Антитела к поверхностным детерминантам s. aureus

Изобретение относится к области биохимии, в частности к фармацевтической композиции, содержащей выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с альфа-токсином (AT) S.aureus, и выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с антигеном S.aureus, являющимся поверхностной детерминантой, выбранным из группы, состоящей из IsdH и ClfA. Также раскрыты способ лечения инфекции S.aureus с помощью указанной композиции, способ уменьшения агглютинации бактерий S.aureus с помощью указанной композиции. Изобретение обладает способностью эффективно лечить инфекции S.aureus. 3 н. и 6 з.п. ф-лы, 11 пр., 7 табл., 18 ил.

 

[0001] Настоящее раскрытие в целом относится к антителам, которые связываются с поверхностными детерминантами Staphylococcus aureus (S. aureus), и антителам, которые связываются с секретируемыми токсинами S. aureus. Настоящее раскрытие также относится к комбинациям антител, которые связываются с поверхностными детерминантами S. aureus, вместе с антителами, которые связываются с секретируемыми токсинами S. aureus, композициям, содержащим такие комбинации антител, и способам предупреждения связанных с S. aureus заболеваний, включающим введение таких комбинаций антител.

[0002] Staphylococcus aureus является грам-положительной, аэробной, относящейся к агрегат-образующим кокковым бактериям, которые обычно колонизируют нос и кожу здоровых людей. Примерно 20-30% населения колонизированы S. aureus в любое время. Бактерии Staphylococcus aureus, которые также иногда называют “стафилококками”, “Staph. aureus”, или “S. aureus”, считают условно-патогенными микроорганизмами, которые вызывают второстепенные инфекции (например, пустулы, фурункулы и другие инфекции мягких тканей) и системные инфекции (например, пневмонию, сепсис, остеомиелит и эндокардит).

[0003] Слизистые и эпидермальные барьеры (кожа) в норме защищают от инфекций S. aureus. Нарушение этих естественных барьеров в результате повреждений (например, ожогов, травмы и хирургических вмешательств) значительно повышает риск инфекции. Заболевания, которые компрометируют иммунную систему (например, диабет, почечная недостаточность терминальной стадии и рак) также повышают риск инфекции. Инфекции, вызываемые условно-патогенными S. aureus, могут стать тяжелыми, спровоцировав ряд заболеваний или состояний, неограничивающие примеры которых включают бактериемию, флегмону, инфекции века, пищевое отравление, инфекции суставов, кожные инфекции, токсический эпидермальный некролиз, синдром токсического шока, пневмонию, остеомиелит, эндокардит, менингит и абсцедирование.

[0004] S. aureus экспрессирует ряд антигенов, являющихся поверхностными детерминантами, включая белки с повторами серин-аспарагиновой кислоты SdrC, SdrD и SdrE, белки-агглютинины ClfA и ClfB, регулируемые железом белки с поверхностными детерминантами IsdA, IsdB, IsdC, IsdE и IsdH, белок А (SpA) S.aureus и полисахарид поли-N-ацетилглюкозамин (PNAG). Эти поверхностные антигены играют роль в колонизации ткани хозяина, уклонении от иммунного ответа хозяина и бактериальной приспособляемости. Было показано, что мутации в ClfA, SpA, IsdA, IsdB и IsdH уменьшают вирулентность S. aureus.

[0005] Такие белки, как IsdH, играют роль в способности S. aureus уклоняться от определенных иммунных ответов хозяина, таких как опосредованный нейтрофилами фагоцитоз, процесс, который критичен для инициации инфекции S. aureus. IsdH является частью комплекса, который активируется при условиях с ограниченным содержанием железа, служащего для связывания гемоглобина и гаптоглобин-гемоглобинового комплекса, а затем экстракции и транспорта гема в цитоплазму. В IsdH присутствуют три N-концевых транспортерных мотива N-terminal NEAr Transporter (NEAT), при этом определенная структура NEAT1 указывает, что некоторые остатки в данном мотиве вовлечены в связывание лиганда. Было показано, что дефектные по IsdH мутанты S. aureus обладают сниженной вирулентностью по сравнению с диким типом и быстрее поглощаются нейтрофилами человека в присутствии опсонинов сыворотки крови. Защитный механизм IsdH, по видимому, обусловлен ускоренным разложением опсонина C3b в сыворотке крови. Таким образом, IsdH играет роль в антифагоцитарных свойствах организма S. aureus.

[0006] ClfA представляет собой фактор вирулентности, который связывает фибриноген. Данная функция ClfA проявляется в дополнительном вкладе в антифагоцитарных свойствах S. aureus. Кроме того, ClfA также способствует агглютинации S.aureus в крови и образованию биопленки на поверхностях биоматериала.

[0007] S. aureus также экспрессирует несколько дополнительных факторов вирулентности, включая капсульные полисахариды и белковые токсины. Одним фактором вирулентности, часто связанным с инфекцией S. aureus, является альфа-токсин (также известный как альфа-гемолизин или Hla), порообразующий и гемолитический экзопротеин, продуцируемый наиболее патогенными штаммами S. aureus. Токсин образует гептамерные поры в мембранах чувствительных клеток, таких как лейкоциты, тромбоциты, эритроциты, моноциты периферической крови, макрофаги, кератиноциты, фибробласты и эндотелиальные клетки. Образование пор альфа-токсина часто ведет к дисфункции или лизису клетки. Это также может привести к разрушению плотных контактов в эпителии и эндотелии и дисрегуляции иммунной системы.

[0008] В настоящее время S. aureus является основной причиной смертности, связанной с инфекционными заболевания, в США и основной причиной нозокомиальной инфекции. Кроме того, проблемой стала возрастающая устойчивость S. aureus к антибиотикам. Таким образом, было бы желательно разработать эффективные альтернативные способы диагностики и лечения инфекций S. aureus, включающие комбинированные терапии антителами.

[0009] Как ранее раскрыто в предварительной заявке на патент США № 61/440581 и в международной заявке № PCT/US2012/024201 (опубликованной под номером WO2012/109205), содержание каждой из которых включено в данный документ посредством ссылки, было показано, что антитела, которые связываются с альфа-токсином S. aureus уменьшают тяжесть заболевания CA-MRSA в модели мышиного дерматонекроза и способствуют клиренсу бактерий в мышиной модели стафилококковой пневмонии. Таким образом, такие антитела можно использовать для лечения различных, связанных с S. aureus заболеваний.

[0010] Помимо антител, которые связываются с альфа-токсином S. aureus, настоящее раскрытие предусматривает антитела, направленные против антигенов, являющихся поверхностными детерминантами S. aureus, а также их комбинации. Настоящее изобретение предусматривает композиции, содержащие такие антитела, или комбинации таких антител, а также способы предупреждения и/или лечения связанных с S. aureus заболеваний с применением таких антител или комбинаций таких антител. Способы предупреждения и/или лечения связанных с S. aureus заболеваний с применением антител, которые связываются с альфа-токсином S. aureus, описаны в предварительной заявке на патент США № 61/440581 и в международной заявке № PCT/US2012/024201 (опубликованной как WO2012/109205), содержание которых в настоящем документе включено с помощью ссылки, а также в предварительной заявке на патент США, поданной одновременно с настоящей заявкой, Sellman et al., под заглавием “Способы лечения связанных с S. Aureus заболеваний” (”Methods of Treating S. Aureus Associated Diseases”), содержание которой включено в настоящий документ с помощью ссылки.

[0011] Настоящее изобретение также относится к некоторым комбинациям антител, таким как антитело, которое связывается с поверхностной детерминантой S. aureus, в комбинации с антителом, которое связывается с альфа-токсином S. aureus, при этом такие комбинации совместно действуют синергетически. Настоящее изобретение также относится к комбинированию антитела, которое нацелено на антиген, являющийся поверхностной детерминантой S. aureus, вовлеченный в уклонение от опсонофагоцитирующих функций хозяина, с антителом, которое нацелено на секретируемый S. aureus токсин, вовлеченный в непосредственное повреждение клеток хозяина.

ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ

[0012] На фиг. 1 показана процентная доляопсонофагоцитирующего киллинга (OPK), индуцированного антителами B11, 2F4 и A7 к IsdH, по сравнению с процентом OPK, индуцированного контрольным антителом R347, при тестировании со штаммами Newman и USA300 S. aureus.

[0013] На фигуре 2 показано связывание антител B11, 2F4, A7 и 1C1 к IsdH по сравнению с контрольным антителом R347, со штаммами ARC2081 и USA300 S. aureus.

[0014] Фигура 3A представляет собой график конкурентного связывания между антителом 1C1 и гаптоглобином (Hp) за связывание с субъединицей Neat-1 на IsdH по сравнению с конкурентным связыванием между контрольным антителом R347 и Hp. Фигура 3B представляет собой график конкурентного связывания между антителом 2F4 и Hp за связывание с субъединицей Neat-2 на IsdH по сравнению с конкурентным связыванием между контрольным антителом R347 и Hp.

[0015] На фигуре 4A показана концентрация колониеобразующих единиц (CFU) S. aureus, измеренная в мышиной модели бактериемии в присутствии антитела 1C1. Концентрация CFU приведена в виде log10[CFU/мл]. На фигуре 4B показана концентрация CFU S. aureus, измеренных в мышиной модели бактериемии в присутствии антитела A7. Концентрация CFU приведена в виде log10[CFU/мл]. На фигуре 4С показана концентрация CFU S. aureus, измеренных в мышиной модели бактериемии в присутствии антитела IsdH0016. Концентрация CFU приведена в виде log10[CFU/мл]. На фигуре 4D показана концентрация CFU S. aureus, измеренных в мышиной модели бактериемии в присутствии антитела IsdH003. Концентрация CFU приведена в виде log[CFU/мл].

[0016] На фигуре 5 показана концентрация колониеобразующих единиц (CFU) S. aureus, измеренная в мышиной модели бактериемии в присутствии антитела 2F4. Концентрация CFU приведена в виде log10[CFU/мл].

[0017] На фигуре 6 проиллюстрировано связывание 2F4, измеренное как процентная доля максимального связывания по сравнению с контрольным антителом R347, в моменты времени T0, T и T у штаммов ARC2379 (USA100), ARC2081 (USA200) и BAA-1556 (USA 300) S. aureus.

[0018] На фигуре 7A показана процентная доля OPK, индуцированного антителом 2F4, по сравнению с процентом OPK, индуцированного контрольным антителом R347, при тестировании со штаммом Newman S. aureus. На фигуре 7B показана процентная доля OPK, индуцированного антителом 2F4, по сравнению с процентом OPK, индуцированного контрольным антителом R347, при тестировании со штаммом ARC634 S. aureus. На фигуре 7С показана процентная доля OPK, индуцированного антителом 2F4, по сравнению с процентом OPK, индуцированного контрольным антителом R347, при тестировании со штаммом ARC2081 (USA200) S. aureus. На фигуре 7D показана процентная доля OPK, индуцированного антителом 2F4, по сравнению с процентом OPK, индуцированного контрольным антителом R347, при тестировании со штаммом BAA-1556 (USA300) S. aureus.

[0019] На фигуре 8 показано увеличение у 2F4 аффинности к IsdH и к субъединицы Neat-2 в анализе захвата hulgGFc.

[0020] На фигуре 9A показана концентрация CFU в почке для штамма USA300 S. aureus (вводимого в начальной концентрации 2,05e8), измеренная в модели нагрузки на орган после обработки с помощью только 2F4, только 2A3 или комбинации 2F4 и 2A3. Концентрация CFU приведена в виде log10[CFU/орган]. На фигуре 9В показана концентрация CFU в почке для штамма USA300 S. aureus (вводимого в начальной концентрации 2,05e8), измеренная в модели нагрузки на орган после обработки с помощью только 2F4, только 2A3 или комбинации 2F4 и 2A3. Концентрация CFU приведена в виде log10[CFU/орган].

[0021] На фигуре 10 показано, что антитела к ClfA ингибируют связывание ClfA с иммобилизированным фибриногеном. Антитела 23D6, 27H4, 11H10 к ClfA демонстрировали повышенное ингибирование связывания с фибриногеном по сравнению с контрольным R347.

[0022] На фигуре 11 показано, что антитела к ClfA ингибируют агглютинацию S. aureus в плазме человека. Была протестирована способность антител 23D6, 27H4, 11H10 к ClfA ингибировать агглютинацию трех различных штаммов S. aureus (NR S112, BAA 1556 и UAMS-1) по сравнению с контрольным R347, при отсутствии mAb и белка ClfA. В данном анализе антитело 11H10 к ClfA характеризовалось наибольшим охватом штаммов.

[0023] На фигуре 12 показано, что антитело 11H10 к ClfA связывается с отличным эпитопом на ClfA по сравнению с антителами 23D6 и 27H4 к ClfA.

[0024] На фигуре 13 продемонстрировано, что антитело 11H10 к ClfA и антитело LC10 к АТ уменьшают бактериальную нагрузку в сердце.

[0025] На фигуре 14 показано влияние антитела 11H10 к ClfA в мышиной модели сепсиса.

[0026] На фигуре 15 показано влияние антитела 11H10 к ClfA, антитела LC10 к AT и комбинации антитела 11H10 к ClfA с антителом LC10 к AT в мышиной модели сепсиса (IV степень, летальное инфицирование) в результате инфицирования CA-MRSA USA300.

[0027] На фигуре 16 показано влияние комбинации антитела 11H10 к ClfA с антителом LC10 к AT в мышиной модели сепсиса (IV степень, летальное инфицирование) в результате инфицирования HA-MRSA USA100.

[0028] На фигуре 17 показано влияние комбинации антитела 11H10 к ClfA с антителом LC10 к AT в мышиной модели сепсиса (IV степень, летальное инфицирование) в результате инфицирования HA-MRSA USA200.

[0029] На фигуре 18 показано влияние комбинации антитела 2F4 к IsdH с антителом LC10 к AT в мышиной модели сепсиса (IV степень, летальное инфицирование) в результате инфицирования HA-MRSA USA100.

ОПИСАНИЕ ИЛЛЮСТРАТИВНЫХ ВАРИАНТОВ ОСУЩЕСТВЛЕНИЯ

[0030] Теперь подробно обратимся к некоторым иллюстративным вариантам осуществления по настоящему раскрытию, некоторые примеры которых проиллюстрированы в прилагаемых графических материалах.

[0031] В настоящем документе раскрыты антитела, в том числе человеческие, гуманизированные и/или химерные формы, а также их фрагменты, производные/конъюгаты и композиции, которые связываются с антигенами, являющимися поверхностными детерминантами S. aureus, и антитела, которые связываются с секретируемыми токсинами S. aureus. Такие антитела могут быть пригодны для детектирования и/или визуализации S. aureus и, таким образом, могут быть пригодны в диагностических способах и анализах. Описываемые в настоящем документе антитела также затрагивают поверхностные детерминанты S. aureus, таким образом, затрагивая колонизацию и ускользание от иммунологического надзора, что делает данные антитела пригодными для терапевтических и профилактических способов. Аналогично, описываемые в настоящем документе антитела могут связывать секретируемые токсины S. aureus, таким образом, уменьшая вирулентность инфекции S. aureus. Комбинирование антител, которые нацелены как на поверхностные детерминанты, так и на секретируемые токсины S. aureus может повысить терапевтическое и профилактическое влияние, достигаемое при помощи любого антитела при индивидуальном введении.

[0032] S. aureus экспрессирует ряд антигенов, являющихся поверхностными детерминантами, которые важны для колонизации, ускользания от иммунологического надзора и приспособляемости S. aureus. Такие поверхностные детерминанты включают SdrC, SdrD, SdrE, ClfA, ClfB, IsdA, IsdB, IsdC, IsdE, IsdH, SpA, FnbA и PNAG. Раскрываемые в настоящем документе антитела могут быть нацелены на антигены, являющиеся поверхностными детерминантами.

[0033] S. aureus также продуцирует большое количество секретируемых и связанных с клеткой белков, многие из которых вовлечены в патогенез, такие как альфа-токсин (AT), бета-токсин, гамма-токсин, дельта-токсин, лейкоцидин, токсин синдрома токсического шока (TSST), энтеротоксины, коагулаза, белок A, фибриноген и т. п. Альфа-токсин является одним из факторов вирулентности Staphylococcus aureus и продуцируется большинством патогенных штаммов S. aureus.

A. Антитела, направленные против поверхностных детерминант и секретируемых токсинов S. aureus

[0034] Применяемые в настоящем документе выражения “антитело”, “антитела” (также известные как иммуноглобулины) и “антигенсвязывающие фрагменты” охватывают моноклональные антитела (включая моноклональные антитела полной длины), поликлональные антитела, мультиспецифические антитела, образованные по меньшей мере из двух различных фрагментов, связывающих эпитопы (например, биспецифические антитела), человеческие антитела, гуманизированные антитела, верблюжьи антитела, химерные антитела, одноцепоченые Fv (scFv), одноцепоченые антитела, однодоменные антитела, доменные антитела, Fab фрагменты, F(ab')2 фрагменты, фрагменты антител, которые проявляют необходимую биологическую активность (например, антигенсвязывающая часть), связанные дисульфидными мостиками Fv (dsFv) и антиидиотипические (анти-Id) антитела (включая, например, анти-Id антитела к антителам, предлагаемым в данном документе), внутриклеточные антитела и фрагменты, связывающие эпитоп, любого из вышеуказанных. В частности, антитела включают молекулы иммуноглобулина и иммунологически активные фрагменты молекул иммуноглобулина, т. е. молекулы, которые содержат по меньшей мере один антигенсвязывающий центр. Молекулы иммуноглобулина могут быть любого изотипа (например, IgG, IgE, IgM, IgD, IgA и IgY), субизотипа (например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или аллотипа (например, Gm, например, G1m(f, z, a или x), G2m(n), G3m(g, b, или c), Am, Em, и Km(1, 2 или 3)). Антитела могут быть получены от любого млекопитающего, включая без ограничения людей, обезьян, свиней, лошадей, кроликов, собак, котов, мышей и подобных, или других животных, таких как птицы (например, куры).

[0035] В определенных вариантах осуществления антитело или его иммуноспецифический фрагмент по настоящему изобретению включают антигенсвязывающий домен. Антигенсвязывающий домен образован вариабельными областями антитела, которые отличаются у различных антител. Встречающиеся в природе антитела содержат по меньшей мере два антигенсвязывающих домена, т. е. они по меньшей мере бивалентны. Применяемое в данном документе выражение "антигенсвязывающий домен" включает участок, который специфически связывается с эпитопом антигена (например, антигена клеточной поверхности или растворимого антигена). Антигенсвязывающий домен антитела обычно включает по меньшей мере часть вариабельной области тяжелой цепи иммуноглобулина и по меньшей мере часть вариабельной области легкой цепи иммуноглобулина. Участок связывания, образованный этими вариабельными областями, определяет специфичность антитела.

[0036] В контексте настоящего документа, если специально не указано иное, “мутация” охватывает присоединение, делецию, замену (в том числе консервативную замену) или другое изменение по меньшей мере одной аминокислоты или нуклеиновой кислоты. “Консервативная замена”, если специально не указано иное, относится к замещению первой аминокислоты второй аминокислотой, которая практически не изменяет химические, физические и/или функциональные свойства антитела или его антигенсвязывающего фрагмента (например, антитело или его антигенсвязывающий фрагмент сохраняют такие же заряд, структуру, полярность, гидрофобность/гидрофильность и/или сохраняет такие функции, как способность связывать альфа-токсин и, таким образом, уменьшать вирулентность S. aureus). Консервативная замена также относится к замещению первой нуклеиновой кислоты второй нуклеиновой кислотой, кодирующей ранее описанную консервативную аминокислотную замену.

[0037] Антитела, предлагаемые в настоящем документе, включают антитела полной длины или интактные антитела, фрагменты антител, антитела с нативной последовательностью или аминокислотные варианты нативных антител, человеческие, гуманизированные, подвергнутые посттрансляционной модификации антитела, химерные или гибридные антитела, иммуноконъюгаты и их функциональные фрагменты. Антитела могут быть модифицированы в Fc области и некоторые модификации могут обеспечивать необходимые эффекторные функции или измененный период полувыведения из сыворотки.

[0038] Нумерация аминокислот в вариабельном домене, определяющих комплементарность областях (CDR) и каркасных областях (FR) антитела выдержана, если не указано иное, согласно определению Kabat, как изложено в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Maryland. Public Health Service, National Institutes of Health, Bethesda, Maryland (1991). При использовании этой системы нумерации фактическая линейная аминокислотная последовательность может содержать меньшее количество или дополнительные аминокислоты, соответствующие укорочению или вставке в FR или CDR вариабельного домена. Нумерацию остатков по Kabat можно определить для данного антитела путем выравнивания областей антитела с гомологией последовательности антитела со "стандартной", пронумерованной по Kabat, последовательностью. Максимальное выравнивание каркасных остатков часто требует вставки “спейсерных” остатков в систему нумерации, чтобы использовать ее для Fv области. Кроме того, идентичность определенных отдельных остатков в любом указанном пронумерованном по Kabat участке может изменяться от цепи антитела к цепи антитела вследствие межвидовой или аллельной дивергенции.

