Arg

1 5 10 15

Gly

<210> 69

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 69

Gly Ile Asn Pro Asn Asn Asp Ala Ile Ser Tyr Asn Gln Lys Phe Arg

1 5 10 15

Gly

<210> 70

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 70

Asp Ile Asn Pro Tyr Asn Gly Asp Thr Phe Tyr Asn Gln Lys Phe Lys

1 5 10 15

Asp

<210> 71

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 71

Asp Ile Asn Pro Asn Asn Gly Glu Thr Phe Tyr Asn Gln Lys Phe Lys

1 5 10 15

Gly

<210> 72

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 72

Val Ile Asn Pro Gly Ser Gly Gly Thr Asn Tyr Asn Glu Lys Phe Lys

1 5 10 15

Gly

<210> 73

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 73

Arg Ile Asn Pro Tyr Asn Gly Glu Thr Phe Phe Asn Gln Asn Phe Lys

1 5 10 15

Asp

<210> 74

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 74

Gly Leu Ile Asn Pro Tyr Asn Gly Glu Thr Thr Tyr Asn Gln Lys Phe

1 5 10 15

Lys Gly

<210> 75

<211> 17

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 75

Gly Val Ile Trp Arg Gly Gly Ser Thr Asp Tyr Asn Ala Ala Phe Met

1 5 10 15

Ser

<210> 76

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 76

Gly Asp Ile Asn Pro Asn Asn Gly Glu Thr Phe Tyr Ser Gln Lys Phe

1 5 10 15

Lys Gly

<210> 77

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 77

Gly Asp Ile Asn Pro Tyr Asn Gly Glu Thr Phe Tyr Asn Gln Lys Leu

1 5 10 15

Lys Gly

<210> 78

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 78

Gly Gly Ile Asn Pro Asn Asn Asp Ala Val Ser Tyr Asn Gln Arg Phe

1 5 10 15

Arg Gly

<210> 79

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 79

Gly Asn Ile Tyr Pro Ser Asp Ser Tyr Thr Asn Tyr Asn Gln Lys Phe

1 5 10 15

Lys Asp

<210> 80

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 80

Gly Gly Ile Asn Pro Asn Asn Asp Ala Ile Ser Tyr Asn Gln Lys Phe

1 5 10 15

Arg Gly

<210> 81

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 81

Gly Gly Ile Asn Pro Asn Asn Asp Ala Ile Ser Tyr Asn Gln Lys Phe

1 5 10 15

Arg Gly

<210> 82

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 82

Gly Asp Ile Asn Pro Tyr Asn Gly Asp Thr Phe Tyr Asn Gln Lys Phe

1 5 10 15

Lys Asp

<210> 83

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 83

Gly Asp Ile Asn Pro Asn Asn Gly Glu Thr Phe Tyr Asn Gln Lys Phe

1 5 10 15

Lys Gly

<210> 84

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 84

Gly Val Ile Asn Pro Gly Ser Gly Gly Thr Asn Tyr Asn Glu Lys Phe

1 5 10 15

Lys Gly

<210> 85

<211> 18

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 85

Gly Arg Ile Asn Pro Tyr Asn Gly Glu Thr Phe Phe Asn Gln Asn Phe

1 5 10 15

Lys Asp

<210> 86

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 86

Gly Leu Tyr Trp Phe Pro Tyr

1 5

<210> 87

<211> 12

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 87

His Tyr Tyr Gly Ser Ser Asp Tyr Ala Leu Asp Asn

1 5 10

<210> 88

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 88

Gly Leu Tyr Arg Phe Asp Tyr

1 5

<210> 89

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 89

Gly Leu Tyr Phe Phe Ala Tyr

1 5

<210> 90

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 90

Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr

1 5

<210> 91

<211> 12

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 91

Ser Leu Tyr Gly Tyr Asp Ala Ser Tyr Phe Asp Tyr

1 5 10

<210> 92

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 92

Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr

1 5

<210> 93

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 93

Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr

1 5

<210> 94

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 94

Gly Leu Tyr Phe Phe His Tyr

1 5

<210> 95

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 95

Gly Leu Tyr Arg Phe Asp Tyr

1 5

<210> 96

<211> 10

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 96

Thr Arg Asn Tyr Gly Tyr Val Ile Asp Tyr

1 5 10

<210> 97

<211> 7

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 97

Gly Leu Tyr Tyr Leu Asn Tyr

1 5

<210> 98

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 98

Ala Arg Gly Leu Tyr Trp Phe Pro Tyr

1 5

<210> 99

<211> 14

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 99

Ser Asn His Tyr Tyr Gly Ser Ser Asp Tyr Ala Leu Asp Asn

1 5 10

<210> 100

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 100

Ala Arg Gly Leu Tyr Arg Phe Asp Tyr

1 5

<210> 101

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 101

Ala Arg Gly Leu Tyr Phe Phe Ala Tyr

1 5

<210> 102

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 102

Ala Lys Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr

1 5 10

<210> 103

<211> 14

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 103

Thr Arg Ser Leu Tyr Gly Tyr Asp Ala Ser Tyr Phe Asp Tyr

1 5 10

<210> 104

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 104

Ala Lys Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr

1 5 10

<210> 105

<211> 11

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 105

Ala Lys Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr

1 5 10

<210> 106

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 106

Ala Arg Gly Leu Tyr Phe Phe His Tyr

1 5

<210> 107

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 107

Ala Arg Gly Leu Tyr Arg Phe Asp Tyr

1 5

<210> 108

<211> 12

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 108

Ala Arg Thr Arg Asn Tyr Gly Tyr Val Ile Asp Tyr

1 5 10

<210> 109

<211> 9

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

пептид"

<400> 109

Gly Arg Gly Leu Tyr Tyr Leu Asn Tyr

1 5

<210> 110

<211> 112

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 110

Asp Ile Val Met Thr Gln Ser Gln Arg Phe Met Ser Thr Ser Leu Gly

1 5 10 15

Asp Arg Val Ser Val Thr Cys Lys Ala Ser Gln Asn Val Ile Thr Asn

20 25 30

Val Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Lys Ala Leu Ile

35 40 45

Tyr Ser Ala Ser Tyr Arg Tyr Ser Gly Val Pro Asp Arg Phe Thr Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Asn Val Gln Ser