[0039] В определенных вариантах осуществления предложены выделенные антитела. Применяемое в настоящем документе выражение “выделенное антитело” относится к антителу, которое практически не содержит других антител и молекул, в норме присутствующих в природном клеточном окружении. Таким образом, в некоторых вариантах осуществления предложенные антитела являются выделенными антителами, при этом они были отделены от антител с отличающейся специфичностью к антигенам. Выделенное антитело может быть моноклональным антителом или поликлональным антителом. Выделенное антитело, которое специфично связывается с эпитопом, изоформой или вариантом поверхностного антигена или секретируемого токсина S. aureus, может, тем не менее, обладать перекрестной реактивностью с другими родственными антигенами, например, из других видов (например, видов-гомологов Staphylococcus). Предлагаемое выделенное антитело может практически не содержать один или несколько других клеточных материалов. В некоторых вариантах осуществления предложена комбинация “выделенных” моноклональных антител, и она относится к антителам, имеющим отличающиеся специфичности и объединенным в определенную композицию.

[0040] Также раскрыты последовательности выделенных нуклеиновых кислот, которые кодируют аминокислотные последовательности раскрываемых антител и их антигенсвязывающих фрагментов. В связи с вырожденностью нуклеотидного кода в любой позиции нуклеиновой кислоты может присутствовать более одного нуклеотида, при этом все еще кодируя ту же аминокислоту. В некоторых вариантах осуществления приведены последовательности нуклеиновых кислот, которые кодируют аминокислотные последовательности, которые на 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% идентичны (или на любую процентную долю между ними) аминокислотной последовательности раскрываемого антитела или его антигенсвязывающего фрагмента, которые связываются с поверхностным антигеном или секретируемым токсином S. aureus. В дополнительных вариантах осуществления последовательности нуклеиновых кислот кодируют аминокислотные последовательности, которые сохраняют функциональные способности раскрываемых антител и их антигенсвязывающих фрагментов, например связывать поверхностный антиген или секретируемый токсин S. aureus и, таким образом, уменьшать колониальный рост, уклонение от опсонофагоцитоза или токсичность секретируемого токсина S. aureus.

[0041] В различных вариантах осуществления раскрываемые в настоящем документе антитела или фрагменты могут специфично связывать полипептид поверхностного антигена или секретируемого токсина S. aureus или его антигенный фрагмент. В определенных вариантах осуществления поверхностным антигеном является SdrC, SdrD, SdrE, ClfA, ClfB, IsdA, IsdB, IsdC, IsdE, IsdH, SpA, FnbA или PNAG. В дополнительных вариантах осуществления поверхностным антигеном является IsdH. В других вариантах осуществления поверхностным антигеном является ClfA. В некоторых вариантах осуществления секретируемым токсином является альфа-токсин или фенол-растворимый модулин. В дополнительных вариантах осуществления секретируемым токсином является альфа-токсин. Некоторые аминокислотные последовательности и последовательности нуклеиновых кислот для антител к альфа-токсину, пригодных согласно настоящему раскрытию, раскрыты в предварительной заявке на патент США № 61/440581 и в международной заявке № PCT/US2012/024201 (опубликованной как WO2012/109205), содержание каждой из который, таким образом, включено в полном их объеме.

[0042] Приведенные в настоящем документе антитела могут специфично связываться с одним или несколькими эпитопами, специфичными для белка антигена, являющегося поверхностной детерминантой, или секретируемого токсина S. aureus, и обычно специфично не связываются с другими полипептидами. Применяемое в настоящем документе выражение “эпитоп” относится к пептиду, субъединице, фрагменту, части, олигомеру или их комбинации, которые могут быть связаны антителом.

[0043] В определенных вариантах осуществления антитело к антигену, являющемуся поверхностной детерминантой, или секретируемому токсину S. aureus или его антигенсвязывающий фрагмент могут связывать консервативный среди видов эпитоп. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент связывает антиген, являющийся поверхностной детерминантой, или секретируемый токсин S. aureus или гомолог или ортолог другого вида бактерий, а также его антигенные фрагменты. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент могут связываться с одной или несколькими изоформами антигена, являющегося поверхностной детерминантой, или секретируемого токсина.

[0044] В различных вариантах осуществления в состав эпитопа входит по меньшей мере часть антигена, являющегося поверхностной детерминантой S. aureus. Данные антигены, являющиеся поверхностными детерминантами, могут включать SdrC, SdrD, SdrE, ClfA, ClfB, IsdA, IsdB, IsdC, IsdE, IsdH, SpA, FnbA или PNAG. В некоторых вариантах осуществления антигеном является IsdH. В других вариантах осуществления антигеном является ClfA. В некоторых вариантах осуществления в состав эпитопа входит по меньшей мере часть секретируемого токсина S. aureus. В некоторых вариантах осуществления секретируемым токсином является альфа-токсин, который вовлечен в образование гептамерного комплекса альфа-токсина.

[0045] Указанный эпитоп может содержать любую аминокислотную последовательность, содержащую по меньшей мере 3 смежных аминокислотных остатка из аминокислотной последовательности целевого антигена. Эпитоп может содержать более длинные аминокислотные последовательности, до и включая всю аминокислотную последовательность целевого антигена. В некоторых вариантах осуществления эпитоп содержит по меньшей мере 4 аминокислотных остатка, по меньшей мере 5 аминокислотных остатков, по меньшей мере 6 аминокислотных остатков, по меньшей мере 7 аминокислотных остатков, по меньшей мере 8 аминокислотных остатков, по меньшей мере 9 аминокислотных остатков, по меньшей мере 10 аминокислотных остатков, по меньшей мере 11 аминокислотных остатков, по меньшей мере 12 аминокислотных остатков, по меньшей мере 13 аминокислотных остатков, по меньшей мере 14 аминокислотных остатков или по меньшей мере 15 аминокислотных остатков из аминокислотной последовательности целевого антигена. В некоторых других вариантах осуществления эпитоп содержит 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 или 15 смежных или несмежных аминокислотных остатков из аминокислотной последовательности целевого антигена.

[0046] В определенных вариантах осуществления предложены комбинации, содержащие выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с секретируемым токсином S. aureus и выделенное антитело, которое специфично связывается с антигеном, являющимся поверхностной детерминантой S. aureus. В дополнительных вариантах осуществления антитело, которое связывает антиген, являющийся поверхностной детерминантой S. aureus, связывает антиген, выбранный из SdrC, SdrD, SdrE, ClfA, ClfB, IsdA, IsdB, IsdC, IsdE, IsdH, SpA, FnbA или PNAG. В еще одних вариантах осуществления антигеном, являющимся поверхностной детерминантой, является IsdH. В определенных вариантах осуществления антитело, которое связывает секретируемый токсин S. aureus, связывает токсин, выбранный из альфа-токсина и фенол-растворимого модулина. В дополнительных вариантах осуществления секретируемым токсином является альфа-токсин.

[0047] В определенных вариантах осуществления антитело или комбинация антител присутствуют в водном растворе. В других вариантах осуществления антитело или комбинация антител присутствуют в порошковой или лиофилизированной форме. В определенных вариантах осуществления антитело или комбинация антител присутствуют в концентрации, достаточной для терапевтических или диагностических применений. В некоторых вариантах осуществления антитело или комбинация антител присутствуют в стерильном сосуде или емкости.

[0048] В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые могут связывать поверхностный антиген или секретируемый токсин S. aureus, получено из исходного антитела. Применяемое в настоящем документе выражение “исходное антитело” относится к антителу, которое кодируется аминокислотной последовательностью, применяемой для получения вариантного или производного антитела, которые описаны в настоящем документе. Исходный полипептид может содержать последовательность нативного антитела (т. е. полипептид встречающегося в природе антитела, в том числе встречающийся в природе аллельный вариант) или последовательность антитела с ранее существовавшими модификациями аминокислотной последовательности (такими как вставки, делеции и/или замены) во встречающейся в природе последовательности. Исходное антитело может быть гуманизированным антителом или человеческим антителом. В конкретных вариантах осуществления антитела к поверхностному антигену или секретируемому токсину S. aureus и их антигенсвязывающие фрагменты являются вариантами исходного антитела. Применяемое в настоящем документе выражение “вариант” относится к антителу или его антигенсвязывающему фрагменту, которые отличаются по их аминокислотной последовательности от аминокислотной последовательности “исходного” антитела или его антигенсвязывающего фрагмента вследствие присоединения, делеции и/или замены одного или нескольких аминокислотных остатков из последовательности исходного антитела.

[0049] Настоящие антитела к поверхностному антигену или секретируемому токсину S. aureus и их антигенсвязывающие фрагменты содержат по меньшей мере один антигенсвязывающий домен. Антигенсвязывающая часть антитела содержит один или несколько фрагментов антитела, которые сохраняют способность специфично связываться с антигеном. Эти сохраняющиеся части могут содержать вариабельную область тяжелой и/или легкой цепи из исходного антитела или варианта исходного антитела.

B. Антитела к IsdH

[0050] Применяемые в настоящем документе выражения “процент (%) идентичности последовательностей” или “гомология” определяют как процентную долю аминокислотных остатков или нуклеотидов в последовательности-кандидате, идентичных аминокислотным остаткам или нуклеотидам в эталонных последовательностях после выравнивания последовательностей и введения гэпов, при необходимости, для достижения максимального процента идентичности последовательности, и исключая консервативные замены. Оптимальное выравнивание последовательностей для сравнения можно получить, помимо ручного способа, с помощью алгоритмов поиска локальной гомологии, известных в данной области техники, или с помощью компьютерных программ, в которых применяются эти алгоритмы (например, GAP, BESTFIT, FASTA, BLAST P, BLAST N и TFASTA).

[0051] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с поверхностным антигеном IsdH, содержат вариабельную область тяжелой цепи (VH), которая на 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% идентична аминокислотной последовательности SEQ ID NO: 80, 82, 84, 86 или 88. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат вариабельную область легкой цепи (VL), которая на 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% идентична аминокислотной последовательности SEQ ID NO: 81, 83, 85, 87 или 89. В конкретных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат VH, которая на 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% идентична аминокислотной последовательности SEQ ID NO: 80, 82, 84, 86 или 88 и VL, содержащую аминокислотную последовательность SEQ ID NO: 81, 83, 85, 87 или 89.

[0052] В конкретных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат VH и VL, при этом VH и VL выбраны из группы, состоящей из SEQ ID NO: 80 и 81; SEQ ID NO: 82 и 83; SEQ ID NO: 84 и 85; SEQ ID NO: 86 и 87 и SEQ ID NO: 88 и 89. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат VH и VL, при этом VH и VL соответствуют SEQ ID NO: 80 и 81. В Примере 7, таблице 12, приведены иллюстративные последовательности VH и VL, представленных в настоящем документе, которые могут присутствовать в любой комбинации с образованием антитела к поверхностному антигену или его антигенсвязывающего фрагмента.

[0053] В дополнительных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат аминокислотную последовательность VH с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 80, 82, 84, 86 или 88. В различных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат аминокислотную последовательность VL с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 81, 83, 85, 87 или 89.

[0054] В определенных вариантах осуществления антитело или антигенсвязывающий фрагмент, которые специфично связываются с поверхностным антигеном IsdH, обладают одной или несколькими из следующих характеристик:

(a) константа диссоциации (KD) для поверхностного антигена S. aureus равна приблизительно 100 нМ или менее, приблизительно 90 нМ или менее, приблизительно 80 нМ или менее, приблизительно 70 нМ или менее, приблизительно 60 нМ или менее, приблизительно 50 нМ или менее, приблизительно 40 нМ или менее, приблизительно 20 нМ или менее, приблизительно 10 нМ или менее, приблизительно 9, 8, 7, 6, 5, 4, 3, 2 или 1 нМ. (или любому значению между ними);

(b) уменьшает способность S. aureus уклоняться от опсонофагоцитоза иммунными клетками по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или любую процентную долю между ними), по результатам измерения с помощью анализа опсонофагоцитирующего киллинга;

(c) уменьшает концентрацию колониеобразующих единиц (CFU) S. aureus по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или любую процентную долю между ними), по результатам измерения с помощью модели бактериемии; или

(d) уменьшает инфильтрацию иммунными клетками, бактериальную нагрузку и высвобождение провоспалительных цитокинов.

[0055] Настоящие антитела и их антигенсвязывающие фрагменты, которые специфично связывают поверхностные антигены или секретируемые токсины S. aureus, содержат по меньшей мере один антигенсвязывающий домен, который включает по меньшей мере одну определяющую комплементарность область (например, по меньшей мере одну из CDR1, CDR2 или CDR3). В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержит VH, которая включает по меньшей мере одну CDR VH (например, CDR1 VH, CDR2 VH или CDR3 VH). В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат VL, которая включает по меньшей мере одну CDR VL (например, CDR1 VL, CDR2 VL или CDR3 VL). В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержит VH, которая включает по меньшей мере одну CDR VH и по меньшей мере одну CDR VL.

[0056] Раскрываемые в настоящем документе CDR-области можно комбинировать во множество комбинаций, поскольку каждая CDR-область может быть независимо выбрана и скомбинирована с другой CDR-областью для указанного антитела. В определенных вариантах осуществления последовательности CDR VH и/или VL могут присутствовать в любой комбинации с образованием антитела или его антигенсвязывающего фрагмента, направленного против поверхностного антигена или секретируемого токсина S. aureus.

[0057] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, который специфично связывается с IsdH, включает (a) CDR1 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 90, 96, 102, 108 или 114; (b) CDR2 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 91, 97, 103, 109 или 115; и/или (c) CDR3 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 92, 98, 104, 110 или 116.

[0058] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, который специфично связывается с IsdH, включает (a) CDR1 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 93, 99, 105, 111 или 117; (b) CDR2 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 94, 100, 106, 112 или 118; и/или (c) CDR3 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 95, 101, 107, 113 или 119.

[0059] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR по отношению к: (a) CDR1 VH, содержащей аминокислотную последовательность SEQ ID NO: 90, 96, 102, 108 или 114; (b) CDR2 VH, содержащей аминокислотную последовательность SEQ ID NO: 91, 97, 103, 109, или 115; (c) CDR3 VH, содержащей аминокислотную последовательность SEQ ID NO: 92, 98, 104, 110 или 116 (d) CDR1 VL, содержащей аминокислотную последовательность SEQ ID NO: 93, 99, 105, 111 или 117; (e) CDR2 VL, содержащей аминокислотную последовательность SEQ ID NO: 94, 100, 106, 112 или 118; и (f) CDR3 VL, содержащей аминокислотную последовательность SEQ ID NO: 95, 101, 107, 113 или 119.

[0060] В конкретных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL выбраны из группы, состоящей из SEQ ID NO: 90, 91, 92, 93, 94 и 95; SEQ ID NO: 96, 97, 98, 99, 100 и 101; SEQ ID NO: 102, 103, 104, 105, 106 и 107; SEQ ID NO: 108, 109, 110, 111, 112 и 113; SEQ ID NO: 114, 115, 116, 117, 118 и 119. В дополнительном варианте осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL и соответствуют SEQ ID NO: 90, 91, 92, 93, 94 и 95.

[0061] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, соответствуют любому из описанных выше выделенных антител или антигенсвязывающих фрагментов и имеют одну или несколько из следующих характеристик:

(a) константа диссоциации (KD) для поверхностного антигена S. aureus, равна приблизительно 100 нМ или менее, приблизительно 90 нМ или менее, приблизительно 80 нМ или менее, приблизительно 70 нМ или менее, приблизительно 60 нМ или менее, приблизительно 50 нМ или менее или приблизительно 40 нМ или менее, приблизительно 20 нМ или менее, приблизительно 10 нМ или менее, приблизительно 9, 8, 7, 6, 5, 4, 3, 2 или 1 нМ (или любому значению между ними);

(b) уменьшает способность S. aureus уклоняться от опсонофагоцитоза иммунными клетками по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или любую процентную долю между ними), по результатам измерения с помощью анализа опсонофагоцитирующего киллинга;

(c) уменьшает количество колониеобразующих единиц (CFU) S. aureus по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или любую процентную долю между ними), по результатам измерения с помощью модели бактериемии; или

(d) уменьшает инфильтрацию иммунными клетками, бактериальную нагрузку и высвобождение провоспалительных цитокинов.

[0062] В дополнительных вариантах осуществления настоящее изобретение относится к выделенному антителу или его антигенсвязывающему фрагменту, которые специфично связываются с тем же эпитопом IsdH, что и любое другое из описанных выше антител или антигенсвязывающих фрагментов к ClfA.

C. Антитела к ClfA

[0063] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с поверхностным антигеном ClfA, содержат вариабельную область тяжелой цепи (VH), которая на 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% идентична аминокислотной последовательности SEQ ID NO: 132 или 140. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, содержат вариабельную область легкой цепи (VL), которая на 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% идентична аминокислотной последовательности SEQ ID NO: 136 или 144. В конкретных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, содержат VH, которая на 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% идентична аминокислотной последовательности SEQ ID NO: 132 или 136 и VL, содержащую аминокислотную последовательность SEQ ID NO: 140 или 144. В конкретных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, содержат VH и VL, при этом VH и VL выбраны из группы, состоящей из SEQ ID NO: 132 и 140; и SEQ ID NO: 136 и 144. В Примере 7, таблице 14, приведены иллюстративные последовательности VH и VL, представленных в настоящем документе, которые могут присутствовать в любой комбинации с образованием антитела к поверхностному антигену или его антигенсвязывающего фрагмента.

[0064] В дополнительных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, содержат аминокислотную последовательность VH с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 132 или 140. В различных вариантах осуществления антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, содержат аминокислотную последовательность VL с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 136 или 144.

[0065] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, который специфично связывается с ClfA, включает (a) CDR1 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 133 или 141; (b) CDR2 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 134 или 142; и/или (c) CDR3 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 135 или 143.

[0066] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, который специфично связывается с ClfA, включает (a) CDR1 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 137 или 145; (b) CDR2 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 138 или 146; и/или (c) CDR3 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 139 или 147.

[0067] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR по отношению к: (a) CDR1 VH, содержащей аминокислотную последовательность SEQ ID NO: 133 или 141; (b) CDR2 VH, содержащий аминокислотную последовательность SEQ ID NO: 134 или 142; (с) CDR3 VH, содержащий аминокислотную последовательность SEQ ID NO: 135 или 143; (d) CDR1 VL, содержащей аминокислотную последовательность SEQ ID NO: 137 или 145; (e) CDR2 VL, содержащей аминокислотную последовательность SEQ ID NO: 138 или 146; и (f) CDR3 VL, содержащей аминокислотную последовательность SEQ ID NO: 139 или 147.

[0068] В конкретных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL выбраны из группы, состоящей из SEQ ID NO: 133, 134, 135, 137, 138 и 139 и SEQ ID NO: 141, 142, 143, 144, 145, 146 и 147.

[0069] В дополнительных вариантах осуществления настоящее изобретение относится к выделенному антителу или его антигенсвязывающему фрагменту, которые специфично связываются с тем же эпитопом ClfA, что и любое другое из описанных выше антител или антигенсвязывающих фрагментов к ClfA.

D. Антитела к альфа-токсину (AT)

[0070] В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент, направленные против секретируемого токсина, содержат VH, содержащую аминокислотную последовательность SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент к секретируемому токсину содержат VL, содержащую аминокислотную последовательность SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63. В еще одном варианте осуществления антитело или его антигенсвязывающий фрагмент к альфа-токсину содержат VH, содержащую аминокислотную последовательность SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62, и VL, содержащую аминокислотную последовательность SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63. См. Пример 7, таблицу 7, для иллюстрации последовательностей VH и VL, представленных в настоящем документе, которые могут присутствовать в любой комбинации с образованием антитела или его антигенсвязывающего фрагмента к альфа-токсину или могут присутствовать в комбинации с образованием mAb по настоящему изобретению. В некоторых вариантах осуществления VH представляет собой SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62. В различных вариантах осуществления VL представляет собой SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63.

[0071] Некоторые нуклеотидные последовательности VH и VL, кодирующие обсуждаемые в настоящем документе аминокислотные последовательности VH и VL, представлены в Примере 7, таблице 8.

[0072] В некоторых вариантах осуществления раскрываемые в настоящем документе выделенные антитела или антигенсвязывающие фрагменты содержат VH и VL, где VH и VL имеют аминокислотные последовательности, представленные под SEQ ID NO: 20 и 19; SEQ ID NO: 22 и 21; SEQ ID NO: 24 и 23; SEQ ID NO: 26 и 25; SEQ ID NO: 28 и 27; SEQ ID NO: 41 и 42; SEQ ID NO: 43 и 44; SEQ ID NO: 45 и 46; SEQ ID NO: 47 и 48; SEQ ID NO: 47 и 48; SEQ ID NO: 49 и 50; SEQ ID NO: 51 и 52; SEQ ID NO: 51 и 52; SEQ ID NO: 53 и 54; SEQ ID NO: 55 и 56; SEQ ID NO: 57 и 58; SEQ ID NO: 59 и 60; SEQ ID NO: 61 и 58; SEQ ID NO: 62 и 58; SEQ ID NO: 62 и 63; SEQ ID NO: 79 и 63.

[0073] В определенных вариантах осуществления антитела или фрагменты, направленные против поверхностных антигенов или секретируемых токсинов S. aureus, содержат VH и/или VL, которые имеют заданный процент идентичности по меньшей мере к одной из последовательностей VH и/или VL, раскрытых в таблице 7.

[0074] В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент к секретируемому токсину содержат аминокислотную последовательность VH, которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% или 100% (или на любую процентную долю между ними) идентична аминокислотной последовательности SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент, содержат аминокислотную последовательность VH с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62. Применяемое в настоящем документе выражение “консервативная замена” относится к замещению первой аминокислоты второй аминокислотой, которая практически не изменяет химические, физические и/или функциональные свойства антитела или его антигенсвязывающего фрагмента (например, антитело или его антигенсвязывающий фрагмент сохраняют такие же заряд, структуру, полярность, гидрофобность/гидрофильность и/или сохраняет такие функции, как способность связывать альфа-токсин и, таким образом, уменьшать вирулентность S. aureus). В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность VH с заданным процентом идентичности к SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62 и имеют одну или несколько из следующих характеристик:

(a) константа диссоциации (KD) для альфа-токсина S. aureus, равная приблизительно 13 нМ или менее;

(b) ингибируют образование олигомеров альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними);

(с) снижают цитолитическую активность альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними) (например, при определении посредством анализов на основе клеточного лизиса и гемолиза); и

(d) уменьшают инфильтрацию иммунными клетками, бактериальную нагрузку и высвобождение провоспалительных цитокинов (например, в животной модели пневмонии).

[0075] В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент к секретируемому токсину содержат аминокислотную последовательность VL, которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% (или на любую процентную долю между ними) идентична аминокислотной последовательности SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63. В различных вариантах осуществления антитело или его антигенсвязывающий фрагмент, содержат аминокислотную последовательность VL с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность VL с заданным процентом идентичности к SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63 и имеют одну или несколько из следующих характеристик:

(a) константа диссоциации (KD) для альфа-токсина S. aureus, равная приблизительно 13 нМ или менее;

(b) ингибируют связывание альфа-токсина с клеточной поверхностью, таким образом, нарушая образование олигомеров альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними);

(с) снижают цитолитическую активность альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними) (например, при определении посредством анализов на основе клеточного лизиса и гемолиза); и

(d) уменьшают инфильтрацию иммунными клетками, бактериальную нагрузку и высвобождение провоспалительных цитокинов (например, в животной модели пневмонии).

[0076] В некоторых вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент специфично связываются с полипептидом альфа-токсина Staphylococcus aureus и включают в себя (a) CDR1 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 7, 10, 13 или 69; (b) CDR2 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 8, 11, 14, 17, 70 или 75; и/или (c) CDR3 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78.

[0077] В конкретных вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент, которые специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, содержат CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR по отношению к SEQ ID NO: 7, 8 и 9; SEQ ID NO: 10, 11 и 12; SEQ ID NO: 13, 14 и 15; SEQ ID NO: 7, 17 и 18; SEQ ID NO: 7, 8 и 16; SEQ ID NO: 7, 8 и 65; SEQ ID NO: 7, 8 и 66; SEQ ID NO: 7, 8 и 67; SEQ ID NO: 7, 8 и 78; SEQ ID NO: 69, 70 и 71; SEQ ID NO: 7, 8 и 72; SEQ ID NO: 69, 75 и 71; SEQ ID NO: 69, 75 и 76 или SEQ ID NO: 69, 70 и 71.

[0078] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, включают в себя (a) CDR1 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 1 или 4; (b) CDR2 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 2, 5, 73 или 77; и/или (c) CDR3 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 3, 6, 64, 68 или 74.

[0079] В конкретных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, содержат CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR по отношению к SEQ ID NO: 1, 2 и 3; SEQ ID NO: 4, 5 и 6; SEQ ID NO: 1, 2 и 64; SEQ ID NO: 1, 2 и 68; SEQ ID NO: 1, 73 и 74 или SEQ ID NO: 1, 77 и 74.

[0080] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают полипептид альфа-токсина Staphylococcus aureus, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные, или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR, по отношению к: (a) CDR1 VH, содержащей аминокислотную последовательность SEQ ID NO: 7, 10, 13 или 69; (b) CDR2 VH, содержащей аминокислотную последовательность SEQ ID NO: 8, 11, 14, 17, 70 или 75; (c) CDR3 VH, содержащей аминокислотную последовательность SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78; (d) CDR1 VL, содержащей аминокислотную последовательность SEQ ID NO: 1 или 4; (e) CDR2 VL, содержащей аминокислотную последовательность SEQ ID NO: 2, 5, 73 или 77; или (f) CDR3 VL, содержащей аминокислотную последовательность SEQ ID NO: 3, 6, 64, 68 или 74.

[0081] В конкретных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают полипептид альфа-токсина Staphylococcus aureus, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR, по отношению к SEQ ID NO: 7, 8, 9, 1, 2 и 3; SEQ ID NO: 10, 11, 12, 1, 2 и 3; SEQ ID NO: 13, 14, 15, 4, 5 и 6; SEQ ID NO: 7, 17, 18, 1, 2 и 3; SEQ ID NO: 7, 8, 16, 1, 2 и 64; SEQ ID NO: 7, 8, 65, 1, 2 и 64; SEQ ID NO; 7, 8, 66, 1, 2 и 64; SEQ ID NO: 7, 8, 67, 1, 2 и 68; SEQ ID NO: 7, 8, 67, 1, 2 и 64; SEQ ID NO: 7, 8, 78, 1, 2 и 64; SEQ ID NO: 7, 8, 65, 1, 2 и 68; SEQ ID NO: 69, 70, 71, 1, 2 и 68; SEQ ID NO: 7, 8, 72, 1, 73 и 74; SEQ ID NO: 69, 75, 71, 1, 2 и 68; SEQ ID NO: 69, 75, 76, 1, 2 и 68; SEQ ID NO: 69, 75, 76, 1, 77 и 74; или SEQ ID NO: 69, 70, 71, 1, 77 и 74.

[0082] В некоторых вариантах осуществления представлена композиция, содержащая выделенное антитело или его антигенсвязывающий фрагмент, которые (i) включают в себя VH-домен цепи, содержащий три CDR, и VL-домен цепи, содержащий три CDR; и (ii) специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, где три CDR VH-домена цепи включают в себя (a) CDR1 VH, содержащую аминокислотную последовательность SEQ ID NO: 7, 10, 13 или 69; (b) CDR2 VH, содержащую аминокислотную последовательность SEQ ID NO: 8, 11, 14, 17, 70 или 75; и (c) CDR3 VH, содержащую аминокислотную последовательность SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78. В конкретных вариантах осуществления CDR1 VH, CDR2 VH и CDR3 VH соответствуют SEQ ID NO: 7, 8 и 9; SEQ ID NO: 10, 11 и 12; SEQ ID NO: 13, 14 и 15; SEQ ID NO: 7, 17 и 18; SEQ ID NO: 7, 8 и 16; SEQ ID NO: 7, 8 и 65; SEQ ID NO: 7, 8 и 66; SEQ ID NO: 7, 8 и 67; SEQ ID NO: 7, 8 и 78; SEQ ID NO: 69, 70 и 71; SEQ ID NO: 7, 8 и 72; SEQ ID NO: 69, 75 и 71; SEQ ID NO: 69, 75 и 76 или SEQ ID NO: 69, 70 и 71.

[0083] В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент специфично связываются с секретируемым токсином S. aureus и содержат (a) CDR1 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 7, 10, 13 или 69; (b) CDR2 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 8, 11, 14, 17, 70 или 75; и (c) CDR3 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78; (d) CDR1 VL, содержащую аминокислотную последовательность SEQ ID NO: 1 или 4; (e) CDR2 VL, содержащую аминокислотную последовательность SEQ ID NO: 2, 5, 73 или 77; и (f) CDR3 VL, содержащую аминокислотную последовательность SEQ ID NO: 3, 6, 64, 68 или 74 и имеют одну или несколько из следующих характеристик:

(a) константа диссоциации (KD) для альфа-токсина составляет приблизительно 13 нМ или менее;

(b) связываются с мономерами альфа-токсина;

(с) ингибируют образование олигомеров альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними);

(d) снижают цитолитическую активность альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними) (например, при определении посредством анализов на основе клеточного лизиса и гемолиза); и

(е) уменьшают инфильтрацию иммунными клетками, бактериальную нагрузку и высвобождение провоспалительных цитокинов (например, в животной модели пневмонии).

[0084] В определенных вариантах осуществления антитело или фрагмент антитела специфично связываются с поверхностным антигеном или секретируемым токсином S. aureus и содержат вариабельный домен тяжелой цепи, который по меньшей мере на 90% идентичен аминокислотной последовательности SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61, 62, 80, 82, 84, 86 или 88, и содержат вариабельный домен легкой цепи, который по меньшей мере на 90% идентичен аминокислотной последовательности SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 63, 81, 83, 85, 87 или 89. В дополнительных вариантах осуществления антитело или его антигенсвязывающий фрагмент уменьшают способность S. aureus уклоняться от опсонофагоцитоза по меньшей мере на 50%. В дополнительных вариантах осуществления антитело или его антигенсвязывающий фрагмент уменьшают концентрацию CFU S. aureus по меньшей мере на 50%. В других вариантах осуществления антитело или его антигенсвязывающий фрагмент ингибируют связывание одного или нескольких мономеров альфа-токсина друг с другом (например, ингибируют олигомеризацию) и/или уменьшают вирулентность S. aureus.

[0085] В некоторых вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент специфично связываются с полипептидом альфа-токсина Staphylococcus aureus и включают (a) CDR1 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 7, 10, 13 или 69; (b) CDR2 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 8, 11, 14, 17, 70 или 75; и/или (c) CDR3 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78.

[0086] В конкретных вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент, которые специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, содержат CDR1 VH, CDR2 VH и CDR3 VH, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR по отношению к SEQ ID NO: 7, 8 и 9; SEQ ID NO: 10, 11 и 12; SEQ ID NO: 13, 14 и 15; SEQ ID NO: 7, 17 и 18; SEQ ID NO: 7, 8 и 16; SEQ ID NO: 7, 8 и 65; SEQ ID NO: 7, 8 и 66; SEQ ID NO: 7, 8 и 67; SEQ ID NO: 7, 8 и 78; SEQ ID NO: 69, 70 и 71; SEQ ID NO: 7, 8 и 72; SEQ ID NO: 69, 75 и 71; SEQ ID NO: 69, 75 и 76 или SEQ ID NO: 69, 70 и 71.

[0087] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, включают (a) CDR1 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 1 или 4; (b) CDR2 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 2, 5, 73 или 77; и/или (c) CDR3 VL, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 3, 6, 64, 68 или 74.

[0088] В конкретных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, содержат CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR по отношению к SEQ ID NO: 1, 2 и 3; SEQ ID NO: 4, 5 и 6; SEQ ID NO: 1, 2 и 64; SEQ ID NO: 1, 2 и 68; SEQ ID NO: 1, 73 и 74 или SEQ ID NO: 1, 77 и 74.

[0089] В некоторых вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают полипептид альфа-токсина Staphylococcus aureus, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные, или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR, по отношению к: (a) CDR1 VH, содержащей аминокислотную последовательность SEQ ID NO: 7, 10, 13 или 69; (b) CDR2 VH, содержащей аминокислотную последовательность SEQ ID NO: 8, 11, 14, 17, 70 или 75; (c) CDR3 VH, содержащей аминокислотную последовательность SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78; (d) CDR1 VL, содержащей аминокислотную последовательность SEQ ID NO: 1 или 4; (e) CDR2 VL, содержащей аминокислотную последовательность SEQ ID NO: 2, 5, 73 или 77; или (f) CDR3 VL, содержащей аминокислотную последовательность SEQ ID NO: 3, 6, 64, 68 или 74.

[0090] В конкретных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают полипептид альфа-токсина Staphylococcus aureus, содержат CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL, содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 мутации аминокислотных остатков в каждой CDR, по отношению к SEQ ID NO: 7, 8, 9, 1, 2 и 3; SEQ ID NO: 10, 11, 12, 1, 2 и 3; SEQ ID NO: 13, 14, 15, 4, 5 и 6; SEQ ID NO: 7, 17, 18, 1, 2 и 3; SEQ ID NO: 7, 8, 16, 1, 2 и 64; SEQ ID NO: 7, 8, 65, 1, 2 и 64; SEQ ID NO; 7, 8, 66, 1, 2 и 64; SEQ ID NO: 7, 8, 67, 1, 2 и 68; SEQ ID NO: 7, 8, 67, 1, 2 и 64; SEQ ID NO: 7, 8, 78, 1, 2 и 64; SEQ ID NO: 7, 8, 65, 1, 2 и 68; SEQ ID NO: 69, 70, 71, 1, 2 и 68; SEQ ID NO: 7, 8, 72, 1, 73 и 74; SEQ ID NO: 69, 75, 71, 1, 2 и 68; SEQ ID NO: 69, 75, 76, 1, 2 и 68; SEQ ID NO: 69, 75, 76, 1, 77 и 74; или SEQ ID NO: 69, 70, 71, 1, 77 и 74.

[0091] В некоторых вариантах осуществления представлена композиция, содержащая выделенное антитело или его антигенсвязывающий фрагмент, которые (i) включают VH-домен цепи, содержащий три CDR, и VL-домен цепи, содержащий три CDR; и (ii) специфично связываются с полипептидом альфа-токсина Staphylococcus aureus, где три CDR VH-домена цепи включают (a) CDR1 VH, содержащую аминокислотную последовательность SEQ ID NO: 7, 10, 13 или 69; (b) CDR2 VH, содержащую аминокислотную последовательность SEQ ID NO: 8, 11, 14, 17, 70 или 75; и (c) CDR3 VH, содержащую аминокислотную последовательность SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78. В конкретных вариантах осуществления CDR1 VH, CDR2 VH и CDR3 VH соответствуют SEQ ID NO: 7, 8 и 9; SEQ ID NO: 10, 11 и 12; SEQ ID NO: 13, 14 и 15; SEQ ID NO: 7, 17 и 18; SEQ ID NO: 7, 8 и 16; SEQ ID NO: 7, 8 и 65; SEQ ID NO: 7, 8 и 66; SEQ ID NO: 7, 8 и 67; SEQ ID NO: 7, 8 и 78; SEQ ID NO: 69, 70 и 71; SEQ ID NO: 7, 8 и 72; SEQ ID NO: 69, 75 и 71; SEQ ID NO: 69, 75 и 76 или SEQ ID NO: 69, 70 и 71.

[0092] В определенных вариантах осуществления комбинация последовательностей CDR, присутствующих для образования антитела к секретируемому токсину, включают CDR1 VH, содержащую SEQ ID NO: 7, 10, 13 или 69, CDR2 VH, содержащую SEQ ID NO: 8, 11, 14, 17, 70 или 75, и CDR3 VH, содержащую SEQ ID NO: SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78, которые описаны в таблице 9. В некоторых вариантах осуществления CDR1 VL содержит SEQ ID NO: 1 или 4, CDR2 VL содержит SEQ ID NO: 2, 5, 73 или 77, и CDR3 VL содержит SEQ ID NO: 3, 6, 64, 68 или 74, которые описаны в таблице 9.

[0093] Раскрываемые в настоящем документе антитела и их антигенсвязывающие фрагменты могут содержать одну или несколько аминокислотных последовательностей, которые практически аналогичны раскрываемым в настоящем документе аминокислотным последовательностям. Аминокислотные последовательности, которые являются практически аналогичными, включают последовательности, содержащие консервативные аминокислотные замены, а также делеции и/или вставки аминокислот.

E. Каркасные области

[0094] Вариабельные домены каждой из тяжелых и легких цепей содержат по меньшей мере одну из каркасных областей (FR1, FR2, FR3, FR4 или альтернативно FW1, FW2, FW3, FW4). Каркасные области тяжелой цепи обозначают FR VH, в то время как каркасные области легкой цепи обозначают FR VL. В определенных вариантах осуществления каркасные области могут содержать замены, вставки или другие изменения. В определенных вариантах осуществления эти изменения в результате приводят к улучшению или оптимизации аффинности связывания у антитела. Неограничивающие примеры остатков каркасной области, которые могут быть модифицированы, включают остатки, которые нековалентно связывают непосредственно антиген, взаимодействуют с/влияют на конформацию CDR, и/или участвуют в формировании поверхности контакта VL-VH.

[0095] В определенных вариантах осуществления каркасная область может содержать одно или несколько изменений аминокислот для “приведения в соответствии с зародышевым типом”. Например, аминокислотные последовательности тяжелой и легкой цепей выбранного антитела можно сравнить для приведения в соответствии с зародышевым типом, и в случаях, где определенные каркасные остатки выбранных VL и/или VH цепей отличаются от конфигурации зародышевого типа (например, в результате соматической мутации генов иммуноглобулина, используемых для получения фаговой библиотеки), может быть желательно "мутировать к первоначальному виду" измененные каркасные остатки выбранных антител до конфигурации зародышевого типа (т.е. изменить каркасные аминокислотные последовательности выбранных антител так, чтобы они были аналогичны каркасным аминокислотным последовательностям зародышевого типа). Такая "мутация к первоначальному виду" (или "приведение в соответствии с зародышевым типом") каркасных остатков можно осуществить с помощью стандартных способов молекулярной биологии для внедрения конкретных мутаций (например, сайт-направленным мутагенезом; PCR-опосредованным мутагенезом). В некоторых вариантах осуществления к первоначальному виду подвергают мутации каркасные остатки вариабельных областей легкой и/или тяжелой цепи. В определенных вариантах осуществления к первоначальному виду подвергают мутации вариабельную область тяжелой цепи раскрываемого в настоящем документе выделенного антитела или антигенсвязывающего фрагмента. В определенных вариантах осуществления вариабельная область тяжелой цепи выделенного антитела или антигенсвязывающего фрагмента содержит по меньшей мере одну, по меньшей мере две, по меньшей мере три, по меньшей мере четыре или более мутаций к первоначальному виду.

[0096] В определенных вариантах осуществления VH антитела к альфа-токсину или его антигенсвязывающего фрагмента могут содержать FR1, FR2, FR3 и/или FR4 с аминокислотными последовательностями, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим каркасным областям VH в SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62. В некоторых вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям VH SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62. В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR в VH SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62.

[0097] В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент могут содержать FR VH (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотных мутации по отношению к соответствующей FR в VH SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62. В частности, каждая из FR1, FR2, FR3 или FR4 в VH могут иметь аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотных мутации по отношению к соответствующей FR1, FR2, FR3 или FR4 в VH SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62.

[0098] В определенных вариантах осуществления VL приводимого в настоящем документе антитела к альфа-токсину или его антигенсвязывающего фрагмента могут содержать FR1, FR2, FR3 и/или FR4 с аминокислотными последовательностями, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим каркасным областям в пределах FR в VL SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63. В некоторых вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим FR в VL SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63. В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR в VL SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63.

[0099] В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент содержат FR VL (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотных мутации по отношению к соответствующей FR в VL SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63. В частности, каждая из FR1, FR2, FR3 или FR4 в VL могут иметь аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотных мутации по отношению к соответствующей FR1, FR2, FR3 или FR4 в VH SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63.

[00100] В определенных вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают секретируемый токсин S. aureus, содержат FR VH (FR1, FR2, FR3 и/или FR4), содержащие аминокислотные последовательности, идентичные или содержащие 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VH SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62, и/или FR VL (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VL SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63.

[00101] В определенных вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент специфично связывают секретируемый токсин S. aureus и содержат FR VH (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VH SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62, и/или FR VL (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VL SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63, и при этом антитело имеет одну или несколько из следующих характеристик:

(a) константа аффинности (KD) в отношении альфа-токсина составляет приблизительно 13 нМ или менее;

(b) связывается с мономерами альфа-токсина;

(с) ингибирует образование олигомеров альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними);

(d) снижает цитолитическую активность альфа-токсина по меньшей мере на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними) (например, при определении посредством анализов на основе клеточного лизиса и гемолиза); и

(е) уменьшает инфильтрацию иммунными клетками, бактериальную нагрузку и высвобождение провоспалительных цитокинов (например, в животной модели пневмонии).