65 70 75 80

Glu Asp Leu Ala Glu Tyr Phe Cys Gln Gln Tyr Thr Asn Tyr Pro Met

85 90 95

Trp Thr Phe Gly Gly Gly Thr Arg Leu Glu Ile Lys Arg Thr Val Ala

100 105 110

<210> 111

<211> 129

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 111

Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Met Lys Ile Ser Cys Glu Ala Ser Gly Tyr Ser Phe Thr Ala Tyr

20 25 30

Ile Met Asn Trp Val Lys Gln Ser Arg Gly Lys Asn Leu Glu Trp Ile

35 40 45

Gly Leu Ile Asn Pro Tyr Asn Gly Glu Thr Thr Tyr Asn Gln Lys Phe

50 55 60

Lys Gly Lys Ala Thr Leu Thr Val Asp Gln Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Glu Leu Leu Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys

85 90 95

Ala Arg Gly Leu Tyr Trp Phe Pro Tyr Trp Gly Gln Gly Thr Leu Val

100 105 110

Thr Val Ser Ala Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala

115 120 125

Pro

<210> 112

<211> 112

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 112

Asp Ile Val Met Thr Gln Ser His Lys Ile Met Ser Thr Ser Val Gly

1 5 10 15

Asp Arg Val Ser Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Asn Ile

20 25 30

Val Val Trp Phe Gln Gln Lys Pro Gly Gln Ser Pro Asn Leu Leu Ile

35 40 45

Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Asp Arg Phe Thr Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Val Gln Ala

65 70 75 80

Glu Asp Leu Ala Val Tyr Tyr Cys Gln Gln His Tyr Ser Ser Pro Tyr

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala

100 105 110

<210> 113

<211> 133

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 113

Glu Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Gln Pro Ser Gln

1 5 10 15

Ser Leu Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu Thr Arg Phe

20 25 30

Gly Val His Trp Val Arg Gln Ser Pro Gly Lys Gly Leu Glu Trp Leu

35 40 45

Gly Val Ile Trp Arg Gly Gly Ser Thr Asp Tyr Asn Ala Ala Phe Met

50 55 60

Ser Arg Leu Thr Ile Thr Lys Asp Asn Ser Lys Ser Gln Val Phe Phe

65 70 75 80

Lys Leu Asn Ser Leu Lys Val Asp Asp Thr Ala Ile Tyr Tyr Cys Ser

85 90 95

Asn His Tyr Tyr Gly Ser Ser Asp Tyr Ala Leu Asp Asn Trp Gly Gln

100 105 110

Gly Thr Ser Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val

115 120 125

Phe Pro Leu Ala Pro

130

<210> 114

<211> 113

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 114

Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Val Thr Pro Gly

1 5 10 15

Asp Ser Val Ser Leu Ser Cys Arg Ala Ser Gln Asn Ile Arg Asn Asn

20 25 30

Leu His Trp Tyr Gln Gln Lys Ser His Glu Ser Pro Arg Leu Leu Ile

35 40 45

Lys Phe Thr Ser Gln Ser Ile Ser Gly Ile Pro Ser Arg Phe Thr Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Ser Ile Asn Ser Val Glu Thr

65 70 75 80

Glu Asp Phe Gly Met Tyr Phe Cys Gln Gln Ser Asn Asn Trp Pro Gln

85 90 95

Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala

100 105 110

Ala

<210> 115

<211> 129

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 115

Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Trp Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30

Tyr Met Lys Trp Val Lys Gln Thr His Gly Lys Ser Leu Glu Trp Ile

35 40 45

Gly Asp Ile Asn Pro Asn Asn Gly Glu Thr Phe Tyr Ser Gln Lys Phe

50 55 60

Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Thr Thr Ala Tyr

65 70 75 80

Met Gln Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Gly Leu Tyr Arg Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu

100 105 110

Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala

115 120 125

Pro

<210> 116

<211> 113

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 116

Asp Ile Gln Met Thr Gln Ser Pro Ala Thr Leu Ser Val Thr Pro Gly

1 5 10 15

Asp Ser Val Ser Leu Ser Cys Arg Ala Ser Gln Ser Ile Ser Asn Asn

20 25 30

Leu His Trp Tyr Gln Gln Lys Ser His Glu Ser Pro Arg Leu Leu Ile

35 40 45

Lys Phe Ala Ser Gln Ser Ile Ser Gly Ile Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Ser Ile Asn Ser Val Glu Thr

65 70 75 80

Glu Asp Phe Gly Met Tyr Phe Cys Gln Gln Ser Asn Asn Trp Pro Gln

85 90 95

Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Leu Lys Arg Thr Val Ala

100 105 110

Ala

<210> 117

<211> 129

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 117

Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Ser Gly Ala

1 5 10 15

Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30

Tyr Met Lys Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile

35 40 45

Gly Asp Ile Asn Pro Tyr Asn Gly Glu Thr Phe Tyr Asn Gln Lys Leu

50 55 60

Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Asn Thr Val Phe

65 70 75 80

Met Gln Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Gly Leu Tyr Phe Phe Ala Tyr Trp Gly Gln Gly Thr Thr Leu

100 105 110

Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala

115 120 125

Pro

<210> 118

<211> 112

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 118

Asp Ile Gln Met Thr Gln Ser Pro Ala Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Glu Thr Val Thr Ile Thr Cys Arg Ala Ser Glu Asn Ile Tyr Ser Asn

20 25 30

Leu Ala Trp Tyr Gln Leu Lys Gln Gly Lys Ser Pro Gln Leu Leu Val

35 40 45

Tyr Gly Ala Ala Asn Leu Ala Glu Gly Val Pro Ser Arg Ile Ser Gly

50 55 60

Ser Gly Ser Gly Thr Gln Tyr Ser Leu Lys Ile Asn Ser Leu Gln Ser

65 70 75 80

Glu Asp Phe Gly Thr Tyr Tyr Cys Gln His Phe Trp Gly Ile Pro Trp

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala

100 105 110

<210> 119

<211> 131

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 119

Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Thr Ser Gly Tyr Thr Phe Thr Glu Tyr

20 25 30

Thr Ile His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Arg Ile

35 40 45

Gly Gly Ile Asn Pro Asn Asn Asp Ala Val Ser Tyr Asn Gln Arg Phe

50 55 60

Arg Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Lys Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly Thr