[00102] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают поверхностный антиген IsdH S. aureus, содержащие FR1, FR2, FR3 и/или FR4 области VH, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 80, 82, 84, 86 или 88. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим аминокислотным последовательностям четырех FR-областей VH SEQ ID NO: 80, 82, 84, 86 или 88. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VH SEQ ID NO: 80, 82, 84, 86 или 88.

[00103] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают IsdH, содержащие FR1, FR2, FR3 и/или FR4 области VL, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 81, 83, 85, 87 или 89. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 81, 83, 85, 87 или 89. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 81, 83, 85, 87 или 89.

[00104] В определенных вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент специфично связывают IsdH и содержат FR VH (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VH SEQ ID NO: 80, 82, 84, 86 или 88, и/или содержат FR VL (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VL SEQ ID NO: 81, 83, 85, 87 или 89.

[00105] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают IsdH, содержащие FR1, FR2, FR3 и/или FR4 области VH, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 80, 82, 84, 86 или 88. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим аминокислотным последовательностям четырех FR-областей VH SEQ ID NO: 80, 82, 84, 86 или 88. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VH SEQ ID NO: 80, 82, 84, 86 или 88.

[00106] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают IsdH, содержащие FR1, FR2, FR3 и/или FR4 области VL, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 81, 83, 85, 87 или 89. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 81, 83, 85, 87 или 89. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 81, 83, 85, 87 или 89.

[00107] В определенных вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент специфично связывают IsdH и содержат FR VH (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VH SEQ ID NO: 80, 82, 84, 86 или 88, и/или содержат FR VL (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VL SEQ ID NO: 81, 83, 85, 87 или 89.

[00108] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают поверхностный антиген ClfA S. aureus, содержащие FR1, FR2, FR3 и/или FR4 области VH, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 132 или 140. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим аминокислотным последовательностям четырех FR-областей VH SEQ ID NO: 132 или 140. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VH SEQ ID NO: 132 или 140.

[00109] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают ClfA, содержащие FR1, FR2, FR3 и/или FR4 области VL, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 136 или 144. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 136 или 144. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 136 или 144.

[00110] В определенных вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент специфично связывают ClfA и содержат FR VH (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VH SEQ ID NO: 132 или 136, и/или содержат FR VL (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VL SEQ ID NO: 136 или 144.

[00111] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают ClfA, содержащие FR1, FR2, FR3 и/или FR4 области VH, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 132 или 140. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим аминокислотным последовательностям четырех FR-областей VH SEQ ID NO: 132 или 140. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VH (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VH SEQ ID NO: 132 или 140.

[00112] В определенных вариантах осуществления предложены выделенное антитело или антигенсвязывающий фрагмент, которые специфично связывают IsdH, содержащие FR1, FR2, FR3 и/или FR4 области VL, имеющие аминокислотные последовательности, которые на от приблизительно 65% до приблизительно 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 136 или 144. В некоторых вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 136 или 144. В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент содержат аминокислотную последовательность FR VL (FR1, FR2, FR3 и/или FR4), которая по меньшей мере на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или 100% идентична (или на любую процентную долю между ними) соответствующим FR-областям в VL SEQ ID NO: 136 или 144.

[00113] В определенных вариантах осуществления выделенное антитело или антигенсвязывающий фрагмент специфично связывают ClfA и содержат FR VH (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VH SEQ ID NO: 132 или 140, и/или содержат FR VL (FR1, FR2, FR3 и/или FR4), содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 аминокислотные мутации по отношению к соответствующей FR в VL SEQ ID NO: 136 или 144.

F. Нуклеотидные последовательности, кодирующие антитела к альфа-токсину и их антигенсвязывающие фрагменты

[00114] Помимо описанных выше аминокислотных последовательностей, дополнительно предложены нуклеотидные последовательности, соответствующие раскрытым в настоящем документе аминокислотным последовательностям. В некоторых вариантах осуществления нуклеотидная последовательность кодирует антитело или его антигенсвязывающий фрагмент, направленные против поверхностного антигена или секретируемого токсина S. aureus. Нуклеотидные последовательности приведены в Примере 7, таблице 8. Таким образом, также предложены полинуклеотидные последовательности, кодирующие VH и VL области, включающие FR-области и CDR, для описываемых в настоящем документе антител или фрагментов, а также векторы экспрессии для их эффективной экспрессии в клетках (например, клетках млекопитающих).

[00115] Также в настоящем документе раскрыты полинуклеотиды, которые практически идентичны полинуклеотидам, кодирующим раскрытые в настоящем документе аминокислотные последовательности. Практически идентичные последовательности могут быть полиморфными последовательностями, т.е. альтернативными последовательностями или аллелями в популяции. Практически идентичные последовательности могут также содержать подвергнутые мутагенезу последовательности, в том числе последовательности, содержащие молчащие мутации. Мутация может включать изменения одного или нескольких остатков, делецию одного или нескольких остатков или вставку одного или нескольких дополнительных остатков. Практически идентичные последовательности также могут содержать различные нуклеотидные последовательности, которые кодируют одну и ту же аминокислоту в любой заданной аминокислотной позиции в раскрываемой в настоящем документе аминокислотной последовательности, вследствие вырожденности кода нуклеиновой кислоты.

[00116] Также в настоящем документе раскрыты полинуклеотиды, которые гибридизируются в условиях гибридизации высокой или низкой жесткости с полинуклеотидами, которые кодируют антитело или его антигенсвязывающий фрагмент, направленные против поверхностного антигена или секретируемого токсина S. aureus. Применяемое в настоящем документе выражение “жесткость” относится к экспериментальным условиям (например, температуре и концентрации соли) эксперимента по гибридизации для определения степени гомологии между двумя нуклеиновыми кислотами; чем выше жесткость, тем выше процент гомологии между двумя нуклеиновыми кислотами. Применяемая в настоящем документе фраза “гибридизация” или ее грамматические варианты относятся к связыванию первой молекулы нуклеиновой кислоты со второй молекулой нуклеиновой кислоты в условиях низкой, средней или высокой жесткости или в условиях синтеза нуклеиновой кислоты. Гибридизация может включать случаи, при которых первая молекула нуклеиновой кислоты связывается со второй молекулой нуклеиновой кислоты, где первая и вторая молекулы нуклеиновой кислоты комплементарны.

[00117] Жесткие условия гибридизации включают без ограничения гибридизацию со связанной на фильтре ДНК в 6X хлориде натрия/цитрате натрия (SSC) при приблизительно 45 градусах Цельсия с последующим одной или несколькими отмывками в 0,2X SSC/0,1% SDS при приблизительно 50-65 градусах Цельсия. Другие жесткие условия включают гибридизацию со связанной на фильтре ДНК в 6X SSC при приблизительно 45 градусах Цельсия с последующей одной или несколькими отмывками в 0,1X SSC/0,2% SDS при приблизительно 65 градусах Цельсия. Специалисту в настоящей области известны и другие жесткие условия и они включены в настоящий документ.

[00118] В определенных вариантах осуществления раскрываемая в настоящем документе нуклеиновая кислота может кодировать аминокислотную последовательность антитела или его антигенсвязывающего фрагмента, направленного против поверхностного антигена или секретируемого токсина S. aureus, или нуклеиновая кислота может гибридизироваться в жестких условиях с нуклеиновой кислотой, включающей нуклеотидную последовательность, которая кодирует аминокислотную последовательность антитела или его антигенсвязывающего фрагмента.

[00119] В определенных вариантах осуществления полинуклеотидная последовательность может содержать нуклеотидную последовательность, кодирующую аминокислотную последовательность антитела или его антигенсвязывающего фрагмента, которые могут связывать поверхностный антиген или секретируемый токсин S. aureus и которые по меньшей мере приблизительно на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентичны (или на любую процентную долю между ними) аминокислотной последовательности VH с SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61, 62, 80, 82, 84, 86 или 88. В определенных вариантах осуществления полинуклеотидная последовательность может содержать нуклеотидную последовательность, кодирующую аминокислотную последовательность с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61, 62, 80, 82, 84, 86 или 88. В некоторых вариантах осуществления полинуклеотидная последовательность может содержать нуклеотидную последовательность, кодирующую аминокислотную последовательность антитела или его антигенсвязывающего фрагмента, которые могут связывать поверхностный антиген или секретируемый токсин S. aureus и которые по меньшей мере приблизительно на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентичны (или на любую процентную долю между ними) нуклеотидной последовательности VH с SEQ ID NO: 30, 32, 34, 36, 38, 120, 122, 124, 126 или 128.

[00120] В определенных вариантах осуществления полинуклеотидная последовательность может содержать нуклеотидную последовательность, кодирующую аминокислотную последовательность антитела или его антигенсвязывающего фрагмента, которые могут связывать поверхностный антиген или секретируемый токсин S. aureus и которые по меньшей мере приблизительно на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентичны (или на любую процентную долю между ними) аминокислотной последовательности VL с SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 63, 81, 83, 85, 87 или 89. В определенных вариантах осуществления полинуклеотидная последовательность может содержать нуклеотидную последовательность, кодирующую аминокислотную последовательность с 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 мутациями (включая присоединения, делеции и замены, такие как консервативные замены) в аминокислотной последовательности SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 63, 81, 83, 85, 87 или 89. В некоторых вариантах осуществления полинуклеотидная последовательность может содержать нуклеотидную последовательность, кодирующую аминокислотную последовательность антитела или его антигенсвязывающего фрагмента, которые могут связывать поверхностный антиген или секретируемый токсин S. aureus и которые по меньшей мере приблизительно на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентичны (или на любую процентную долю между ними) нуклеотидной последовательности VL с SEQ ID NO: 29, 31, 33, 35, 37, 121, 123, 125, 127 или 129.

[00121] В конкретных вариантах осуществления полинуклеотидная последовательность может содержать нуклеотидную последовательность, кодирующую аминокислотную последовательность антитела или его антигенсвязывающего фрагмента, которые могут связывать поверхностный антиген или секретируемый токсин S. aureus и которые по меньшей мере приблизительно на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентичны (или на любую процентную долю между ними) аминокислотной последовательности VH и по меньшей мере приблизительно на 65%, 70%, 75%, 80%, 85%, 90%, 95% или 100% идентичны (или на любую процентную долю между ними) аминокислотной последовательности VL, при этом последовательности VH и VL представлены под SEQ ID NO: 20 и 19; SEQ ID NO: 22 и 21; SEQ ID NO: 24 и 23; SEQ ID NO: 26 и 25; SEQ ID NO: 28 и 27; SEQ ID NO: 41 и 42; SEQ ID NO: 43 и 44; SEQ ID NO: 45 и 46; SEQ ID NO: 47 и 48; SEQ ID NO: 47 и 48; SEQ ID NO: 49 и 50; SEQ ID NO: 51 и 52; SEQ ID NO: 51 и 52; SEQ ID NO: 53 и 54; SEQ ID NO: 55 и 56; SEQ ID NO: 57 и 58; SEQ ID NO: 59 и 60; SEQ ID NO: 61 и 58; SEQ ID NO: 62 и 58; SEQ ID NO: 62 и 63; SEQ ID NO: 79 и 63; SEQ ID NO: 80 и 81; SEQ ID NO: 82 и 83; SEQ ID NO: 84 и 85; SEQ ID NO: 86 и 87; SEQ ID NO: 88 и 89.

[00122] Раскрываемые полинуклеотиды можно получить и нуклеотидную последовательность полинуклеотидов можно определить с помощью любого способа, известного из уровня техники. Например, если нуклеотидная последовательность антитела известна, то полинуклеотид, кодирующий антитело, можно собрать из синтезированных химическими способами олигонуклеотидов. Это будет включать, например, синтез перекрывающихся олигонуклеотидов, содержащих части последовательности, кодирующей антитело, отжиг и лигирование данных олигонуклеотидов, а затем амплификацию лигированных олигонуклеотидов с помощью PCR. Раскрываемые полинуклеотиды также можно получить из любого подходящего источника нуклеиновых кислот, такого как библиотека cDNA антител, или библиотека cDNA, выделенная из любой ткани или клеток, экспрессирующих антитело (например, из клеток гибридомы, выбранных для экспрессии антитела).

G. Функциональные характеристики антител или фрагментов, направленных против поверхностных антигенов или секретируемых токсинов S. aureus

[00123] В определенных вариантах осуществления антитело или его антигенсвязывающий фрагмент, направленные против поверхностного антигена S. aureus, изменяют биологические свойства клеток S. aureus, которые экспрессируют поверхностный антиген. В различных вариантах осуществления антитело связывает поверхностный антиген S. aureus, таким образом усиливая опсонофагоцитоз клетками хозяина. В следующих вариантах осуществления опсонофагоцитоз повышается на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними), по результатам измерения с помощью анализа опсонофагоцитирующего киллинга. В некоторых вариантах осуществления связывание антитела с антигеном, являющимся поверхностной детерминантой, предупреждает взаимодействие поверхностного антигена и поверхностного адгезина, таким образом, уменьшая концентрацию колониеобразующих единиц (CFU), присутствующих в ткани хозяина, по результатам измерения в мышиной модели бактериемии. В следующих вариантах осуществления концентрация CFU уменьшается на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними) по сравнению с концентрацией CFU в присутствии антитела отрицательного контроля или в отсутствии антитела или его антигенсвязывающего фрагмента. Например, антитело к IsdH может уменьшать концентрацию CFU на 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними). В некоторых вариантах осуществления антитело к поверхностному антигену может конкурировать с гаптоглобином и/или гемоглобином за связывание с S. aureus, таким образом ингибируя способность S. aureus получать доступ и использовать железо в гемоглобине. В определенных вариантах осуществления антитела или фрагменты, направленные против поверхностного антигена, уменьшают способность S. aureus связывать гаптоглобин и/или гемоглобин на 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними) по сравнению со связыванием S. aureus в отсутствии антитела. Например, антитело к IsdH может уменьшать способность S. aureus связывать гаптоглобин и/или гемоглобин на 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 95% (или на любую процентную долю между ними).

[00124] Применяемое в настоящем документе выражение “анализ опсонофагоцитирующего киллинга” (OPK) относится к любому анализу, применяемому для измерения процента фагоцитирующего киллинга, индуцированного в ткани хозяина in vitro после добавления антитела к образцу ткани, содержащему S. aureus с известной концентрацией. Данное уменьшение CFU нормализуют против контрольного уровня OPK, наблюдаемого в присутствии контрольного антитела. С помощью анализа измеряют способность целевого антитела индуцировать активацию комплемента и последующий фагоцитоз. Например, OPK может включать объединение 10 мкл антитела и 10 мкл S. aureus (106 клеток/мл), с последующим добавлением 10 мкл клеток промиелоцитарного лейкоза человека (HL-60) (107 клеток/мл) и 10 мкл сыворотки человека, предварительно абсорбированной по S. aureus. Затем можно посеять 10 мкл смеси (в момент времени T0) с последующим лизисом клеток с применением 1% сапонина (в момент времени T60) и определением концентрации CFU S. aureus. Процентную долю киллинга можно рассчитывать следующим образом: 100×(1-(T60/T0)), где T60 относится к концентрации CFU в конце анализа (т. е., через 60 минут), а T0 относится к концентрации CFU в начале анализа.

[00125] Применяемое в настоящем документе выражение “модель бактериемии” относится к любой in vivo модели инфекции S. aureus, применяемой для оценки влияния антитела на бактериальную нагрузку S. aureus, выраженный как процент уменьшения CFU. Например, модель бактериемии может включать введение антитела мыши, последующее внутрибрюшинное введение 108 CFU S. aureus, а затем забор крови и измерение концентрации CFU по сравнению с концентрацией CFU после введения контрольного антитела.

[00126] В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент изменяет биологические свойства альфа-токсина и/или клеток, экспрессирующих альфа-токсин. В некоторых вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент нейтрализуют биологическую активность альфа-токсина в результате связывания с полипептидом и ингибирования связывания с мембраной и сборки мономеров альфа-токсинов в трансмембранную пору (например, гептамер альфа-токсина). Анализы нейтрализации можно провести с помощью способов, известных из уровня техники, с использованием, при некоторых условиях, коммерчески доступных реактивов. Нейтрализацию альфа-токсина зачастую измеряют с помощью IC50, равной 1×10-6 M или менее, 1×10-7 M или менее, 1×10-8 M или менее, 1×10-9 M или менее, 1×10-10 M или менее и 1×10-11 M или менее. Выражение “концентрация 50% ингибирования” (сокращенно “IC50”) представляет собой концентрацию ингибитора (например, предлагаемого в настоящем документе антитела к альфа-токсину или его антигенсвязывающего фрагмента), которая необходима для 50% ингибирования заданной активности молекулы, на которую воздействует ингибитор (например, олигомеризацию альфа-токсина с образованием гептамерного комплекса трансмембранной поры). Более низкое значение IC50 обычно соответствует более сильному ингибитору.

[00127] В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент ингибируют одну или несколько биологических активностей альфа-токсина. Применяемое в настоящем документе выражение "ингибирование" относится к статистически значимому снижению биологической активности, в том числе к полному блокированию активности. Например, “ингибирование” может относиться к снижению биологической активности приблизительно на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 100% или на любую процентную долю между ними. В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент ингибируют одну или несколько биологических активностей альфа-токсина по меньшей мере на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% или 100% или на любую процентную долю между ними.

[00128] В некоторых вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент могут элиминировать альфа-токсин, секретируемый патогенными S. aureus. В некоторых вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент могут достигать по меньшей мере приблизительно 20%, по меньшей мере приблизительно 30%, по меньшей мере приблизительно 40%, по меньшей мере приблизительно 50%, по меньшей мере приблизительно 60%, по меньшей мере приблизительно 70%, по меньшей мере приблизительно 80%, по меньшей мере приблизительно 90%, по меньшей мере приблизительно 95% или приблизительно 100% элиминирования альфа-токсина, секретируемого S. aureus, или на любую процентную долю между ними. В конкретных вариантах осуществления в сущности весь детектируемый секретируемый альфа-токсин элиминируется из клеток, инфицированных S. aureus.

[00129] В определенных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент могут ингибировать экспрессию одного или нескольких индуцируемых генов, которые непосредственно или опосредованно реагируют на среду, создаваемую инфекцией S. aureus и/или экспрессией и функционированием альфа-токсина. В конкретных вариантах осуществления антитело к альфа-токсину или его антигенсвязывающий фрагмент ингибируют экспрессию одного или нескольких индуцируемых генов, которые реагируют непосредственно или опосредовано на окружение, создаваемое экспрессией и функционированием альфа-токсина S. aureus, по меньшей мере на 20%, по меньшей мере на 30%, по меньшей мере на 40%, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80% или по меньшей мере на 90% или на любую процентную долю между ними.

H. Способы получения антител к поверхностным антигенам и секретируемым токсинам S. aureus

[00130] Далее описаны иллюстративные методики получения раскрываемых в настоящем документе антител. В некоторых вариантах осуществления для получения раскрываемых в настоящем документе антител или фрагментов можно применять рекомбинантные способы или способы с использованием гибридом. В других вариантах осуществления антитела или фрагменты антител могут быть выделены из фаговых библиотек антител, образованных с использованием методик, известных из уровня техники. Для получения антител к поверхностным антигенам или секретируемым токсинам S. aureus также можно применять другие методики получения антител, известные из уровня техники.

[00131] В некоторых вариантах осуществления антитела к IsdH можно получать с применением нативного IsdH S. aureus, мутантного IsdH, варианта или антигенного фрагмента IsdH. Для получения антител также можно применять клетки S. aureus, экспрессирующие IsdH. Для применения IsdH при получении антител к IsdH, его также можно получать рекомбинантно в выделенной форме из бактериальных или эукариотических клеток с применением стандартных способов рекомбинантной ДНК.

[00132] Поликлональные антитела к секретируемому токсину или поверхностному антигену, такому как IsdH, можно получить с помощью различных процедур, известных из уровня техники. Например, полипептид IsdH или его иммуногенный фрагмент можно вводить различным животным-хозяевам посредством подкожных или внутрибрюшинных инъекций соответствующего антигена для индукции выработки содержащихся в сыворотке поликлональных антител, специфичных к антигену. Животные-хозяева включают без ограничения кроликов, мышей и крыс. В некоторых вариантах осуществления для усиления иммунного ответа можно применять различные адъюванты в зависимости от вида-хозяина, и они включают без ограничения адъювант Фрейнда (полный и неполный), минеральные гели, такие как гидроксид алюминия, поверхностно-активные вещества, такие как лизолецитин, полиолы-плюроники, полианионы, пептиды, масляные эмульсии, гемоцианин лимфы улитки, динитрофенол и потенциально пригодные адъюванты для человека, такие как BCG (бацилла Кальметта-Герена) и Corynebacterium parvum. Также можно применять другие адъюванты, известные из уровня техники.

[00133] Моноклональные антитела к секретируемому токсину или поверхностному антигену, такому как IsdH, можно получать при помощи широкого разнообразия методик, известных в данной области техники, включая применение гибридомной, рекомбинантной технологий и технологии фагового дисплея или их комбинации. Применяемое в настоящем документе выражение “моноклональное антитело” относится к антителу, получаемому из популяции практически однородных или выделенных антител, например, отдельные антитела, составляющие популяцию, являются идентичными, за исключением возможных, встречающихся в природе мутаций, которые могут присутствовать в незначительных количествах. Модификатор “моноклональное” не следует понимать как нуждающееся в получении каким-либо конкретным способом антитело. Моноклональные антитела включают моноклональные млекопитающего, химерные, гуманизированные, человеческие, доменные, диатела, вакцитела (vaccibodies), линейные и мультиспецифичные антитела.

[00134] После получения раскрываемого в настоящем документе антитела его можно очистить любым известным в данной области способом очистки молекулы иммуноглобулина, например, при помощи хроматографии (например, ионообменной, аффинной и колоночной эксклюзионной хроматографией), центрифугирования, дифференциальной растворимости или любой другой методики для очистки белков. Кроме того, антитела, полученные с помощью настоящей методики, или их фрагменты можно гибридизировать с гетерологичными полипептидными последовательностями (в том числе с "метками" эпитопа и другими гибридными белками, такими как гибриды с GST) для облегчения очистки и применения антитела в последующих анализах.

[00135] В определенных вариантах осуществления раскрываемые в настоящем документе антитела являются химерными антителами. Химерными антителами являются антитела, у которых часть тяжелой и/или легкой цепи идентична или гомологична соответствующим последовательностям антител, полученных от конкретного вида или принадлежащих конкретному классу или подклассу антитела, тогда как другая часть цепи(цепей) идентична или гомологична соответствующим последовательностям антител, полученных от другого вида или принадлежащих другому классу или подклассу антитела, а также фрагменты таких антител, при условии, что они проявляют необходимую биологическую активность. Раскрываемые в настоящем документе химерные антитела включают “приматизированные” антитела, содержащие антигенсвязывающие последовательности вариабельного домена, полученные из последовательностей константного участка отличного от человека примата (например, мартышковых, таких как бабуин, макак-резус или яванский макак) и человека. Раскрываемые в настоящем документе химерные антитела также включают гуманизированные антитела, которые получены с помощью известных из уровня техники способов.

[00136] В других вариантах осуществления раскрываемыми в настоящем документе антителами являются человеческие антитела, и они получены с помощью известных из уровня техники способов. Например, полностью человеческие антитела могут быть получены посредством введения нуклеиновых кислот, кодирующих функциональные локусы человеческого антитела, грызуну или другому животному с тем, чтобы грызун или другое животное вырабатывало полностью человеческие антитела. В другом примере человеческие антитела можно получить с помощью in vitro способов. Подходящие примеры включают без ограничения фаговый дисплей, рибосомный дисплей, дрожжевой дисплей и другие известные из уровня техники способы. Дополнительные примеры способов получения человеческих антител или фрагментов, направленных против поверхностных антигенов или секретируемых токсинов S. aureus, включают методику с мышами VelocImmune® (Regeneron Pharmaceuticals). См., например, патент США № 6596541 (включенный с помощью ссылки в полном его объеме).

[00137] В определенных вариантах осуществления может быть необходимо обратное превращение каркасной последовательности раскрываемого в настоящем документе антитела в последовательность зародышевой линии, обратное превращение CDR в последовательность зародышевой линии и/или устранение структурной помехи. Таким образом, в некоторых вариантах осуществления, если раскрываемое в настоящем документе конкретное антитело отличается от его соответствующей последовательности зародышевой линии на аминокислотном уровне, последовательность антитела можно подвергнуть возвратной мутации в последовательность зародышевой линии. Такие корригирующие мутации могут происходить в одном, двух, трех или более позициях или в комбинации каких-либо из мутантных позиций с использованием стандартных методик молекулярной биологии.

[00138] В определенных вариантах осуществления настоящее раскрытие охватывает фрагменты антител или антитела, содержащие эти фрагменты. Фрагмент антитела содержит часть антитела полной длины, которое, как правило, является его антигенсвязывающей или вариабельной областью. Примеры таких фрагментов антител включают фрагменты Fab, Fab’, F(ab’)2, Fd и Fv; диатела; линейные антитела, одноцепочечные молекулы антител и мультиспецифичные антитела являются антителами, полученными из этих фрагментов.

[00139] Помимо описанных выше человеческих, гуманизированных и/или химерных антител раскрываемые в настоящем документе антитела также можно дополнительно модифицировать с включением одного или нескольких из следующего: замены, присоединения и/или делеции по меньшей мере одного аминокислотного остатка и/или полипептида в VL-домене, и/или VH-домене, и/или Fc-области и посттрансляционных модификаций. Для получения конечной конструкции можно осуществить любую комбинацию делеции, вставки и замены при условии, что конечная конструкция обладает необходимыми характеристиками.

[00140] В такие модификации включены конъюгаты антитела, при этом антитело ковалентно присоединено к некоторому компоненту. Компоненты, подходящие для присоединения к антителам, включают без ограничения белки, пептиды, лекарственные средства, метки и цитотоксины. Такие изменения антител можно осуществить для изменения или оптимизации характеристик (например, биохимических, связывающих и/или функциональных) антител, которые подходят для детекции, диагностики и/или лечения инфекции S. aureus и связанных с нею заболеваний или расстройств. Способы получения конъюгатов, осуществления аминокислотных и/или полипептидных изменений и посттрансляционных модификаций известны из уровня техники. Также в данные модификации включены гибридные белки, т. е. антитело или его фрагмент, гибридизированные с гетерологичным белком, полипептидом или пептидом.

[00141] В определенных вариантах осуществления антитела или фрагменты, направленные против поверхностных антигенов или секретируемых токсинов S. aureus получают с включением измененной Fc-области (также называемой в настоящем документе “вариантной Fc-областью”), у которых в Fc-области было выполнено одно или несколько изменений с целью изменения функциональных и/или фармакокинетических свойств антител. Такие изменения в результате могут давать измененную эффекторную функцию, уменьшенную иммуногенность и/или повышенный период полужизни в сыворотке крови. В определенных вариантах осуществления эффекторную функцию антитела можно модифицировать посредством изменений в Fc-области, в том числе, без ограничения, замен аминокислот, добавлений аминокислот, делеций аминокислот и изменений посттрансляционных модификаций аминокислот в Fc (например, гликозилирования).

[00142] В некоторых вариантах осуществления получают антитело с вариантом Fc, которое обладает измененными свойствами связывания с лигандом Fc (например, Fc-рецептором, таким как C1q) по сравнению с антителом с нативным Fc. Примеры свойств связывания без ограничения включают специфичность связывания, равновесную константу диссоциации (Kd), скорости диссоциации и ассоциации (koff и kon, соответственно), аффинность связывания и/или авидность.

[00143] В определенных вариантах осуществления раскрываемые в настоящем документе антитела гликозилируют с целью изменения эффекторной функции антител или изменения аффинности антитела к целевому антигену. В некоторых вариантах осуществления модифицируют паттерн гликозилирования в вариабельной области данного антитела. Например, можно получить негликозилированное антитело (т.е. не подвергнутое гликозилированию антитело). Гликозилирование можно изменять, например, для повышения аффинности антитела к антигену мишени. Подобных углеводных модификаций можно достичь при помощи, например, изменения одного или нескольких сайтов гликозилирования в пределах последовательности антитела. Например, можно осуществить одну или несколько аминокислотных мутаций, результатом чего является удаление одного или нескольких участков гликозилирования каркасного участка вариабельной области, тем самым исключая гликозилирование в данном участке.

[00144] В определенных вариантах осуществления раскрываемые в настоящем документе антитела конъюгируют или ковалентно присоединяют к другому веществу с помощью известных из уровня техники способов. В некоторых вариантах осуществления присоединенное вещество представляет собой детектируемую метку (также называемую в данном документе репортерной молекулой) или твердую подложку. Подходящие вещества для присоединения к антителу включают без ограничения аминокислоту, пептид, белок, полисахарид, нуклеозид, нуклеотид, олигонуклеотид, нуклеиновую кислоту, гаптен, лекарственное средство, гормон, липид, набор липидов, синтетический полимер, полимерную микрочастицу, биологическую клетку, вирус, флуорофор, хромофор, краситель, токсин, гаптен, фермент, антитело, фрагмент антитела, радиоактивный изотоп, твердые матрицы, полутвердые матрицы и их комбинации. Способы конъюгации или ковалентного присоединения другого вещества к антителу известны из уровня техники.

I. Способы лечения с применением поверхностного антитела к антигену или секретируемому токсину S. aureus или его фрагментов

[00145] Раскрываемые в настоящем документе антитела или фрагменты можно вводить отдельно, в комбинации друг с другом или в комбинации с дополнительными фармацевтическими средствами, такими как антибиотики, для предупреждения инфекций S. aureus или связанных с ними симптомов или состояний (например, для лечения гипервоспаления, индуцированного альфа-токсином). Антитела и комбинации антител или фрагментов можно применять для лечения или предупреждения широкого спектра состояний/заболеваний, включая как хронические, так и острые состояния, такие как без ограничения бактериемия, ожоги, флегмона, дерматонекроз, инфекции век, пищевое отравление, инфекции суставов, конъюнктивит новорожденного, остеомиелит, пневмония, кожные инфекции, послеоперационная раневая инфекция, синдром ошпаренной кожи, эндокардит, менингит, абсцедирование и синдром токсического шока. Ниже приведены дополнительные детали касательно возможных заболеваний/состояний, подходящих для терапии против S. aureus.

[00146] В определенных вариантах осуществления по меньшей мере одно раскрываемое в настоящем документе антитело можно вводить в комбинации по меньшей мере с одним дополнительным терапевтическим средством (например, антибиотиком). Примеры антибиотиков, которые можно вводить в комбинации, включают пенициллин, оксациллин, флуклоксациллин, ванкомицин и гентамицин. В определенных вариантах осуществления комбинированная терапия с применением антибиотика и по меньшей мере одного раскрываемого в настоящем документе антитела или его антигенсвязывающего фрагмента увеличивает эффективность лечения путем, например, уменьшения концентрации CFU S. aureus в ткани хозяина, уменьшения способности S. aureus уклоняться от опсонофагоцитоза и/или уменьшения вирулентности S. aureus по сравнению с терапией только антителом.

[00147] Комбинированная терапия (например, лечение или предупреждение с помощью нескольких антител) может обеспечить преимущество над индивидуальной терапией, затрагивая множество неперекрывающихся терапевтических целей S. aureus. Например, антитело, нацеленное на секретируемый токсин, может нейтрализовать вредные эффекты токсина, такие как гипервоспаление, индуцированное альфа-токсином. В то же время, совместно вводимое антитело, нацеленное на поверхностный антиген (например, IsdH), может ингибировать рост колоний и уклонение от опсонофагоцитоза у S. aureus, которые не изменяются под воздействием антитела, нацеленного на секретируемый токсин. Комбинированная терапия также может обеспечивать, чтобы терапия была эффективной против более широкого спектра штаммов или мутантов S. aureus, при этом у некоторых из них может отсутствовать антигенная цель для конкретного антитела.

[00148] В частности, комбинированная терапия может включать одно или несколько антител или их антигенсвязывающих фрагментов, которые специфично связываются с поверхностной детерминантой, такой как SdrC, SdrD, SdrE, ClfA, ClfB, IsdA, IsdB, IsdC, IsdE, IsdH или PNAG, и одно или несколько антител или их антигенсвязывающих фрагментов, которые связываются с секретируемым токсином, таким как альфа-токсин (AT). В конкретных вариантах осуществления комбинированная терапия может включать антитело или его антигенсвязывающий фрагмент, которые специфично связываются IsdH, и антитело или его антигенсвязывающий фрагмент, которые специфично связываются с AT; антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, и антитело или его антигенсвязывающий фрагмент, которые специфично связываются с AT; антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, и антитело или его антигенсвязывающий фрагмент, которые специфично связываются с AT; антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, и антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH; или антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA, и антитело или его антигенсвязывающий фрагмент, которые специфично связываются с AT. В конкретных вариантах осуществления комбинированная терапия может включать антитело или его антигенсвязывающий фрагмент, которые специфично связываются с IsdH, и антитело или его антигенсвязывающий фрагмент, которые специфично связываются с AT, при этом антитело к IsdH или его фрагмент содержат VH и/или VL или CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL mAb 2F4, а антитело к AT или его фрагмент содержат VH и/или VL или CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL mAb LC10 или содержат SEQ ID NO: 130 и SEQ ID NO: 131.

[00149] В конкретных вариантах осуществления антитела к AT или их антигенсвязывающие фрагменты могут содержать VH и/или VL или CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL любого из перечисленных в таблице 7 или 10 антител, антитела к IsdH или их антигенсвязывающие фрагменты могут содержать VH и/или VL или CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL любого из перечисленных в Таблице 12 антител, а антитела к ClfA или их антигенсвязывающие фрагменты могут содержать VH и/или VL или CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL любого из перечисленных в Таблице 14 антител.

[00150] В различных вариантах осуществления раскрываемые антитела, комбинации антител и/или комбинации антител и антибиотиков можно терапевтически вводить для лечения инфекции S. aureus, или в качестве профилактики для предупреждения инфекции. Например, комбинированную терапию можно назначить до хирургического вмешательства с целью предупреждения вызванного S. aureus осложнения, или после хирургического вмешательства, для лечения инфекции S. aureus, которая была приобретена в ходе хирургического вмешательства.

[00151] Также в настоящем документе предложены фармацевтические композиции для применения при лечении инфекций S. aureus или в качестве профилактики. В нескольких вариантах осуществления фармацевтическая композиция содержит по меньшей мере одно раскрываемое в настоящем документе антитело и фармацевтически приемлемый носитель. Выражение “фармацевтически приемлемый носитель” означает один или несколько нетоксичных материалов, которые не препятствуют эффективности или биологической активности активных ингредиентов. Такие препараты могут содержать соли, буферные средства, консерванты, совместимые носители и необязательно другие терапевтические средства. Такие фармацевтически приемлемые препараты также могут содержать совместимые твердые или жидкие наполнители, разбавители или инкапсулирующие вещества, которые пригодны для введения в организм человека. Выражение "носитель" обозначает органический или неорганический ингредиент, природный или синтетический, с которым объединяют активный ингредиент для облегчения фармацевтического применения.

[00152] Терапевтические композиции по настоящей методике можно составить с конкретной дозировкой. Схемы дозирования можно корректировать для обеспечения оптимального необходимого ответа (например, терапевтического ответа). Например, можно вводить однократный болюс, можно вводить несколько разделенных доз на протяжении некоторого периода или дозу можно пропорционально уменьшить или увеличить, что определяется потребностями терапевтической ситуации. В некоторых вариантах осуществления выбранная дозировка пригодна для внутривенной, внутримышечной, интраназальной, пероральной, местной или подкожной доставки. Количество активного ингредиента, которое может быть объединено с материалом-носителем для получения единичной лекарственной формы, будет варьировать в зависимости от субъекта, подлежащего лечению, и конкретного способа введения.

[00153] Также в настоящем документе раскрыт фармацевтический набор для терапевтического применения при лечении инфекции S. aureus или в качестве профилактики против такой инфекции. В некоторых вариантах осуществления набор включает одну или несколько емкостей, заполненных стерильным жидким терапевтическим составом или лиофилизированным составом, содержащим по меньшей мере одно раскрываемое в настоящем документе антитело или его антигенсвязывающий фрагмент и фармацевтически приемлемый носитель. В некоторых вариантах осуществления емкость, заполненная жидким составом, представляет собой предварительно заполненный шприц. В других вариантах осуществления емкость, заполненная стерильным лиофилизированным порошковым составом, пригодна для восстановления и последующего введения. В определенных вариантах осуществления составы содержат антитела и их антигенсвязывающие фрагменты, рекомбинантно гибридизированные или химически конъюгированные по меньшей мере с одним компонентом, в том числе без ограничения гетерологичным белком, гетерологичным полипептидом, гетерологичным пептидом, большой молекулой, малой молекулой, маркерной последовательностью, диагностическим или детектируемым средством, терапевтическим компонентом, лекарственным компонентом, ионом радиоактивного металла, вторым антителом и твердой подложкой. В определенных вариантах осуществления составы составляют во флаконах для однократной дозы в виде стерильных жидкостей. В некоторых вариантах осуществления состав поставляют в виде предварительно заполненного шприца.

J. Заболевания, связанные с инфекцией S. aureus

[00154] Раскрываемые в настоящем документе антитела и их антигенсвязывающие фрагменты можно применять для детекции, диагностики, предупреждения и/или лечения заболевания, связанного с инфекцией S. aureus. Антитела также можно применять для ослабления и/или предупреждения одного или нескольких симптомов, связанных с инфекцией S. aureus.

[00155] Также в настоящем документе предложен способ предупреждения, лечения или контроля пневмонии у субъекта, включающий введение композиции, которая включает выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинацию, нуждающемуся в этом субъекту в количестве, эффективном для предупреждения, лечения или контроля пневмонии.

[00156] Применяемые в настоящем документе выражения "лечить", “осуществлять лечение” или "лечение" могут относиться к терапевтическому лечению и профилактическим или предупредительным мерам, при которых целью является предупреждение или замедление (ослабление) нежелательного физиологического изменения или нарушения, такого как прогрессирование заболевания. Благоприятные или необходимые клинические результаты включают без ограничения ослабление симптомов, уменьшение степени заболевания, стабилизацию (т. е. отсутствие ухудшения) состояния заболевания, задержку или замедление прогрессирования заболевания, улучшение или облегчение состояния заболевания. "Лечение" может также означать увеличение выживаемости по сравнению с ожидаемой выживаемостью в том случае, если лечение не было получено. К тем, кто нуждается в лечении, относятся те, у кого уже есть состояние или нарушение, а также те, кто склонен иметь состояние или нарушение, или те, у кого нужно предупредить развитие состояния или нарушения.

[00157] Также в некоторых вариантах осуществления предложен способ предупреждения, лечения или контроля состояния, вызванного кожной инфекцией, у субъекта, включающий введение композиции, которая включает выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинацию по настоящему изобретению, нуждающемуся в этом субъекту в количестве, эффективном для предупреждения, лечения или контроля состояния, вызванного кожной инфекцией. В определенных вариантах осуществления состоянием, вызванным кожной инфекцией, является дерматонекроз. В некоторых вариантах осуществления состояние, вызванное кожной инфекцией, включает инфицирование кожи S. aureus. В определенных вариантах осуществления с помощью способа предупреждают состояние, вызванное кожной инфекцией.

[00158] В некоторых вариантах осуществления предложен способ предупреждения, лечения или контроля инфекции S. aureus, связанной с лечением диализом, хирургическим вмешательством с высоким риском, пневмонией, вентиляторно-ассоциированной пневмонией (VAP) или повторным инфицированием после предшествующей выписки из больницы при предыдущем лечении или хирургическом вмешательстве, который включает введение нуждающемуся в этом субъекту композиции, которая включает выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинации.

[00159] В некоторых вариантах осуществления также предложен способ предупреждения, лечения или контроля состояния, связанного с инфекцией S. aureus, который включает введение композиции, которая выделенное включает антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, нуждающемуся в этом субъекту в количестве, эффективном для снижения клеточного лизиса. В определенных вариантах осуществления с помощью способа предупреждают состояние, связанное с инфекцией S. aureus. В некоторых вариантах осуществления клетка представляет собой эритроцит из крови или легкого.

[00160] В данном документе предложены способы предупреждения или уменьшения тяжести сепсиса, связанного с S. aureus, у субъекта-млекопитающего, включающие введение субъекту эффективного количества выделенного антитела или его антигенсвязывающего фрагмента, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинации. Также предложены способы уменьшения бактериальной нагрузки S. aureus в кровотоке или сердце субъекта-млекопитающего, включающие введение субъекту эффективного количества выделенного антитела или его антигенсвязывающего фрагмента, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинации. Также предложены способы уменьшения агглютинации бактерий S. aureus и/или формирование очагов тромбоэмболического поражения у субъекта-млекопитающего, включающие введение субъекту эффективного количества выделенного антитела или его антигенсвязывающего фрагмента, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинации.