100 105 110

Thr Leu Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro

115 120 125

Leu Ala Pro

130

<210> 120

<211> 117

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 120

Asp Ile Gln Met Thr Gln Thr Pro Leu Ser Leu Pro Val Thr Leu Gly

1 5 10 15

Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Val His Arg

20 25 30

Asn Gly Asn Thr Tyr Leu His Trp Tyr Leu Gln Lys Pro Gly Gln Ser

35 40 45

Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro

50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile

65 70 75 80

Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Phe Cys Ser Gln Ser

85 90 95

Thr His Val Pro Pro Thr Phe Gly Gly Gly Thr Lys Leu Glu Leu Lys

100 105 110

Arg Thr Val Ala Ala

115

<210> 121

<211> 134

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 121

Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Arg Pro Gly Ala

1 5 10 15

Ser Val Lys Leu Ser Cys Lys Thr Ser Gly Tyr Thr Phe Ile Ser Tyr

20 25 30

Trp Ile Asn Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile

35 40 45

Gly Asn Ile Tyr Pro Ser Asp Ser Tyr Thr Asn Tyr Asn Gln Lys Phe

50 55 60

Lys Asp Lys Ala Thr Leu Thr Val Asp Thr Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Gln Leu Thr Ser Pro Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Thr Arg Ser Leu Tyr Gly Tyr Asp Ala Ser Tyr Phe Asp Tyr Trp Gly

100 105 110

Gln Gly Thr Thr Leu Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser

115 120 125

Val Phe Pro Leu Ala Pro

130

<210> 122

<211> 112

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 122

Asp Ile Val Met Thr Gln Ser Pro Ala Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Glu Thr Val Thr Ile Thr Cys Arg Ala Ser Glu Asn Ile Tyr Ser Asn

20 25 30

Leu Ala Trp Tyr Gln Leu Lys Gln Gly Lys Ser Pro Gln Leu Leu Val

35 40 45

Tyr Gly Ala Ala Asn Leu Ala Glu Gly Val Pro Ser Arg Ile Ser Gly

50 55 60

Ser Gly Ser Gly Thr Gln Tyr Ser Leu Lys Ile Asn Ser Leu Gln Ser

65 70 75 80

Glu Asp Phe Gly Thr Tyr Tyr Cys Gln His Phe Trp Gly Ile Pro Trp

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala

100 105 110

<210> 123

<211> 131

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 123

Gln Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Thr Ser Gly Tyr Thr Phe Thr Glu Tyr

20 25 30

Thr Ile His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Arg Ile

35 40 45

Gly Gly Ile Asn Pro Asn Asn Asp Ala Ile Ser Tyr Asn Gln Lys Phe

50 55 60

Arg Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Lys Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr Trp Gly Arg Gly Thr

100 105 110

Thr Leu Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro

115 120 125

Leu Ala Pro

130

<210> 124

<211> 112

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 124

Asp Ile Val Met Thr Gln Ser Pro Ala Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Glu Thr Val Thr Ile Thr Cys Arg Ala Ser Glu Asn Ile Tyr Ser Asn

20 25 30

Leu Ala Trp Tyr Gln Leu Lys Gln Gly Lys Ser Pro Gln Leu Leu Val

35 40 45

Tyr Gly Ala Ala Asn Leu Ala Glu Gly Val Pro Ser Arg Ile Ser Gly

50 55 60

Ser Gly Ser Gly Thr Gln Tyr Ser Leu Lys Ile Asn Ser Leu Gln Ser

65 70 75 80

Glu Asp Phe Gly Thr Tyr Tyr Cys Gln His Phe Trp Gly Ile Pro Trp

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala

100 105 110

<210> 125

<211> 131

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 125

Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Thr Ser Gly Tyr Thr Phe Thr Glu Tyr

20 25 30

Thr Ile His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Arg Ile

35 40 45

Gly Gly Ile Asn Pro Asn Asn Asp Ala Ile Ser Tyr Asn Gln Lys Phe

50 55 60

Arg Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Lys Leu Gly Arg Gly Tyr Tyr Phe Asp Tyr Trp Gly Arg Gly Thr

100 105 110

Thr Leu Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro

115 120 125

Leu Ala Pro

130

<210> 126

<211> 113

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 126

Asp Ile Val Leu Ile Gln Ser Pro Ala Thr Leu Ser Val Thr Leu Gly

1 5 10 15

Gly Ser Val Ser Leu Ser Cys Arg Ala Ser Gln Ser Ile Ser Asn Asn

20 25 30

Leu His Trp Tyr Gln Gln Lys Ser His Glu Ser Pro Arg Leu Leu Ile

35 40 45

Lys Phe Ala Ser Gln Ser Ile Ser Gly Ile Pro Ser Arg Phe Arg Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Ser Val Glu Thr

65 70 75 80

Glu Asp Phe Gly Ile Tyr Phe Cys Gln Gln Ser Asn Asn Trp Pro Gln

85 90 95

Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Leu Lys Arg Thr Val Ala

100 105 110

Ala

<210> 127

<211> 129

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 127

Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30

Tyr Met Lys Trp Val Arg Gln Asn His Gly Lys Arg Leu Glu Trp Ile

35 40 45

Gly Asp Ile Asn Pro Tyr Asn Gly Asp Thr Phe Tyr Asn Gln Lys Phe

50 55 60

Lys Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Gln Phe Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Gly Leu Tyr Phe Phe His Tyr Trp Gly Gln Gly Thr Thr Leu

100 105 110

Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala

115 120 125

Pro

<210> 128

<211> 113

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 128

Asp Ile Val Leu Thr Gln Ser Pro Ala Asn Leu Ser Val Ile Pro Gly

1 5 10 15

Asp Ser Val Ser Leu Ser Cys Arg Ala Ser Gln Asn Ile Arg Asn Asn

20 25 30

Leu His Trp Tyr Gln Gln Lys Ser Gln Glu Ser Pro Arg Leu Leu Ile

35 40 45

Lys Phe Ala Ser Gln Ser Met Ser Gly Thr Pro Ser Arg Phe Thr Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Thr Val Glu Thr

65 70 75 80

Glu Asp Phe Gly Met Tyr Phe Cys Gln Gln Ser Asn Asn Trp Pro Gln

85 90 95

Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala

100 105 110

Ala

<210> 129

<211> 130

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 129

Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Trp Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr

20 25 30

Tyr Met Lys Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile

35 40 45

Gly Asp Ile Asn Pro Asn Asn Gly Glu Thr Phe Tyr Asn Gln Lys Phe

50 55 60

Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Thr Ser Thr Ala Tyr

65 70 75 80

Met Glu Leu Asn Ser Leu Thr Thr Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Gly Leu Tyr Arg Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu

100 105 110

Thr Val Ser Ser Ala Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu

115 120 125

Ala Pro

130

<210> 130

<211> 115

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 130

Gln Ala Val Val Thr Gln Glu Ser Ala Leu Thr Thr Ser Pro Gly Glu

1 5 10 15

Thr Val Thr Leu Thr Cys Arg Ser Ser Thr Gly Thr Val Thr Thr Ser

20 25 30

Asn Phe Ala Asn Trp Val Gln Glu Lys Pro Asp His Leu Phe Thr Gly

35 40 45

Leu Ile Gly Gly Thr Ser Asn Arg Ala Pro Gly Val Pro Ala Arg Phe

50 55 60

Ser Gly Ser Leu Ile Gly Asp Lys Ala Ala Leu Thr Ile Thr Gly Ala

65 70 75 80

Gln Thr Glu Asp Glu Ala Ile Tyr Phe Cys Val Leu Trp Cys Ser Asn

85 90 95

Leu Trp Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly Gln Pro

100 105 110

Lys Ala Ala

115

<210> 131

<211> 132

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 131

Gln Val Gln Leu Gln Gln Ser Gly Ala Asp Leu Val Arg Pro Gly Thr

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ala Phe Thr Asn Tyr

20 25 30

Leu Ile Glu Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile

35 40 45

Gly Val Ile Asn Pro Gly Ser Gly Gly Thr Asn Tyr Asn Glu Lys Phe

50 55 60

Lys Gly Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Gln Leu Ser Ser Leu Thr Ser Asp Asp Ser Ala Val Tyr Phe Cys

85 90 95

Ala Arg Thr Arg Asn Tyr Gly Tyr Val Ile Asp Tyr Trp Gly Gln Gly

100 105 110

Thr Thr Leu Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe

115 120 125

Pro Leu Ala Pro

130

<210> 132

<211> 112

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 132

Asp Ile Val Met Thr Gln Ser His Lys Phe Met Ser Thr Ser Val Gly

1 5 10 15

Asp Arg Val Ser Ile Thr Cys Lys Ala Ser Gln Asp Val Gly Thr Ala

20 25 30

Val Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile

35 40 45

Phe Trp Pro Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Thr Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Gly Asn Val Gln Ser

65 70 75 80

Glu Asp Leu Ala Asp Tyr Phe Cys Gln Gln Phe Ser Ser Leu Pro His

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala

100 105 110

<210> 133

<211> 129

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 133

Gln Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Phe Ser Phe Thr Ala Tyr

20 25 30

Phe Met Asn Trp Val Lys Gln Ser His Gly Lys Ser Pro Glu Trp Ile

35 40 45

Gly Arg Ile Asn Pro Tyr Asn Gly Glu Thr Phe Phe Asn Gln Asn Phe

50 55 60

Lys Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Asn Thr Ala His

65 70 75 80

Met Glu Leu Leu Ser Leu Thr Ser Asp Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Gly Arg Gly Leu Tyr Tyr Leu Asn Tyr Trp Gly Gln Gly Thr Thr Leu

100 105 110

Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala

115 120 125

Pro

<210> 134

<211> 107

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 134

Asp Ile Val Met Thr Gln Ser His Lys Ile Met Ser Thr Ser Val Gly

1 5 10 15

Asp Arg Val Ser Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Asn Ile

20 25 30

Val Val Trp Phe Gln Gln Lys Pro Gly Gln Ser Pro Asn Leu Leu Ile

35 40 45

Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Asp Arg Phe Thr Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Val Gln Ala

65 70 75 80

Glu Asp Leu Ala Val Tyr Tyr Cys Gln Gln His Tyr Ser Ser Pro Tyr

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105

<210> 135

<211> 120

<212> PRT

<213> искусственная последовательность

<220>

<221> источник

<223> /примечание="описание искусственной последовательности: синтетический

полипептид"