[00161] Способы предупреждения сепсиса, связанного с S. aureus, у субъекта-млекопитающего предпочтительно включают введение субъекту до события инфицирования эффективного количества выделенного антитела или его антигенсвязывающего фрагмента, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинации. Применяемое в настоящем документе выражение “событие инфицирования” относится к эпизоду, при котором субъект подвергается, или мог быть подвергнут, инфицированию S. aureus. Иллюстративные события инфицирования включают без ограничения хирургическое вмешательство на любой части тела, включая ротовую полость, кисти, руки, ноги, туловище, внутренние органы (например, сердце, головной мозг, кишечник, почки, желудок, легкие, печень, селезенку, поджелудочную железу и т. д.), кости, кожу. Хирургическое вмешательство обеспечивает условия, такие как открытые хирургические раны и органы, которые могут быть легко инфицированы S. aureus. Дополнительные события инфицирования включают травму любой части тела, при которой образуются открытые раны или иной доступ к кровотоку, посредством которого инфекция S. aureus может попасть в организм. Дополнительные события инфицирования включают гемотрансфузии, инъекции лекарственных препаратов или неразрешенных законодательством или разрешенных законодательством лекарственных средств, уколы иглой, иглами для татуажа, введение или присутствие внутривенных (IV) катетеров, введение и присутствие хирургических дренажей и наличие участков разрушения кожи, например, пролежней (декубитальных язв).

[00162] В вариантах осуществления, в которых способы обеспечивают предупреждения сепсиса, связанного с S. aureus, выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинацией, предпочтительно вводят по меньшей мере за 1 час до события инфицирования. Например, по меньшей мере за 1 час до хирургического вмешательства (события инфицирования). Предпочтительно, выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинацией, вводят по меньшей мере за 6 часов, по меньшей мере за 12 часов, по меньшей мере за 18 часов, по меньшей мере за 24 часа, по меньшей мере за 30 часов, по меньшей мере за 36 часов, по меньшей мере за 42 часа, по меньшей мере за 48 часов или раньше до события инфицирования. В вариантах осуществления выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинацией, предпочтительно вводят за от приблизительно 6 часов до приблизительно 36 часов, от приблизительно 6 часов до приблизительно 36 часов, от приблизительно 12 часов до приблизительно 36 часов, от приблизительно 12 часов до приблизительно 24 часов, от приблизительно 24 часов до приблизительно 36 часов, от приблизительно 20 часов до приблизительно 30 часов, от приблизительно 20 часов до приблизительно 28 часов, от приблизительно 22 часов до приблизительно 26 часов или приблизительно за 12 часов, приблизительно за 13 часов, приблизительно за 14 часов, приблизительно за 15 часов, приблизительно за 16 часов, приблизительно за 17 часов, приблизительно за 18 часов, приблизительно за 19 часов, приблизительно за 20 часов, приблизительно за 21 час, приблизительно за 22 часа, приблизительно за 23 часа, приблизительно за 24 часа, приблизительно за 25 часов, приблизительно за 26 часов, приблизительно за 27 часов, приблизительно за 28 часов, приблизительно за 29 часов, или приблизительно за 30 часов, или приблизительно за 31 час, или приблизительно за 32 часа, или приблизительно за 33 часа, или приблизительно за 34 часа, или приблизительно за 35 часов, или приблизительно за 36 часов до события инфицирования.

[00163] Применяемое в настоящем документе “предупреждение” сепсиса, связанного с S. aureus, относится к уменьшению риска возникновения у субъекта сепсиса, связанного с S. aureus, во время события инфицирования. Предпочтительно, риск возникновения у субъекта сепсиса, связанного S. aureus, уменьшается по меньшей мере на 30% по сравнению с субъектом, которому до события инфицирования не было введено выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинацией. Более предпочтительно, риск уменьшается по меньшей мере на 40%, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90% или риск полностью устраняется по сравнению с субъектом, которому до события инфицирования не было введено выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинацией.

[00164] В способах уменьшения тяжести сепсиса, связанного с S. aureus, у субъекта-млекопитающего, такие способы предпочтительно включают введение эффективного количества выделенного антитела или его антигенсвязывающего фрагмента, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus, или их комбинации, субъекту, у которого наблюдаются симптомы сепсиса, связанного с S. aureus. Такие симптомы могут включать, например, озноб, спутанность сознания или бред, лихорадку или низкую температуру тела (гипотермию), головокружение, обусловленное низким кровяным давлением, учащенное сердцебиение, тремор, кожную сыпь и горячие кожные покровы.

[00165] Применяемое в данном документе выражение “уменьшение тяжести” при применении по отношению к сепсису относится к уменьшению интенсивности симптомов, наблюдающихся у субъекта, у которого возник сепсис, ассоциированный с S. aureus. Предпочтительно, интенсивность симптомов уменьшается по меньшей мере на 30% по сравнению с интенсивностью симптомов, которые наблюдаются у субъекта, у которого также возник сепсис, ассоциированный с S. aureus, но при этом субъекту не были введены выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus или их комбинацией. Более предпочтительно, интенсивность симптомов уменьшается по меньшей мере на 40%, по меньшей мере на 50%, по меньшей мере на 60%, по меньшей мере на 70%, по меньшей мере на 80%, по меньшей мере на 90% или симптомы полностью устраняются (т. е. субъект излечивается от инфекции и сепсиса) по сравнению с субъектом, которому до события инфицирования не были введены выделенное антитело или его антигенсвязывающий фрагмент, которые иммуноспецифично связываются с токсином или поверхностной детерминантой S. aureus или их комбинацией.

[00166] Неограничивающие примеры некоторых общеизвестных состояний, вызванных инфекцией S. aureus, включают ожоги, флегмону, дерматонекроз, инфекции века, пищевое отравление, инфекции суставов, пневмонию, кожные инфекции, инфекцию послеоперационной раны, синдром ошпаренной кожи и синдром токсического шока. Кроме того, он является частым патогеном при инфекции, связанной с инородным телом, таким как внутрисосудистые катетеры, электрокардиостимуляторы, искусственные сердечные клапаны и протезы суставов. Ниже описаны некоторые из состояний или заболеваний, вызванных S. aureus. Некоторые или все из описанных ниже состояний и заболеваний могут включать непосредственное действие секретируемых токсинов в качестве составляющего инфекции или медиатора состояния или болезненного состояния, в то время как некоторые или все из состояний могут включать опосредованное или сопутствующее воздействие секретируемых токсинов (например, в качестве основных факторов вирулентности, которые вызывают главный симптом или большинство симптомов, связанных с состоянием, или в качестве средств, которые действуют как дополнительно усугубляющие заболевание вследствие нарушения клеточной функции или клеточного лизиса).

a) Ожоги

[00167] Ожоговые раны изначально зачастую стерильны. Однако, умеренные и тяжелые ожоги обычно повреждают физические и иммунные барьеры для инфекции (например, образование волдырей, растрескивание или шелушение кожи), вызывая потерю жидкости и электролитов, и приводят в результате к местной или общей физиологической дисфункции. Контакт поврежденной кожи с жизнеспособными бактериями может привести в результате к смешанной колонизации на участке повреждения. Инфекция может ограничиться нежизнеспособным дебрисом на поверхности ожога (“ожоговый струп”), или колонизация может развиться в глубокую кожную инфекцию и захватить жизнеспособные ткани ниже ожогового струпа. Более тяжелые инфекции могут проникать под кожу, попадать в лимфатическую систему и/или кровоток и развиваться в септицемию. S. aureus, как правило, обнаруживается среди патогенов, которые колонизируют инфекции ожоговых ран. S. aureus может уничтожать грануляционную ткань и являться причиной тяжелой септицемии.

b) Флегмона

[00168] Флегмона является острой инфекцией кожи, которая часто начинается как поверхностная инфекция, которая может распространяться под кожный слой. Флегмона чаще всего вызывается смешанной инфекцией S. aureus в сочетании с S. pyogenes. Флегмона может приводить к системной инфекции.

c) Дерматонекроз

[00169] Дерматонекроз является инфекцией кожи и подкожных тканей, легко распространяющейся по фасциальной плоскости в пределах подкожной ткани. Данное состояние приводит к тому, что верхние и/или нижние слои кожи некротизируются, и оно может распространяться на нижележащие и окружающие ткани.

d) Некротический фасцит

[00170] Некротический фасцит называют “плотоядной болезнью” или “синдромом плотоядных бактерий”. Некротический фасцит может быть вызван полимикробной инфекцией (например, I типа, вызываемой смешанной бактериальной инфекцией) или мономикробной инфекцией (например, II типа, вызываемой одиночным патогенным штаммом бактерий). Многие типы бактерий могут вызывать некротический фасцит, их неограничивающие примеры включают стрептококк группы А (например, Streptococcus pyrogenes), Staphylococcus aureus, Vibrio vulnificus, Clostridium perfringens и Bacteroides fragilis. Наиболее вероятно, дерматонекрозом (например, некротическим фасцитом) будут страдать лица с подавленной или поврежденной иммунной системой.

[00171] Первоначально, в качестве причины большинства случаев дерматонекротических инфекций II типа диагностировали стрептококк группы А. Однако, с 2001 года с возрастающей частотой наблюдали, что мономикробный некротический фасцит вызывает устойчивый к метициллину Staphylococcus aureus (MRSA). Инфекция начинается локально, иногда в месте травмы, которая может быть тяжелой (такая как результат хирургического вмешательства), незначительной или даже невидимой. Пациенты обычно жалуются на сильную боль, которая может казаться избыточной с учетом внешнего вида кожи. С развитием заболевания ткань становится припухшей, часто в пределах нескольких часов. Распространенным симптомами также являются диарея и рвота.

[00172] Признак воспаления может не быть заметен на ранних стадиях инфекции, если бактерии находятся глубоко в ткани. Если бактерии находятся неглубоко, быстро проявляются такие признаки воспаления, как покраснение и припухлость или горячая кожа. Цвет кожи может становиться фиолетовым, и могут образовываться волдыри с последующим некрозом (например, отмиранием) подкожных тканей. У пациентов с некротическим фасцитом, как правило, имеет место лихорадка или очень болезненный вид. Было отмечено, что при отсутствии лечения показатели смертности составляют вплоть до 73 процентов.

e) Пневмония

[00173] S. aureus также был выявлен как причина стафилококковой пневмонии. Стафилококковая пневмония вызывает воспаление и отек легкого, что, в свою очередь, вызывает скопление жидкости в легком. Скопление жидкости в легком может препятствовать попаданию кислорода в кровоток. Больные гриппом имеют риск развития бактериальной пневмонии. Staphylococcus aureus является наиболее распространенной причиной бактериальной пневмонии у больных, уже страдающих гриппом. Типичные симптомы стафилококковой пневмонии включают кашель, затрудненное дыхание и лихорадку. Дополнительные симптомы включают утомляемость, желтую или кровавую слизь и боль в груди, которая усиливается при дыхании. Устойчивый к метициллину S. aureus (MRSA) все чаще диагностируют как штамм, идентифицируемый при стафилококковой пневмонии.

f) Инфекции послеоперационных ран

[00174] Послеоперационные раны зачастую проникают глубоко в тело. Следовательно, при инфицировании раны инфекция таких ран представляет серьезную опасность для пациента. Зачастую возбудителем инфекций в послеоперационных ранах является S. aureus. S. aureus необычайно способен к проникновению в послеоперационные раны, раны с наложенными швами могут быть инфицированы гораздо меньшим количеством клеток S. aureus, чем необходимо для того, чтобы вызвать инфекцию нормальной кожи. Проникновение в послеоперационные раны может приводить к тяжелой септицемии, вызванной S. aureus. Проникновение S. aureus в кровоток может приводить к диссеминации и инфицированию внутренних органов, в частности сердечных клапанов и кости, вызывая системные заболевания, такие как эндокардит и остеомиелит.

g) Синдром ошпаренной кожи

[00175] S. aureus может являться главным возбудителем “синдрома ошпаренной кожи”, также называемого “стафилококковым синдромом ошпаренной кожи”, “токсическим эпидермальным некрозом”, “локализованным буллезным импетиго”, “болезнью Риттера” и “болезнью Лайела”. Синдром ошпаренной кожи часто встречается у подростков, как правило, при вспышках, вызванных развитием штаммов S. aureus, которые продуцируют эпидермолитические экзотоксины (например, эксфолиатин A и B, иногда называемый токсином синдрома ошпаренной кожи), который вызывает расслоение эпидермального слоя. Один из экзотоксинов кодируется бактериальной хромосомой, а другой кодируется плазмидой. Экзотоксины представляют собой протеазы, которые расщепляют десмоглеин-1, который в норме удерживает вместе гранулезный и шиповатый слои кожи.

[00176] Бактерии первоначально могут инфицировать только незначительный пораженный участок, однако токсин разрушает межклеточные соединения, распространяется по эпидермальным слоям и дает возможность инфекции проникать в наружный слой кожи, приводя к слущиванию, которое характеризует заболевание. Шелушение наружного слоя кожи обычно открывает нижележащую нормальную кожу, но при отсутствии соответствующего лечения потеря жидкости в процессе может вызывать тяжелое повреждение у детей младшего возраста.

h) Синдром токсического шока

[00177] Синдром токсического шока (TSS) вызывается штаммами S. aureus, которые продуцируют так называемый “токсин синдрома токсического шока”. Заболевание может быть вызвано инфекцией S. aureus в любом месте, но часто ошибочно рассматривается исключительно как заболевание сугубо женщин, которые используют тампоны. Заболевание включает токсемию и септицемию и может быть летальным.

[00178] Симптомы синдрома токсического шока варьируют в зависимости от первопричины. TSS, возникающий в результате инфицирования бактериями Staphylococcus aureus, как правило, проявляется у здоровых в других отношениях лиц сильной лихорадкой, сопровождаемой низким кровяным давлением, дискомфортом и спутанностью сознания, которое может быстро развиться в помрачение сознания, кому и мультиорганную недостаточность. Характерная сыпь, часто наблюдаемая на ранних стадиях течения заболевания, напоминает солнечный ожог и может затрагивать любую область тела, включая губы, рот, глаза, ладони и подошвы стоп. У пациентов, которые пережили первоначальный приступ инфекции, сыпь слущивается или отслаивается через 10-14 дней.

[00179] Как указано выше, вследствие возрастания количества устойчивых ко многим лекарственным средствам штаммов S. aureus, все большее количество антибиотиков, широко применявшихся для лечения инфекций S. aureus, больше не контролируют или устраняют инфекции устойчивых к метициллину и устойчивых ко многим лекарственным средствам Staphylococcus aureus. Описываемые в настоящем документе антитела к поверхностным детерминантам и секретируемым токсинам S. aureus могут помочь уменьшить тяжесть инфекции, а также могут способствовать устранению, предупреждению (профилактическому) или уменьшению количества патогенного S. aureus у инфицированного хозяина. Антитела также можно применять для детекции S. aureus и, в случае образца пациента, диагностики инфекций S. aureus.

K. Способы детекции S. aureus с применением антител или фрагментов, направленных против поверхностных антигенов или секретируемых токсинов S. aureus

[00180] В различных вариантах осуществления раскрываемые в настоящем документе антитела можно применять по-отдельности или в комбинации для детекции наличия в образце S. aureus.

[00181] В определенных вариантах осуществления способ включает приведение в контакт тестируемого образца с одним из раскрываемых в настоящем документе выделенных антител или фрагментов. Затем антитело или его антигенсвязывающий фрагмент связываются с поверхностным антигеном или секретируемым токсином S. aureus с образованием комплекса антиген-антитело. В дополнительных вариантах осуществления способ включает приведение в контакт комплекса антиген-антитело с детектируемой меткой, при этом сигнал, производимый детектируемой меткой, прямо коррелирует с наличием в образце S. aureus. Например, детектируемая метка может включать один или несколько флуоресцентных маркеров, которые связывают антитело или антиген в комплексе антитело-антиген таким образом, что увеличение флуоресценции коррелирует с повышенной концентрацией S. aureus или секретируемого токсина в образце.

[00182] В других вариантах осуществления детектируемая метка конкурирует с поверхностным антигеном или секретируемым токсином S. aureus за связывание с антителом или его антигенсвязывающим фрагментом, при этом сигнал, производимый детектируемой меткой, опосредованно коррелирует с концентрацией S. aureus или секретируемого токсина в образце. Например, детектируемая метка может включать один или несколько флуоресцентных маркеров, которые конкурируют с поверхностным антигеном или секретируемым токсином за связывание с антителом так, что снижение флуоресценции коррелирует с повышенной концентрацией S. aureus или секретируемого токсина в образце.

[00183] В определенных вариантах осуществления детектируемый сигнал, производимый детектируемой меткой в тестируемом образце сравнивают с сигналом по меньшей мере от одного контрольного образца с известной концентрацией антигена и антитела. В вариантах осуществления с применением контрольных образцов комплекс антитело-антиген детектируют в контрольном и тестируемых образцах с помощью детектируемой метки, и любая статистически значимая разница детектируемого сигнала среди образцов указывает на концентрацию, наличие или отсутствие S. aureus и/или секретируемого токсина в тестируемом образце.

[00184] В других вариантах осуществления для детекции S. aureus в образце применяют комбинацию антител. В различных вариантах осуществления способ включает приведение в контакт тестируемого образца с выделенным антителом или его антигенсвязывающим фрагментом, направленным против поверхностного антигена S. aureus, и выделенным антителом или его антигенсвязывающим фрагментом, направленным против секретируемого токсина S. aureus. Затем комбинация антител или фрагментов связывается с поверхностным антигеном S. aureus и секретируемым токсином с образованием двух комплексов антиген-антитело. В дополнительных вариантах осуществления способ включает приведение в контакт тестируемого образца, содержащего комплексы антиген-антитело, по меньшей мере с одной детектируемой меткой, при этом сигнал, производимый детектируемой меткой(ами), прямо коррелирует с наличием в образце S. aureus. Например, детектируемая метка(метки) может включать один или несколько флуоресцентных маркеров, которые связывают антитело или антиген по меньшей мере в одном из комплексов антитело-антиген таким образом, что увеличение флуоресценции коррелирует с повышенной концентрацией S. aureus и/или секретируемого токсина в образце.

[00185] В других вариантах осуществления по меньшей мере одна детектируемая метка конкурирует с поверхностным антигеном и/или секретируемым токсином S. aureus за связывание с комбинацией антител или фрагментов. Сигнал, производимый детектируемой меткой(ами), таким образом, опосредованно коррелирует с концентрацией S. aureus в образце. Например, детектируемая метка(метки) может включать в себя в себя один или несколько флуоресцентных маркеров, которые конкурируют с поверхностным антигеном и/или секретируемым токсином за связывание с антителом так, что снижение флуоресценции коррелирует с повышенной концентрацией S. aureus и/или секретируемого токсина в образце.

[00186] В определенных вариантах осуществления детектируемые сигналы, производимые детектируемыми метками в тестируемом образце, сравнивают с сигналом по меньшей мере от одного контрольного образца с известными концентрациями антигенов и антител. В вариантах осуществления с применением контрольных образцов комплексы антитело-антиген детектируют в контрольном и тестируемых образцах с помощью детектируемых меток, и любая статистически значимая разница детектируемых сигналов среди образцов указывает на концентрацию, наличие или отсутствие S. aureus и/или секретируемого токсина в тестируемом образце.

[00187] В определенных вариантах осуществления способ детекции применяют для детекции наличия S. aureus в образце пациента, и способ дополнительно включает диагностику пациента с инфекцией S. aureus. В некоторых вариантах осуществления способ адаптируют для применения в автоматической или полуавтоматической системе.

[00188] В определенных вариантах осуществления также предложены наборы, содержащие по меньшей мере одно раскрываемое в настоящем документе антитело или его антигенсвязывающий фрагмент, которые пригодны в целях различных исследований и диагностики. Например, наборы можно применять для детекции S. aureus в образце или для иммунопреципитации секретируемого токсина S. aureus. С целью выделения и очистки набор может содержать антитело или его антигенсвязывающий фрагмент, связанные с гранулой (например, гранулами сефарозы).

[00189] В настоящей заявке применение формы единственного числа включает форму множественного числа, если специально не указано иное. Также в настоящей заявке применение “или” означает “и/или”, если не указано иное. Более того, применение выражения “включающий”, а также других форм, таких как “включает” и “включен”, не является ограничивающим. Любой описываемый в настоящем документе диапазон необходимо понимать как включающий конечные точки и все значения между конечными точками.

[00190] Используемые в настоящем документе заглавия разделов предназначены лишь для организации и не должны пониматься как ограничивающие описываемый объект. Все упоминаемые в настоящей заявке документы или части документов, включая без ограничения патенты, патентные заявки, статьи, книги и монографии, таким образом, непосредственно включены в настоящее описание с помощью ссылки в их полном объеме с любой целью. До той степени, до которой публикации и патенты или патентные заявки, включенные с помощью ссылки, противопоставлены настоящему изобретению, изложенному в настоящем описании, до той же степени настоящее описании будет преобладать над любым противопоставляемым материалом.

Примеры

[00191] Приведенные далее примеры служат для иллюстрации и никоим образом не для ограничения настоящего раскрытия.

Пример 1 - Материалы и способы

[00192] Далее приведены материалы и способы, используемые для примера 2 - примера 9.

Нейтрализация гемолитической активности

[00193] Пятьдесят микролитров супернатанта каждой культуры гибридом В-клеток смешивали с рекомбинантным альфа-токсином-His (rAT-his, с конечной концентрацией 0,1 мкг/мл) в 96-луночных планшетах с последующим добавлением 50 мкл 5% красных кровяных телец (RBC) кролика в PBS. Контрольные лунки содержали только RBC и культуральные среды с AT или без него. Планшеты инкубировали в течение 1 часа при 37°C, а интактные клетки осаждали центрифугированием. 50 мкл супернатантов переносили в новый 96-луночный планшет и измеряли A490 в спектрофотометре. Нейтрализующую активность рассчитывали относительно лизиса с RBC и rAT-his по отдельности следующим образом: % ингибирования = 100×[100-(A490 nAT+ Ab) /(A490 nAT без Ab)].

[00194] Также тестировали ингибирование очищенных mAb. MAb к AT добавляли в 96-луночный планшет в количестве 80 мкг/мл в PBS и производили последовательное разведение образцов (двукратное) в PBS до конечного объема 50 мкл. В качестве изотопического контроля включали неспецифический IgG1 (R347). Двадцать пять микролитров разведений mAb смешивали с 25 мкл nAT (нативный альфа-токсин) с концентрацией 0,1 мкг/мл в 96-луночных круглодонных планшетах с последующим добавлением 50 мкл 5% RBC. Ингибирование гемолитической активности рассчитывали как описано выше.

Нейтрализация лизиса A549

[00195] Клетки A549 хранили в 5% CO2 37°C термостате в RMPI, дополненной неосновной аминокислотой, глутамином и 10% эмбриональной бычьей сыворотки. Клетки один раз промывали сбалансированной средой Хенка и высеивали в количестве 104/лунка в 50 мкл RPMI, 5% FBS, и инкубировали при 37°C с 5% CO2 в течение 20 часов. MAb к AT добавляли в 96-луночный планшет в концентрации 80 мкг/мл в RPMI и производили последовательное разведение образцов (двукратное) в RPMI. Несоответствующий IgG1 (R347) включили в качестве изотопического контроля. В отдельном 96-луночном планшете 30 мкл разведенных антител смешивали с 30 мкл nAT (с конечной концентрацией 5 мкг/мл). Пятьдесят микролитров из каждой лунки переносили в планшет, содержавший прикрепленные клетки A549. Включали контрольные лунки клеток A549 с nAT или без него. Планшеты инкубировали при 37°C с 5% CO2 в течение 3 часов, центрифугировали и 50 мкл супернатанта переносили в новый 96-луночный планшет. Клеточный лизис измеряли как высвобождение лактатдегидрогеназы (LDH) с применением набора для нерадиоактивного анализа Cytotox 96 (Promega), следуя протоколу производителя. Фоновую LDH вычитали из каждой лунки и рассчитывали ингибирование высвобождения LDH: % ингибирования = 100×[100-(A590 nAT+ Ab)/(A590 nAT без Ab)].

Нейтрализация лизиса THP-1

[00196] Клетки THP-1 хранили в 5% CO2, 37°C термостате в RPMI среде (Invitrogen), дополненной неосновными аминокислотами (Invitrogen), 2 мМ глутамином (Invitrogen) и 10% эмбриональной бычьей сыворотки (Invitrogen). MAb к AT добавляли в 96-луночный планшет в количестве приблизительно 80 мкг/мл в RPMI и производили последовательное разведение образцов (двукратное) в RPMI до конечного объема 50 мкл. Несоответствующий IgG1 (R347) включили в качестве изотопического контроля. Двадцать пять микролитров разведений mAb смешивали с 25 мкл нативного альфа-токсина (nAT) с конечной концентрацией 1,5 мкг/мл с последующим добавлением 50 мкл клеток THP-1, промытых RMPI (106 клеток/мл в RPMI с 10% FBS) в 96-луночном планшете. Контрольные лунки заключали в себе только клетки THP-1 или с nAT. Планшеты инкубировали в 5% CO2, при 37°C в термостате в течение 3 часов, центрифугировали и 50 мкл супернатанта переносили в новый 96-луночный планшет. Клеточный лизис измерили как высвобождение лактатдегидрогеназы (LDH) с применением набора для нерадиоактивного анализа Cytotox 96 (Promega), следуя протоколу производителя. Ингибирование высвобождения LDH рассчитывали как описано выше.

Мышиная модель пневмонии

[00197] За двадцать четыре часа до инфицирования группы из десяти 7-9 недельных мышей C57BL/6J (Harlan) получали 0,5 мл mAb в указанных концентрациях посредством внутрибрюшинной инъекции. Животных затем анестезировали при помощи изофлурана, удерживали вертикально и в левую и правую ноздри привили 0,05 мл бактериальной суспензии S. aureus (1×108 КОЕ - 3×108 КОЕ) в стерильном PBS. Животных размещали в клетке в положении лежа на спине для восстановления и наблюдали два раза в день в течение курса исследования. Выживание животных отслеживали в течение максимум 6 дней.

[00198] Альтернативно, животных подвергали эвтаназии путем ингаляции CO2 через 48 часов после инфицирования бактериями. Забирали легкое и почку в стерильный PBS, гомогенизировали, разводили и высеивали для подсчета бактерий. Статистическую значимость исследований смертности определяли с помощью логарифмического рангового критерия. Значимость выделения бактерий из органов рассчитывали с помощью дисперсионного анализа и апостериорного критерия Даннетта.

Мышиная модель дерматонекроза

[00199] Мышам из групп пяти 6-8 недельных самок BALB/c (Harlan) брили их спины и вводили путем внутрибрюшинной инъекции 0,5 мл IgG в концентрации, указанной на графике. Двадцать четыре часа спустя мышей инфицировали при помощи подкожной инъекции 50 μмкл бактериальной суспензии (1×108 S. aureus). Животных отслеживали два раза в день в отношении признаков инфекции и размера абсцесса, измеряемого ежедневно в одно и то же время. Площадь пораженных участков рассчитывали с помощью формулы A=L×W. Статистическую значимость определяли с помощью дисперсионного анализа и апостериорного критерия Даннетта.

Мышиная модель сепсиса

[00200] Приготовление дозы для контрольного заражения бактериями: Штамм SF8300 S. (USA300) aureus получали от Binh Diep (Калифорнийский университет в Сан-Франциско). Бактерии культивировали в течение ночи при 37°C в 50 мл триптического соевого бульона (TSB) с перемешиванием при 250 об./мин. Десять мл из суточной культуры добавляли к 1 л свежего TSB, и выращивали бактерии при 37°C с перемешиванием до оптической плотности 0,8 при 600 нм (OD600). Бактерии извлекали посредством центрифугирования на скорости 8000 об./мин. в течение 15 мин. при 4°C и промывали в фосфатно-солевом буфере (PBS). Бактерии собирали посредством центрифугирования и ресуспендировали в PBS с 10% глицерином до конечной концентрации бактерий в исходном растворе ~2×1010 CFU/мл.

[00201] Контрольное заражение и выживаемость мышей: мышам BALB/c в группах из десяти самок в возрасте 8-9 недель внутрибрюшинно (IP) инъецировали LC10 в указанных концентрациях или mAb R347 (45 мг/кг) в 500 мкл PBS. Животных через 24 ч. подвергали контрольному заражению путем внутривенного (IV) введения в хвостовую вену 200 мкл бактериальной суспензии (5×107 CFU, разбавленных в PBS, pH 7,2, из замороженного исходного раствора). Отслеживали выживаемость мышей в течение 14 дней после контрольного заражения. Статистический анализ проводили с применением логарифмического рангового критерия: животные, иммунизированные с помощью R347 (контроля), по сравнению с животными, иммунизированными с помощью LC10 (Ab к АТ).

[00202] Бактериальная нагрузка в сердце: инфицированных мышей умерщвляли при помощи CO2 через 14 ч. после инфицирования. Сердце удаляли, гомогенизировали в пробирках с лизирующей матрицей A в 1 мл холодного PBS и высеивали на чашки с TSA для подсчета бактерий. Бактериальную нагрузку в ткани сердца анализировали путем попарного сравнения mAb R347 и LC10 с помощью непарного двустороннего t-критерия Стьюдента. Данные считали значимыми, если p<0,05.

[00203] Бактериальная нагрузка в крови: животных умерщвляли при помощи CO2 через 8, 24, 48, 72 и 144 ч. после инфицирования. Кровь собирали посредством пункции сердца и 100 мкл незамедлительно высевали на чашку с TSB для подсчета CFU. Данные анализировали при помощи непарного t-критерия Стьюдента. Значения для mAb LC10 и R347 считали статистически различными, если p<0,05.

Анализ связывания с рецептором

[00204] “Тени“ красных кровяных телец получали путем инкубирования 5 мл промытых и упакованных красных кровяных телец кролика (RBC) в 500 мл буфера для лизиса (5 мМ фосфат, 1 мМ EDTA, pH 7,4) в течение ночи при 4°C с постоянным помешиванием. Затем “тени“ удаляли путем центрифугирования при 15000×g и промывали 3× буфером для лизиса. Затем их промывали в PBS и ресуспендировали в конечном объеме 3 мл.

[00205] Для оценки связывания nAT с мембранами клеток “тени“ RBC разводили до OD600, равной примерно 0,2, в PBS и 50 мкл наносили на ½-лунки 96-луночных планшетов (Costar) и инкубировали в течение ночи при 4°C. Затем жидкость удаляли из планшетов и лунки блокировали посредством 100 мкл 1% BSA в PBS, pH 7,4 в течение 2 часов при 4°C и промывали 3x посредством PBS. 20-молярный избыток IgG смешивали с nAT в концентрации 3 мкг/мл и 50 мкл добавляли в заблокированные планшеты. Планшеты инкубировали при 4°C в течение 2 часов и промывали 3× посредством PBS. Меченный биотином IgG кролика к AT добавляли в лунки в концентрации 1 мг/мл и инкубировали при 4°C в течение 1 часа, промывали 3× и инкубировали с конъюгатом пероксидазы и стрептавидина (1:30000, Jackson Immunoresearch). Лунки промывали 3x и проявляли посредством Sure Blue Reserve (KPL, Inc.). A450 считывали с помощью планшетного ридера (Molecular Devices) и рассчитывали % связанного AT. % связанного AT = 100×(A450-AT+IgG/A450 - только AT).

Измерение констант скорости реакции и связывания (KD)

[00206] Константы скорости реакции (kon, koff) связывания IgG-антител к АТ с очищенным nAT измеряли с использованием формата анализа с IgG-захватом на приборе BIAcore 3000 (BIAcore, Inc). Если кратко, то IgG крысы к антителу мыши иммобилизировали на сенсорном чипе CM5 согласно инструкциям производителя. Конечная поверхностная плотность захватывающего реактива на сенсорном чипе составляла примерно 2500 единиц ответа (RU), которые описаны в настоящем документе. Также на данном сенсорном чипе получали эталонную поверхность проточной ячейки с использованием идентичного протокола иммобилизации и исключением nAT. Готовили IgG-антитела к АТ в 20 нМ в буфере для прибора (HBS-EP буфер, содержащий 0,01 M HEPES, pH 7,4, 0,15 M NaCl, 3 мМ EDTA и 0,005% P-20), а также двукратные последовательные разведения nAT. Последовательные разведения nAT выполняли в диапазоне от приблизительно 0,78 нМ до приблизительно 50 нМ в буфере для прибора.

[00207] Для кинетических измерений использовали последовательный подход. Каждый IgG к AT сначала инъецировали на поверхность захвата и эталонную поверхность со скоростью потока 50 мкл/мин. После стабилизации связывания захваченного IgG, однократную концентрацию белка nAT инъецировали на обе поверхности со скоростью потока 50 мкл/мин. Полученные кривые реакции связывания использовали для получения данных по фазе ассоциации. Затем, после введения nAT, поток переключали назад на буфер для прибора на 10 минут для того, чтобы сделать возможным сбор данных по фазе диссоциации, с последующей 1-минутной подачей 10 мМ глицина, pH 1,5, для регенерации на чипе поверхности захвата IgG. Реакции связывания в результате повторных введений каждой концентрации nAT регистрировали ко всем IgG к AT.

[00208] Кроме того, в ходе серии введений делали вразброс несколько введений буфера. Избранные введения буфера использовали вместе с ответами эталонной ячейки для корректировки наборов необработанных данных в отношении артефактов введений и/или взаимодействий, вызванных неспецифическим связыванием, обычно называемых “двойной контроль” (D.G. Myszka, Improving biosensor analysis. J. Mol. Recognit. 12 (1999), pp. 279-284). Полностью скорректированные данные связывания затем в целом согласовали 1:1 с моделью связывания (программное обеспечение BIAevaluation 4.1, BIAcore, Inc, Уппсала, Швеция) с включением параметра для коррекции ограниченного переносом массы связывания, которое подлежит выявлению. С помощью этих анализов определяли константы (on, off) скорости реакции, из которых затем рассчитывали кажущуюся KD в виде koff/kon.

Измерение уровней цитокинов в инфицированных S. aureus легких

[00209] Семи-девятинедельных мышей C57BL/6J обрабатывали посредством 2A3.1hu (полностью человеческий 2A3.1) или R347 (45 мг/кг) путем внутрибрюшинной инъекции за 24 часа до интраназальной инфекции 1,5×108 CFU USA300 (BAA-1556, ATCC). Через четыре и двадцать четыре часа после инфицирования мышей подвергали эвтаназии и легкие 3× промывали посредством 1 мл PBS. Бронхоальвеолярную смывную жидкость (BAL) хранили при -70°C. Провоспалительные цитокины оценивали с использованием набора для определения провоспалительных цитокинов у мышей 7 pro-inflammatory II mouse cytokine kit (Mesoscale, Гейтерсберг, Мэриленд) согласно инструкциям производителя. Уровни цитокинов выражали в виде пг/мл.

Дот-блот анализы

[00210] Синтезировали химическим методом (New England Peptide) перекрывающиеся пептиды, охватывающие аминокислоты 40-293. Осуществляли попытку синтеза AT1-50, но безуспешно. Альфа-токсин (AT), пептиды AT и фрагменты AT (1 мкг) наносили в виде точек на нитроцеллюлозу и блокировали 10 минут посредством блокирующего казеина в PBS. Затем блоты зондировали посредством 2 мкг/мл отдельного IgG в течение 3 часов при комнатной температуре. Блоты промывали и инкубировали с щелочной фосфатазой, конъюгированной с IgG козы к антителу мыши или IgG козы к антителу кролика (1:1000, Caltag Laboratories), в течение 1 часа и проявляли с применением мембранной субстратной системы для фосфатазы BCIP/NBT (KPL, Inc).

Пример 2 - Отбор и проверка мишеней

[00211] Тринадцать поверхностных антигенов и четыре секретируемых токсина отбирали для проверки в качестве мишеней для антител, исходя из их консервативности среди клинических изолятов и/или опубликованной активности вакцины. В данную группу включали альфа-токсин и три растворимых модулина (PSM). Также включали 8 заякоренных на клеточной стенке стафилококка антигенов/адгезинов. У пяти из отобранных мишеней были гомологи в S. aureus и S. epidermidis. Эти мишени вовлечены в усвоение питательных веществ, образование биопленки и клеточное деление. Антитела к альфа-токсину использовали в качестве предполагаемого способа уменьшения или нейтрализации активностей токсинов, таких как повреждение тканей и дисрегуляция иммунной системы. Также в качестве мишеней использовали поверхностные детерминанты S. aureus (IsdH, SdrC, ClfB, ClfA и IsdB), которые важны для колонизации, ускользания от иммунологического надзора и приспособляемости S. aureus. Потенциальный подход, рассматриваемый для улучшения терапии антителами, включал объединение опсонических и токсин-нейтрализующих моноклональных антител.

[00212] Антитела, вырабатываемые против указанных мишеней, собирали как в in vitro, так и в in vivo анализах для уменьшения вирулентности и/или уменьшения колонизации и ускользания от иммунологического надзора. Также оценивали целевую приспособляемость посредством активной/пассивной иммунизации в мышиных моделях инфекции.

Пример 3 - Выявление антител к IsdH

[00213] Основной выявляемой мишенью была железо-регулируемая поверхностная детерминанта H (IsdH) S. aureus. IsdH содержит петлю из 7 аминокислот между B1b и B2 β-листов и эта петля из 7 аминокислот является консервативной у нескольких членов семейства железо-регулируемых поверхностных детерминант, в том числе IsdA и IsdB. Мутации в данной петле из 7 аминокислот уменьшают способность S. aureus связывать гемоглобин более чем в 100 раз, а также ослабляет способность S. aureus уклоняться от фагоцитарного киллинга. Visai et al., J. Microbiology, 155(3): 667-679 (2008).

[00214] Моноклональные антитела к IsdH (mAB) выявляли с помощью мышей VelocImmune® (Regeneron Pharmaceuticals) и фагового пэннинга (библиотеки Dyax или CAT). Очищали 59 антител IgG (29 из библиотек Dyax, 16 из библиотек CAT и 14 из мышей VelocImmune).

Пример 4 - Каскад скрининга mAB к IsdH

[00215] Выявленные mAB к IsdH оценивали с помощью ELISA для цельноклеточного связывания S. aureus in vitro. Антитела также подвергали скринингу с помощью ELISA в отношении ингибирования связывания гаптоглобина S. aureus. Затем антитела оценивали в анализе опсонофагоцитирующего киллинга (OPK) (описанном ниже). Выявляли одиннадцать антител IgG к IsdH, которые обладали опсонической активностью в отношении 4 изолятов S. aureus. Пять антител к IsdH эффективно связывали S. aureus после засева in vivo в мышиной модели инфекции (описанной ниже). Эти пять лучших mAB к IsdH (3 из библиотек Dyax и 2 из библиотек CAT) отбирали для промышленного получения антитела, тестирования аффинности и последующего тестирования in vivo. Тестирование in vivo включало исследования в модели бактериемии (описанной ниже). Антитело 2F4 значительно уменьшало CFU в модели бактериемии. Затем пять антител характеризовали и оценивали в отношении применения в комбинированной терапии.

[00216] Анализ опсонофагоцитирующего киллинга (OPK) включал объединение 10 мкл S. aureus (106 клеток/мл), 10 мкл моноклонального антитела и 60 мкл DMEM плюс 0,1% желатина. Раствор инкубировали в течение 30 минут при 4°C. Спустя 30 минут добавляли 10 мкл клеток промиелоцитарного лейкоза человека (HL-60) в количестве 107 клеток/мл вместе с 10 мкл сыворотки крови человека, предварительно абсорбированной по S. aureus. В момент времени T0 высеивали 10 мкл раствора, а затем инкубировали при 37°C с перемешиванием на скорости 1500 об./мин. в течение 60 минут. В момент времени T60 клетки HL-60 лизировали при помощи 1% сапонина, повторно высеивали и определяли концентрацию CFU. Процентную долю OPK рассчитывали следующим образом: 100×(1- (T60/T0)), где T60 относится к концентрации CFU в конце анализа (т. е., через 60 минут), а T0 относится к концентрации CFU в начале анализа.

[00217] Выявляли 11 моноклональных антител к IsdH, которые обладали достаточной опсонической активностью к 4 изолятам S. aureus для проведения на них дополнительного исследования. На фигуре 19 проиллюстрировано, что антитела B11, 2F4 и A7 характеризовались повышенной процентной долей OPK по сравнению с контрольным антителом R347, при тестировании на штаммах S. aureus Newman и USA300.

[00218] Для определения того, экспрессировались ли антигены, которые были мишенями для антител у S. aureus in vivo, оценивали связывание антител после засева in vivo у мыши. Мышам внутрибрюшинно вводили провокационную пробу примерно 5x108 CFU S. aureus. Спустя 1-6 часов мышей обескровливали, а кровь объединяли в ледяном цитрате. Эукариотические клетки лизировали при помощи 1% NP-40. Лизированные клетки промывали три раза фосфатно-солевым буферным раствором (PBS) и обрабатывали ультразвуком с последующим ресуспендированием бактерий S. aureus в буфере (примерно 0,5-10×106 CFU восстанавливались после лизиса и ресуспендирования). В клеточные лизаты вводили антитела к IsdH и оценивали связывание антител по окрашиванию и результатам FACs-сортинга.

[00219] Пять из одиннадцати mAB к IsdH (обозначенные 1C1, 2F4, A7, IsdH003 и IsdH0016) связывали S. aureus после засева in vivo. На фигуре 2 показано связывание антител B11, 2F4, A7 и 1C1 по сравнению с контрольным антителом R347, у штаммов ARC2081 и USA300 S. aureus. На фигуре показано, что антитела 2F4, A7 и 1C1 связывали S. aureus ex vivo.