<400> 135

Gln Val Gln Leu Lys Gln Ser Gly Pro Gly Leu Val Gln Pro Ser Gln

1 5 10 15

Ser Leu Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu Thr Arg Phe

20 25 30

Gly Val His Trp Val Arg Gln Ser Pro Gly Lys Gly Leu Glu Trp Leu

35 40 45

Gly Val Ile Trp Arg Gly Gly Ser Thr Asp Tyr Asn Ala Ala Phe Met

50 55 60

Ser Arg Leu Thr Ile Thr Lys Asp Asn Ser Lys Ser Gln Val Phe Phe

65 70 75 80

Lys Leu Asn Ser Leu Lys Val Asp Asp Thr Ala Ile Tyr Tyr Cys Ser

85 90 95

Asn His Tyr Tyr Gly Ser Ser Asp Tyr Ala Leu Asp Asn Trp Gly Gln

100 105 110

Gly Ile Ser Val Thr Val Ser Ser

115 120

<210> 136

<211> 233

<212> PRT

<213> Homo sapiens

<400> 136

Val Ala Val Pro Val Ser Arg Pro Val Leu Thr Leu Arg Ala Pro Gly

1 5 10 15

Thr His Ala Ala Val Gly Asp Leu Leu Glu Leu His Cys Glu Ala Leu

20 25 30

Arg Gly Ser Pro Leu Ile Leu Tyr Arg Phe Phe His Glu Asp Val Thr

35 40 45

Leu Gly Asn Arg Ser Ser Pro Ser Gly Gly Ala Ser Leu Asn Leu Ser

50 55 60

Leu Thr Ala Glu His Ser Gly Asn Tyr Ser Cys Glu Ala Asp Asn Gly

65 70 75 80

Leu Gly Ala Gln Arg Ser Glu Thr Val Thr Leu Tyr Ile Thr Gly Leu

85 90 95

Thr Ala Asn Arg Ser Gly Pro Phe Ala Thr Gly Val Ala Gly Gly Leu

100 105 110

Leu Ser Ile Ala Gly Leu Ala Ala Gly Ala Leu Leu Leu Tyr Cys Trp

115 120 125

Leu Ser Arg Lys Ala Gly Arg Lys Pro Ala Ser Asp Pro Ala Arg Ser

130 135 140

Pro Ser Asp Ser Asp Ser Gln Glu Pro Thr Tyr His Asn Val Pro Ala

145 150 155 160

Trp Glu Glu Leu Gln Pro Val Tyr Thr Asn Ala Asn Pro Arg Gly Glu

165 170 175

Asn Val Val Tyr Ser Glu Val Arg Ile Ile Gln Glu Lys Lys Lys His

180 185 190

Ala Val Ala Ser Asp Pro Arg His Leu Arg Asn Lys Gly Ser Pro Ile

195 200 205

Ile Tyr Ser Glu Val Lys Val Ala Ser Thr Pro Val Ser Gly Ser Leu

210 215 220

Phe Leu Ala Ser Ser Ala Pro His Arg

225 230

1. Способ получения анти-FcRH5 антитела, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c и незначительно связывается с другим Ig-подобным доменом FcRH5, где способ включает стадии:

(a) иммунизации мыши белком, выбранным из группы, состоящей из:

(i) аминокислот от 745 до 850 последовательности SEQ ID NO:1,

(ii) аминокислот от 745 до 851 последовательности SEQ ID NO:1,

(iii) аминокислот от 752 до 834 последовательности SEQ ID NO:1 и

(iv) аминокислот от 754 до 835 последовательности SEQ ID NO:1;

(b) выделения лимфоцитов из указанной мыши и слияние с клетками миеломы с получением гибридомы; и

(c) сбор анти-FcRH5 антитела из гибридомы.

2. Способ по п.1, при котором белок имеет аминокислоты 745-850 последовательности SEQ ID NO:1.

3. Способ по п.1, при котором белок имеет аминокислоты 745-851 последовательности SEQ ID NO:1.

4. Способ по п.1, при котором белок имеет аминокислоты 752-834 последовательности SEQ ID NO:1.

5. Способ по п.1, при котором белок имеет аминокислоты 754-835 последовательности SEQ ID NO:1.

6. Выделенное анти-FcRH5 антитело, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c и незначительно связывается с другим Ig-подобным доменом FcRH5, полученное способом, включающим стадии:

(a) иммунизации мыши белком, выбранным из группы, состоящей из:

(i) аминокислот от 745 до 850 последовательности SEQ ID NO:1,

(ii) аминокислот от 745 до 851 последовательности SEQ ID NO:1,

(iii) аминокислот от 752 до 834 последовательности SEQ ID NO:1 и

(iv) аминокислот от 754 до 835 последовательности SEQ ID NO:1;

(b) выделения лимфоцитов из указанной мыши и слияние с клетками миеломы с получением гибридомы; и

(c) сбор анти-FcRH5 антитела из гибридомы.

7. Выделенное анти-FcRH5 антитело по п.6, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c, показанным как аминокислоты 745-850 последовательности SEQ ID NO:1.

8. Выделенное анти-FcRH5 антитело по п.6, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c, показанным как аминокислоты 745-851 последовательности SEQ ID NO:1.

9. Выделенное анти-FcRH5 антитело по п.6, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c, показанным как аминокислоты 752-834 последовательности SEQ ID NO:1.

10. Выделенное анти-FcRH5 антитело по п.6, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c, показанным как аминокислоты 754-835 последовательности SEQ ID NO:1.

11. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:38,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:62, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:86; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:2,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:14, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:26.

12. Анти-FcRH5 антитело по п.11, отличающееся тем, что

тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:50,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:74, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:98.

13. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:39,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:63, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:87; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:3,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:15, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:27.

14. Анти-FcRH5 антитело по п.13, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:51,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:75, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:99.

15. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:41,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:65, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:89; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:5,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:17, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:29.

16. Анти-FcRH5 антитело по п.15, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:53,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:77, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:101.

17. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:42,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:66, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:90; и

b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:6,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:18, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:30.

18. Анти-FcRH5 антитело по п.17, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:54,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:78, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:102.

19. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:43,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:67, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:91; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:7,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:19, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:31.

20. Анти-FcRH5 антитело по п.19, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:55,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:79, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:103.

21. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:44,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:68, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:92; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:8,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:20, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:32.

22. Анти-FcRH5 антитело по п.21, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:56,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:80, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:104.

23. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:45,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:69, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:93; и

b) легкую цепь, содержащую HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:9,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:21, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:33.

24. Анти-FcRH5 антитело по п.23, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:57,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:81, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:105.

25. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:46,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:70, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:94; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:10,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:22, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:34.

26. Анти-FcRH5 антитело по п.25, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:58,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:82, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:106.

27. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:48,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:72, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:96; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:12,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:24, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:36.

28. Анти-FcRH5 антитело по п.27, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:60,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:84, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:108.

29. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:49,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:73, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:97; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:13,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:25, и

НVR-L3, содержащий аминокислотную последовательность SEQ ID NO:37.

30. Анти-FcRH5 антитело по п.29, отличающееся тем, что тяжелая цепь содержит

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:61,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:85, и

НVR-H3, содержащий аминокислотную последовательность SEQ ID NO:109.

31. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

(a) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:113, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:112;

(b) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:135, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:134;

(c) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:111, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:110;

(d) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:117, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:116;

(e) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:119, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:118;

(f) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:121, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:120;

(g) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:123, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:122;

(h) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:125, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:124;

(i) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:127, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:126;

(j) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:131, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:130; или

(k) VH последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:133, и

VL последовательность, которая по меньшей мере на 95% идентична аминокислотной последовательности SEQ ID NO:132.

32. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело содержит:

(a) VH последовательность SEQ ID NO:113 и

VL последовательность SEQ ID NO:112;

(b) VH последовательность SEQ ID NO:135 и

VL последовательность SEQ ID NO:134;

(c) VH последовательность SEQ ID NO:111 и

VL последовательность SEQ ID NO:110;

(d) VH последовательность SEQ ID NO:117 и

VL последовательность SEQ ID NO:116;

(e) VH последовательность SEQ ID NO:119 и

VL последовательность SEQ ID NO:118;

(f) VH последовательность SEQ ID NO:121 и

VL последовательность SEQ ID NO:120;

(g) VH последовательность SEQ ID NO:123 и

VL последовательность SEQ ID NO:122;

(h) VH последовательность SEQ ID NO:125 и

VL последовательность SEQ ID NO:124;

(i) VH последовательность SEQ ID NO:127 и

VL последовательность SEQ ID NO:126;

(j) VH последовательность SEQ ID NO:131 и

VL последовательность SEQ ID NO:130; или

(k) VH последовательность SEQ ID NO:133 и

VL последовательность SEQ ID NO:132.

33. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело представляет собой:

(a) моноклональное антитело;

(b) человеческое, гуманизированное или химерное антитело;

(c) фрагмент антитела, который связывается с FcRH5;

(d) IgG1, IgG2a или IgG2b антитело;

(e) биспецифическое антитело; необязательно, где биспецифическое антитело связывается с FcRH5 и CD3; и/или

(f) конъюгированное с меткой, где, необязательно, метка представляет собой излучатель позитронов, и, необязательно, излучатель позитронов представляет собой 89Zr.

34. Анти-FcRH5 антитело по п.6, отличающееся тем, что анти-FcRH5 антитело имеет одну или более из следующих характеристик:

(a) перекрестную реактивность с полноразмерным FcRH5 человека и FcRH5 макаки,

(b) не имеет перекрестной реактивности с FcRH1, FcRH2, FcRH3 и/или FcRH4,

(c) связывается с эндогенным FcRH5, и

(d) не имеет перекрестной реактивности с FcRH5a.

35. Выделенная нуклеиновая кислота, кодирующая анти-FcRH5 антитело по п.6, содержащая нуклеотидные последовательности, кодирующие антитело по любому из пп.11-30.

36. Клетка-хозяин для экспрессии анти-FcRH5 антитела по п.6, содержащая нуклеиновую кислоту по п.35.

37. Способ получения анти-FcRH5 антитела, включающий культивирование клетки-хозяина по п.36 таким образом, что продуцируется анти-FcRH5 антитело.

38. Иммуноконъюгат для лечения FcRH5-позитивного рака, содержащий анти-FcRH5 антитело по п.6 и цитотоксический агент, необязательно, где иммуноконъюгат имеет формулу Ab-(L-D)p, где:

(a) Ab представляет собой выделенное анти-FcRH5 антитело по п.6;

(b) L представляет собой линкер;

(c) D представляет собой лекарственное средство, выбранное из майтансиноида, ауристатина, калихеамицина, пирролобензодиазепина и производного неморубицина; и

(d) p равно от 1 до 8.

39. Иммуноконъюгат по п.38, отличающийся тем, что D представляет собой ауристатин.

40. Иммуноконъюгат по п.39, отличающийся тем, что D имеет формулу DE

DE,

и где каждый R2 и R6 представляет собой метил,

каждый R3 и R4 представляет собой изопропил,

R5 представляет собой Н,

R7 представляет собой втор-бутил,

каждый R8 независимо выбран из CH3, O-CH3, OH и Н;

R9 представляет собой Н; и

R18 представляет собой -C(R8)2–C(R8)2–арил.

41. Иммуноконъюгат по п.38, отличающийся тем, что лекарственное средство представляет собой MMAE.

42. Иммуноконъюгат по п.38, отличающийся тем, что D представляет собой пирролобензодиазепин Формулы A:

A;

где пунктирные линии указывают на необязательное присутствие двойной связи между C1 и С2 или С2 и С3;

R2 независимо выбран из H, OH, =O, =CH2, CN, R, OR, =CH-RD, =C(RD)2, O-SO2-R, CO2R и СOR, и необязательно дополнительно выбран из галогена или дигалогена,

где RD независимо выбран из R, CO2R, COR, CHO, CO2H и галогена;

R6 и R9 независимо выбраны из Н, R, OH, OR, SH, SR, NH2, NHR, NRR’, NO2, Me3Sn и галогена;

R7 независимо выбран из H, R, OH, OR, SH, SR, NH2, NHR, NRR’, NO2, Me3Sn и галогена;

Q независимо выбран из O, S и NH;

R11 представляет собой либо H, либо R или, если Q представляет собой О, SO3M, если M представляет собой катион металла;

каждый R и R’ независимо выбран из независимо замещенных C1-8 алкильных, C3-8 гетероциклильных и С5-20 арильных групп, и необязательно в отношении группы NRR’, R и R’ вместе с атомом азота к которому они прикреплены, образуют необязательно замещенное 4-, 5-, 6- или 7-членное гетероциклическое кольцо;

R12, R16, R19 и R17 такие, как определено для R2, R6, R9 и R7 соответственно;

R″ представляет собой С3-12 алкиленовую группу, цепь которой может быть прервана одним или более гетероатомами и/или ароматическими кольцами, которые необязательно замещены; и

X и Х’ независимо выбраны из O, S и N(H).

43. Иммуноконъюгат по п.42, отличающийся тем, что D имеет структуру:

A(II);

где n представляет собой 0 или 1.

44. Иммуноконъюгат по п.42, отличающийся тем, что D имеет структуру, выбранную из:

A(I);

A(III);

A(IV); и

A(V);

где каждый RE и RE” независимо выбран из H либо RD,

где RD независимо выбран из R, CO2R, COR, CHO, CO2H и галогена;

где каждый Ar1 и Ar2 независимо представляет собой необязательно замещенный C5-20 арил; и

где n равно 0 или 1.

45. Иммуноконъюгат по п.38, отличающийся тем, что D представляет собой пирролобензодиазепин Формулы B:

,

где горизонтальная волнистая линия указывает на сайт ковалентного присоединения к линкеру;

RV1 и RV2 независимо выбраны из Н, метила, этила, фенила, фторзамещенного фенила и С5-6 гетероциклила; и

n представляет собой 0 или 1.

46. Иммуноконъюгат по п.38, отличающийся тем, что D представляет собой производное неморубицина

47. Иммуноконъюгат по п.46, отличающийся тем, что D имеет структуру, выбранную из:

; и .

48. Иммуноконъюгат по п.38, отличающийся тем, что линкер является расщепляемым протеазой.

49. Иммуноконъюгат по п.48, отличающийся тем, что линкер содержит val-cit дипептид или Phe-homoLys дипептид.

50. Иммуноконъюгат по п.38, отличающийся тем, что линкер является кислото-лабильным.

51. Иммуноконъюгат по п.50, отличающийся тем, что линкер содержит гидразон.

52. Иммуноконъюгат по п.50, имеющий формулу:

,

где S представляет собой атом серы.

53. Иммуноконъюгат по п.43, имеющий формулу, выбранную из:

; и

.

54. Иммуноконъюгат по п.47, имеющий формулу, выбранную из:

;

;

; и

.

55. Иммуноконъюгат по п.38, отличающийся тем, что p равно от 2 до 5.

56. Фармацевтическая композиция для лечения FcRH5-позитивного рака, содержащая эффективное количество анти-FcRH5 антитела по п.6 и фармацевтически приемлемый носитель и, необязательно, дополнительно содержащая дополнительный терапевтический агент.

57. Способ лечения больного, страдающего FcRH5-позитивным раком, который включает введение больному эффективного количества анти-FcRH5 антитела по п.6.

58. Способ по п.57, отличающийя тем, что FcRH5-позитивный рак представляет собой B-клеточное пролиферативное расстройство.

59. Способ по п.57, дополнительно включающий введение дополнительного терапевтического агента субъекту.

60. Способ ингибирования пролиферации FcRH5-позитивной клетки, который включает воздействие на FcRH5-позитивную клетку анти-FcRH5 антитела по п.6 в условиях, обеспечивающих связывание анти-FcRH5 антитела с FcRH5 на поверхности FcRH5-позитивной клетки, таким образом ингибируя пролиферацию FcRH5-позитивной клетки, и, необязательно, где FcRH5-позитивная клетка представляет собой B-клетку.

61. Способ детекции FcRH5 человека в биологическом образце, включающий приведение в контакт биологического образца с анти-FcRH5 антителом по п.6 в условиях, обеспечивающих связывание анти-FcRH5 антитела с природным FcRH5 человека, и детекцию образовавшегося комплекса между анти-FcRH5 антителом и природным FcRH5 человека в биологическом образце.

62. Способ по п.61, отличающийся тем, что анти-FcRH5 антитело представляет собой анти-FcRH5 антитело, содержащее

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:52,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:76, и

HVR-H3, содержащий аминокислотную последовательность SEQ ID NO:100; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:4,

HVR-L2 содержащий аминокислотную последовательность SEQ ID NO:16, и

HVR-L3 содержащий аминокислотную последовательность SEQ ID NO:28.

63. Способ по п.61, отличающийся тем, что биологический образец представляет собой образец крови.

64. Способ по п.61, в котором анти-FcRH5 антитело содержит

a) тяжелую цепь, содержащую

HVR-H1, содержащий аминокислотную последовательность SEQ ID NO:55,

HVR-H2, содержащий аминокислотную последовательность SEQ ID NO:79, и

HVR-H3, содержащий аминокислотную последовательность SEQ ID NO:103; и

b) легкую цепь, содержащую

HVR-L1, содержащий аминокислотную последовательность SEQ ID NO:7,

HVR-L2, содержащий аминокислотную последовательность SEQ ID NO:19, и

HVR-L3, содержащий аминокислотную последовательность SEQ ID NO:31.

65. Способ детекции FcRH5-позитивного рака, включающий

(i) введение меченого анти-FcRH5 антитела больному, страдающему FcRH5-позитивным раком или с подозрением на FcRH5-позитивный рак, где меченое анти-FcRH5 антитело содержит анти-FcRH5 антитело по п.6, и

(ii) детекцию меченого анти-FcRH5 антитела у больного, где детекция меченого анти-FcRH5 антитела указывает на FcRH5-позитивный рак у больного, и, необязательно,

где меченое анти-FcRH5 антитело содержит анти-FcRH5 антитело, конъюгированное с излучателем позитронов, который, необязательно, представляет собой 89Zr.

66. Фармацевтическая композиция для лечения FcRH5-позитивного рака, содержащая эффективное количество иммуноконъюгата по п.38 и фармацевтически приемлемый носитель.

67. Способ лечения больного, страдающего FcRH5-позитивным раком, причем способ включает введение больному эффективного количества иммуноконъюгата по п.38.

68. Способ ингибирования пролиферации FcRH5-позитивной клетки, причем способ включает воздействие на FcRH5-позитивную клетку иммуноконъюгата по п.38 в условиях, обеспечивающих связывание иммуноконъюгата с FcRH5 на поверхности FcRH5-позитивной клетки, таким образом ингибируя пролиферацию FcRH5-позитивной клетки.



 

Похожие патенты:

Изобретение относится к области медицины, в частности к молекулярной онкологии, и предназначено для прогнозирования развития метастазов в печени у больных раком толстой кишки.

Изобретение относится к области медицины, в частности к молекулярной онкологии, и предназначено для прогнозирования развития метастазов в печени у больных раком толстой кишки.

Изобретение относится к области медицины, в частности к молекулярной биологии и онкологии. Предложена тест-система для прогнозирования развития метастазов у больных раком желудка на основании определения числа копий HV2 мтДНК, содержащая высокоспецифичные праймеры для генов HV2 и В2М с концентрацией 1,8 мкМ каждого в водном растворе.

Изобретение относится к области медицины, в частности к молекулярной биологии и онкологии. Предложена тест-система для прогнозирования развития метастазов у больных раком желудка на основании определения числа копий HV2 мтДНК, содержащая высокоспецифичные праймеры для генов HV2 и В2М с концентрацией 1,8 мкМ каждого в водном растворе.

Предложенная группа изобретений относится к области биомедицины, в частности молекулярной и клинической онкологии. Предложен способ диагностики светлоклеточного почечно-клеточного рака (скПКР), при котором у обследуемых лиц берут образцы ткани почки, производят выделение и очистку ДНК из взятых образцов и производят методом МС-ПЦР анализ метилирования фрагментов ДНК с применением праймеров.

Предложенная группа изобретений относится к области биомедицины, в частности молекулярной и клинической онкологии. Предложен способ диагностики светлоклеточного почечно-клеточного рака (скПКР), при котором у обследуемых лиц берут образцы ткани почки, производят выделение и очистку ДНК из взятых образцов и производят методом МС-ПЦР анализ метилирования фрагментов ДНК с применением праймеров.

Изобретение относится к области медицины, в частности к онкологии, и предназначено для прогнозирования безметастатической выживаемости у больных раком молочной железы.
Изобретение относится к области диагностики. Диагностический иммунохимический препарат для выявления онкоассоциированных экзосом в моче содержит, мас.% Гексацианферрат железа 0,7717-4,1266 Антитела к онкоэкзосомам 0,0018-0,0019 Глутаровый альдегид 0,0230-0,0239 Деионизированная вода остальное 2 пр., 3 табл..

Изобретение относится к области биотехнологии, конкретно к композиции для специфического связывания гетеротипичного комплекса кератина 7 с кератином 19, что может быть использовано в медицине.

Изобретение относится к области биотехнологии, конкретно к композиции для специфического связывания гетеротипичного комплекса кератина 7 с кератином 19, что может быть использовано в медицине.

Изобретение относится к области медицины, а именно к офтальмологии и эндокринологии, и предназначено для ранней диагностики активной фазы эндокринной офтальмопатии (ЭОП).

Изобретение относится к физиологии, иммунологии, лабораторной диагностике, патофизиологии и предназначено для прогнозирования развития сердечно-сосудистой патологии (профзаболевания) у мужчин со стажем работы более 5 лет вахтовым методом в условиях экстремального климата Арктики.

Изобретение относится к области биотехнологии. Описано получение рекомбинантного антигена вирусного капсида цирковируса свиней 2 (PCV-2) и его модификации путем экспрессии в прокариотической системе, очистки в мономерной форме, выделения вирусоподобных частиц (ВПЧ) и его применение в композициях вакцин, диагностических наборах и системе для количественной оценки антигена PCV-2 в партиях вакцин путем анализа с помощью (антиген)захватывающего ELISA.

Изобретение относится к области медицины и представляет собой способ определения индекса выраженности интерстициального фиброза почек при миеломной нефропатии, включающий световое микроскопическое исследование биоптатов почек, окрашенных трихромом по Массону, отличающийся тем, что осуществляют цифровую обработку и компьютерный морфометрический анализ оптического изображения коркового вещества биоптата почки, при этом последовательно измеряют площадь коркового вещества почки (sКВ), а также составляющие его следующие структуры: площадь всех клубочков, в том числе склерозированных (sКлуб), площадь просвета канальцев (sПКан), площадь цилиндров, в том числе и патологических в просветах канальцев (sЦил), затем рассчитывают площадь интерстиция (sИ) по формуле: sИ=sКВ-(sКлуб+sПКан+sЦил) и вычисляют площадь фиброзной патологической ткани в интерстиции (sИФ) на всем протяжении коркового вещества биоптата почки, а индекс выраженности интерстициального фиброза (ИИФ) рассчитывают по формуле: выраженность ИИФ=sИФ/sИ*100.

Изобретение относится к области молекулярной биологии и ветеринарии и предназначено для дифференциальной диагностики случной болезни и сурры лошадей. Для этого сначала из крови больных лошадей или из крови мышей и кроликов, которым трехкратно вводили трипаносомный антиген с адьювантом (гидроокись алюминия) и которых тотально обескровливали на 25-30 день, получают высокоактивные и высокоспецифичные ДНК-содержащие антигены Т.

Изобретение относится к области медицины и представляет собой способ оценки нарушений имплантации эмбриона на ранней стадии беременности до 12 недель, осложненной цитомегаловирусной инфекцией, заключающийся в исследовании гомогената ворсинчатого хориона иммуноферментным методом, где в гомогенате ворсинчатого хориона определяют содержание СОХ-2 и при значении СОХ-2 более 16,85 нг/мл делают заключение о нарушении имплантации эмбриона.
Изобретение относится к медицине, а именно к травматологии, и может быть использовано для прогнозирования развития осложнения при черепно-мозговой травме у пострадавших в экстремальных условиях Арктики.
Изобретение относится к ветеринарии, а именно к способу изготовления эритроцитарного диагностикума для диагностики пуллороза-тифа птиц. Способ включает получение бактериальной массы Salmonella gallinarum pullorum, выделение из нее антигенной фракции, Обработку бактериальной массы поверхностно-активным веществом с добавлением соды или щелочи в дистиллированной воде при 93-96°C с дальнейшей сенсебилизацией формалинизированных эритроцитов, их очисткой и получением целевого продукта в виде 10%-ной суспензии.

Изобретение относится к биотехнологии. Описан способ обнаружения генетических факторов (генов), определяющих функционирование ДНК-структур клетки - теломер, обуславливающих, в свою очередь, продолжительность жизни клетки эукариот.

Группа изобретений относится к медицине и касается иммобилизованного белкового материала, содержащего носитель и по меньшей мере один белок, иммобилизованный на носителе.

Настоящее изобретение относится к генной инженерии. Предложен способ in vitro модификации генома в представляющем интерес геномном локусе в нечеловеческой плюрипотентной клетке млекопитающего, включающий внесение в клетку компонентов системы CRISPR/Cas9 в комбинации с крупным направляющим вектором (LTVEC), который составляет по меньшей мере 10 т.п.о.

Изобретение относится к области биотехнологии. Предложен способ получения анти-FcRH5 антитела, которое связывается с изоформным с-специфичным участком внеклеточного домена FcRH5c и незначительно связывается с другим Ig-подобным доменом FcRH5. Способ включает иммунизацию мыши антигеном, выделение лимфоцитов из мыши и слияние с клетками миеломы с получением гибридомы и сбор анти-FcRH5 антитела из гибридомы. Также предложено анти-FcRH5 антитело, полученное указанным способом, и иммуноконъюгат на его основе. Рассмотрены полинуклеотид и клетка-хозяин для получения антитела по изобретению. Антитело и иммуноконъюгат по изобретению используются для получения фармацевтических композиций для лечения FcRH5-позитивного рака, в способах лечения пациентов, страдающих FcRH5-позитивным раком, ингибирования пролиферации FcRH5-позитивной клетки. Кроме того, представлен способ детекции FcRH5 в образце и способ детекции FcRH5-позитивного рака. Изобретение может найти применение в диагностике и лечении рака. 14 н. и 54 з.п. ф-лы, 25 ил., 4 табл.

Наверх