[00220] Два из пяти mAB к IsdH (1C1 и 2F4) также конкурировали с гаптоглобином (Hp) за связывание с IsdH, в то время как другие не конкурировали. На фигуре 3 показано, что антитело 1C1 конкурирует с Hp за связывание с субъединицей Neat-1 на IsdH. Повышение концентраций 1C1 (в мкг/мл) коррелировало с уменьшением связывания Hp с IsdH по сравнению со связыванием Hp в присутствии контрольного антитела R347. Аналогично, на фигуре 3 показано, что антитело 2F4 конкурирует с Hp за связывание с субъединицей Neat-2 на IsdH. Повышение концентраций 2F4 (в мкг/мл) коррелировало с уменьшением связывания Hp с IsdH по сравнению со связыванием Hp в присутствии контрольного антитела R347.

[00221] Для оценки того, были ли антитела 1C1, 2F4, A7, IsdH003 и IsdH0016 эффективны при введении in vivo, использовали мышиную модель бактериемии. Мышам внутрибрюшинно инъецировали моноклональное антитело в количестве 45, 15 или 5 мг/кг, а затем их оставляли на ночь для восстановления. На следующий день мышам внутрибрюшинно вводили инъекцией примерно 108 CFU S. aureus (штамм Newman). Спустя примерно 4 часа кровь оценивали в отношении концентрации CFU, измеренной как log[CFU/мл]. На фигуре 4 показано, что антитела 1C1, A7, IsdH003 и IsdH0016 не снижали концентрацию CFU в модели бактериемии. Тем не менее, на фигуре 5 показано, что антитело 2F4 действительно снижало концентрацию CFU в мышиной модели бактериемии.

[00222] Антитело 2F4 дополнительно оценивали в отношении ex vivo связывания с различными штаммами S. aureus. Антитело связывалось с 23 из 25 изолятов S. aureus после in vivo засева и выделения у мыши. На фигуре 6 проиллюстрировано связывание 2F4 у штаммов ARC2379 (USA100), ARC2081 (USA200) и BAA-1556 (USA 300). В приведенной ниже таблице проиллюстрированы результаты экспериментов по связыванию после засева in vivo 25 штаммов S. aureus у мыши.

Связывание антитела 2F4 после in vivo засева штаммов S. aureus

[00223] Также антитело 2F4 оценивали в ОРК-анализах, включающих клинические изоляты S. aureus - Newman, ARC634 (USA100), ARC2081 (USA200) и BAA-1556 (USA300). На фигуре 7 показано, что 2F4 обладало опсонической активностью к основным клиническим изолятам S. aureus.

[00224] Затем 2F4 оценивали в отношении аффинности к IsdH и к субъединице Neat-2 в анализе захвата hu lgGFc. По средней аффинности, усредненной для трех экспериментов, находили KD для IsdH, равную 3,66 нМ, и KD для Neat-2, равную 2,57 нМ. Фигура 8.

Пример 5 - Комбинированная терапия с антителами к IsdH и к AT

[00225] Альфа-токсин и IsdH играют различные роли в ходе патогенеза после инфицирования S. aureus. Первый является секретируемым токсином, в то время как второй является поверхностным белком, важным для колонизации, ускользания от иммунологического надзора и бактериальной приспособляемости. Оба могут дифференциально экспрессироваться во время инфекции S. aureus. Комбинирование моноклональных антител с различными способами воздействия может потенциально дать аддитивный или синергетический эффекты, в то же время уменьшая риск, что штамм будет уклоняться от терапии.

[00226] 2A3, антитело к альфа-токсину, оценивали в отношении применения в комбинации с 2F4, антителом к IsdH. При введении в комбинации антитела 2A3 и 2F4 демонстрировали синергетические эффекты в модели нагрузки органа. На фигуре 9 показано, что распределение в почке штамма USA300 S. aureus уменьшалось в присутствии обоих антител по сравнению с любым антителом в отдельности или по сравнению с контрольным антителом R347.

[00227] Результаты данных экспериментов с комбинированной терапией позволяли предположить, что может быть эффективен комбинированный подход к профилактике или лечению S. aureus.

Пример 6 -mAb к ClfA ингибировали связывание ClfA

[00228] mAb к ClfA ингибировали связывание ClfA с иммобилизированным фибриногеном in vitro. Сообщали, что ClfA в качестве фактора вирулентности способствовали связыванию S. aureus с фибриногеном, присутствовавшим в плазме крови. Это в результате приводило к агглютинации бактерий в крови.

[00229] Оценивали способность трех mAb к ClfA, полученных с помощью технологии гибридом с В-клетками, ингибировать связывание ClfA с иммобилизированным фибриногеном. Антитело R347 применяли в качестве отрицательного контроля. Активность каждого mAb к ClfA в данном анализе рассчитывали при IC50, концентрации, необходимой для инициирования 50% ингибирования связывания. Как показано на фигуре 10, помимо IC50 каждого антитела, антитела к ClfA ингибировали связывание ClfA с иммобилизированным фибриногеном.

Пример 7 - mAb 11H10 к ClfA ингибировало агглютинацию S.aureus в плазме крови человека с тремя различными клиническими изолятами.

[00230] Для оценки агглютинации S. aureus в плазме крови человека бактерии инкубировали с каждым mAb к ClfA и визуально изучали агрегирование бактерий после 3 минутной инкубации при 37°C. Для более точного сравнения активности mAb в данном анализе сравнивали при минимальной концентрации, необходимой для ингибирования агглютинации. 11H10 был более эффективным, чем 27H4 или 23D6 (фигура 11). Дополнительно проводили эксперименты по агглютинации с тремя различными клиническими изолятами, и 11H10 демонстрировал ингибирование в отношении данных трех изолятов по сравнению с двумя другими mAb к ClfA, которые охватывали один или два штамма.

Пример 8 - Связывание с эпитопом для 11H10

[00231] В связи с отличающимися характеристиками 11H10 в сравнении с 23D6 и 27H4, как обсуждалось ранее, дополнительно исследовали его характеристики связывания. Конкурентное связывание с эпитопом проводили с помощью системы Octet для оценки того, связывается ли 11H10 с отличным эпитопом, нежели 23D6 и 27H4. Как видно на фигуре 12, 23D6 и 27H4 конкурировали за связывание с ClfA, что позволяло предположить, что они могли иметь общий участок для связывания на ClfA. Тем не менее, конкуренция между 11H10 и 23D6 или 11H10 и 27H4 отсутствовала, что демонстрировало, что эпитоп 11H10 на ClfA отличался по сравнению с 23D6 и 27H4.

Пример 9 - Пассивная иммунизация посредством mAb 11H10 к ClfA демонстрировала эффективность в модели летального IV заражения

Бактериальная нагрузка в сердце

[00232] Для тестирования того, происходила ли агглютинация стафилококков in vivo, мышей сначала заражали в хвостовую вену изолятом USA300 и регистрировали количество бактерий в сердце спустя 14 часов после инфицирования. Как показано на фигуре 13, профилактическое внутрибрюшинное введение mAb к ClfA 11H10 (IP) в количестве 45 мг/кг приводило в результате к значительному снижению cfu бактерий в сердце (p=0,031). Оно было дозозависимым, поскольку 11H10 в количестве 15 мг/кг лишь слегка уменьшало бактериальную нагрузку в сердце по сравнению с отрицательным контролем R347.

Выживаемость

[00233] Сублетальную дозу USA300 для IV заражения определяли как индуцирующую 20% выживаемость спустя 2 недели. В данной модели исследовали способность mAb 11H10 к ClfA повышать выживаемость животных. На фигуре 14 показано, что введение инъекцией 11H10 приводило в результате к значимому повышению выживаемости (p=0,0114 при 45 мг/кг и p=0,0239 при 15 мг/кг) спустя 2 недели после инфицирования.

Пример 10 - Эффективность комбинации mAb 11H10 к ClfA и Ab LC10 к AT в модели летального IV заражения

[00234] Шестинедельных самок мышей BALB/c пассивно внутрибрюшинно (IP) иммунизировали посредством mAb в указанных концентрациях (разведенных в 500 мкл PBS) и спустя 24 часа внутривенно (IV) заражали LD20 дозой бактерий в хвостовую вену (в 200 мкл PBS). Выживаемость отслеживали до 14 дней после инфицирования.

[00235] Данные анализировали с помощью логарифмического рангового критерия (Мантеля-Кокса), а величину p считали статистически значимой, если ≤0,05. Для тестирования того, происходила ли агглютинация стафилококков in vivo, мышей сначала заражали в хвостовую вену изолятом CA-MRSA USA300, HA-MRSA-100 или HA-MSSA USA200 и регистрировали количество бактерий в сердце и почке спустя 14 часов после инфицирования.

[00236] Тестировали эффективность комбинации mAb 11H10 к ClfA и Ab LC10 к AT в модели летального IV заражения. Как показано на фигуре 15, профилактическое введение mAb 11H10 к ClfA, mAb LC10 к AT и комбинации как mAb к ClfA, так и mAb LC10 к АТ приводило в результате к значимому снижению cfu бактерий в сердце (фиг. 15b) и почке (15c).

[00237] На фигуре 15 также продемонстрирована способность mAb 11H10 к ClfA, mAb LC10 к AT и комбинации mAb 11H10 к ClfA и mAb LC10 к At повышать выживаемость животных по результатам исследования в мышиной модели IV заражения с помощью сублетальной дозы USA300. На фигуре 15a показано, что комбинация обоих антител приводила к значимому повышению реакции в отношении выживаемости спустя 2 недели после инфицирования по сравнению с контролем и по сравнению с любым отдельным mAb к ClfA и mAb к AT.

[00238] На фигурах 16 и 17 дополнительно продемонстрирована способность комбинации mAb 11H10 к ClfA и mAb LC10 к At повышать выживаемость животных по результатам исследования в модели IV заражения с помощью сублетальной дозы HA-MRSA USA100 (фигура 16) и сублетальной дозы HA-MSSA USA200 (фигура 17).

Пример 11 - Эффективность комбинации mAb 2F4 к IsdH и Ab LC10 к AT в модели летального IV заражения

[00239] Проводили эксперименты, которые описаны выше для Примера 10.

[00240] Тестировали эффективность комбинации mAb 2F4 к IsdH и Ab LC10 к AT в модели летального IV заражения. Как показано на фигуре 18, комбинация mAb 2F4 к IsdH и mAb LC10 к At повышала выживаемость животных по результатам исследования в модели IV заражения с помощью сублетальной дозы HA-MRSA USA100. На фигуре 18 показано, что комбинация приводила в результате к значимому повышению реакции в отношении выживаемости спустя 6 дней после инфицирования по сравнению с контролем R347.

Таблица последовательностей

Таблица 1
Последовательности CDR VL для mAb 2A3.1, 10A7.5, 12B8.19 и 25E9.1
SEQ ID NO: Описание Последовательность
SEQ ID NO: 1 CDR1 VL RASQSISSWLA
SEQ ID NO: 2 CDR2 VL KASSLES
SEQ ID NO: 3 CDR3 VL QQYNSYWT

Таблица 2
Последовательности CDR VL для mAB 28F6.1
SEQ ID NO: Описание Последовательность
SEQ ID NO: 4 CDR1 VL mAb 28F6.1 RASQGIRNDLG
SEQ ID NO: 5 CDR2 VL mAb 28F6.1 DASSLQS
SEQ ID NO: 6 CDR3 VL mAb 28F6.1 LQDYNYPWT

Таблица 3
Последовательности CDR VH для mAb 2A3.1
SEQ ID NO: Описание Последовательность
SEQ ID NO: 7 CDR1 VH SYDMH
SEQ ID NO: 8 CDR2 VH GIGTAGDTYYPGSVKG
SEQ ID NO: 9 CDR3 VH DNYSSTGGYYGMDV

Таблица 4
Последовательности CDR VH для mAb 10A7.5 и 12B8.19
SEQ ID NO: Описание Последовательность
SEQ ID NO: 10 CDR1 VH RYDMH
SEQ ID NO: 11 CDR2 VH VIGTDGDTYYPGSVKG
SEQ ID NO: 12 CDR3 VH DRYSSSNHYNGMDV

Таблица 5
Последовательности CDR VH для mAb 28F6.1
SEQ ID NO: Описание Последовательность
SEQ ID NO: 13 CDR1 VH mAb 28F6.1 SYAMT
SEQ ID NO: 14 CDR2 VH mAb 28F6.1 VISGSGGSTYYADSVKG
SEQ ID NO: 15 CDR3 VH mAb 28F6.1 DGRQVEDYYYYYGMDV

Таблица 6
Последовательности CDR VH для mAb 25E9.1
SEQ ID NO: Описание Последовательность
SEQ ID NO: 7 CDR1 VH mAb 25E9.1 SYDMH
SEQ ID NO: 17 CDR2 VH mAb 25E9.1 VIDTAGDTYYPGSVKG
SEQ ID NO: 18 CDR3 VH mAb 25E9.1 DRYSGNFHYNGMDV

Таблица 7
Аминокислотные последовательности VL и VH для mAb к альфа-токсину
Описание Последовательность VH или VL (с CDR, выделенными жирным шрифтом) CDR1 CDR2 CDR3
VL mAb 2A3.1 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYWTFGQGTKVEIK
(SEQ ID NO: 19)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYNSYWT (SEQ ID NO: 3)
VH mAb 2A3.1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQLNSLRAGDTAVYFCARDNYSSTGGYYGMDVWGQGTTVTVSS
(SEQ ID NO: 20)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DNYSSTGGYYGMDV (SEQ ID NO: 9)
VL mAb 10A7.5 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYWTFGQGTKVEIK
(SEQ ID NO: 21)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYNSYWT
(SEQ ID NO: 3)
VH mAb 10A7.5 EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQATGKGLEWVSVIGTDGDTYYPGSVKGRFIISRENAKNSLYLEMNSLRAGDTAVYYCARDRYSSSNHYNGMDVWGQGTTVTVSS
(SEQ ID NO: 22)
RYDMH
(SEQ ID NO: 10)
VIGTDGDTYYPGSVKG
(SEQ ID NO: 11)
DRYSSSNHYNGMDV
(SEQ ID NO: 12)

VL mAb 12B8.19 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKVLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYWTFGQGTKVEIK
(SEQ ID NO: 23)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYNSYWT
(SEQ ID NO: 3)
VH mAb 12B8.19 EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQATGKGLEWVSVIGTDGDTYYPGSVKGRFIISRENAKNSLYLEMNSLRAGDTAVYYCARDRYSSSNHYNGMDVWGQGTTVTVSS
(SEQ ID NO: 24)
RYDMH
(SEQ ID NO: 10)
VIGTDGDTYYPGSVKG
(SEQ ID NO: 11)
DRYSSSNHYNGMDV
(SEQ ID NO: 12)
VL mAb 28F6.1 AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYDASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK
(SEQ ID NO: 25)
RASQGIRNDLG (SEQ ID NO: 4) DASSLQS
(SEQ ID NO: 5)
LQDYNYPWT
(SEQ ID NO: 6)
VH mAb 28F6.1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMTWVRQAPGKGLEWVSVISGSGGSTYYADSVKGRFTVSRDNSKNTLYLQMNSLRAEDTAVYYCAKDGRQVEDYYYYYGMDVWGQGTTVTVSS
(SEQ ID NO: 26)
SYAMT
(SEQ ID NO: 13)
VISGSGGSTYYADSVKG
(SEQ ID NO: 14)
DGRQVEDYYYYYGMDV
(SEQ ID NO: 15)
VL mAb 25E9.1 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYWTFGQGTKVEIK
(SEQ ID NO: 27)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYNSYWT
(SEQ ID NO: 3)

VH mAb 25E9.1 EVQLVESGGGLVQPGGSLRLSCTASGFTFSSYDMHWVRQATGKGLEWVSVIDTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCVRDRYSGNFHYNGMDVWGQGTTVTVSS
(SEQ ID NO: 28)
SYDMH
(SEQ ID NO: 7)
SVIDTAGDTYYPGSVKG
(SEQ ID NO: 17)
DRYSGNFHYNGMDV
(SEQ ID NO: 18)
VH mAb QD20 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSPTGHYMGMDVWGQGTTVTVSS
(SEQ ID NO: 41)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DRYSPTGHYMGMDV
(SEQ ID NO: 16)
VL mAb QD20 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYDTYWTFGQGTKVEIK
(SEQ ID NO: 42)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYDTYWT
(SEQ ID NO: 64)
VH mAb QD33 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSRTGHYMGMDVWGQGTTVTVSS
(SEQ ID NO: 43)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DRYSRTGHYMGMDV
(SEQ ID NO: 65)
VL mAb QD33 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYDTYWTFGQGTKVEIK
(SEQ ID NO: 44)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYDTYWT
(SEQ ID NO: 64)

VH mAb QD37 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSRTGHYMGMSLWGQGTTVTVSS
(SEQ ID NO: 45)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DRYSRTGHYMGMSL
(SEQ ID NO: 66)
VL mAb QD37 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYDTYWTFGQGTKVEIK
(SEQ ID NO: 46)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYDTYWT
(SEQ ID NO: 64)
VH mAb QD3 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDNYSRTGHYMGMDVWGQGTTVTVSS
(SEQ ID NO: 47)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DNYSRTGHYMGMDV
(SEQ ID NO: 67)
VL mAb QD3 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCKQYADYWTFGQGTKVEIK
(SEQ ID NO: 48)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
KQYADYWT
(SEQ ID NO: 68)
VH mAb QD4 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDNYSRTGHYMGMDVWGQGTTVTVSS
(SEQ ID NO: 49)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DNYSRTGHYMGMDV
(SEQ ID NO: 67)

VL mAb QD4 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYDTYWTFGQGTKVEIK
(SEQ ID NO: 50)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYDTYWT
(SEQ ID NO: 64)
VH mAb QD23 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSPTGHYMGMSLWGQGTTVTVSS
(SEQ ID NO: 51)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DRYSPTGHYMGMSL
(SEQ ID NO: 78)
VL mAb QD23 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYDTYWTFGQGTKVEIK
(SEQ ID NO: 52)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYDTYWT
(SEQ ID NO: 64)
VH mAb QD32 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSRTGHYMGMDVWGQGTTVTVSS
(SEQ ID NO: 53)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DRYSRTGHYMGMDV
NO: 65)
VL mAb QD32 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCKQYADYWTFGQGTKVEIK
(SEQ ID NO: 54)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
KQYADYWT
(SEQ ID NO: 68)

VH mAb 2A3GL EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDNYSSTGGYYGMDVWGQGTTVTVSS
(SEQ ID NO: 55)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DNYSSTGGYYGMDV
(SEQ ID NO: 9)
VL mAb 2A3GL DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYWTFGQGTKVEIK
(SEQ ID NO: 56)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
QQYNSYWT
(SEQ ID NO: 3)
VH mAb LC10 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSHDMHWVRQATGKGLEWVSGIGTAGDTYYPDSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSPTGHYYGMDVWGQGTTVTVSS
(SEQ ID NO: 57)
SHDMH
(SEQ ID NO: 69)
GIGTAGDTYYPDSVKG
(SEQ ID NO: 70)
DRYSPTGHYYGMDV
(SEQ ID NO: 71)
VL mAb LC10 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCKQYADYWTFGQGTKVEIK
(SEQ ID NO: 58)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
KQYADYWT
(SEQ ID NO: 68)
VH mAb TVES EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSGIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDNYSPTGGYYGMDVWGQGTTVTVSS
(SEQ ID NO: 59)
SYDMH
(SEQ ID NO: 7)
GIGTAGDTYYPGSVKG
(SEQ ID NO: 8)
DNYSPTGGYYGMDV
(SEQ ID NO: 72)

VL mAb TVES DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLKSGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYESYWTFGQGTKVEIK
(SEQ ID NO: 60)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLKS
(SEQ ID NO: 73)
QQYESYWT
(SEQ ID NO: 74)
VH mAb 3H7KAD EVQLVESGGGLVQPGGSLRLSCAASGFTFSSHDMHWVRQATGKGLEWVSGIGTRGDTYYPDSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSPTGHYYGMDVWGQGTTVTVSS
(SEQ ID NO: 61)
SHDMH
(SEQ ID NO: 69)
GIGTRGDTYYPDSVKG
(SEQ ID NO: 75)
DRYSPTGHYYGMDV
(SEQ ID NO: 71)
VL mAb 3H7KAD DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCKQYADYWTFGQGTKVEIK
(SEQ ID NO: 58)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
KQYADYWT
(SEQ ID NO: 68)
VH mAb LC9 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSHDMHWVRQATGKGLEWVSGIGTRGDTYYPDSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDKYSPTGHYYGMDVWGQGTTVTVSS
(SEQ ID NO: 62)
SHDMH
(SEQ ID NO: 69)
GIGTRGDTYYPDSVKG
(SEQ ID NO: 75)
DKYSPTGHYYGMDV
(SEQ ID NO: 76)
VL mAb LC9 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCKQYADYWTFGQGTKVEIK
(SEQ ID NO: 58)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLES
(SEQ ID NO: 2)
KQYADYWT
(SEQ ID NO: 68)

VH mAb LC4 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSHDMHWVRQATGKGLEWVSGIGTRGDTYYPDSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDKYSPTGHYYGMDVWGQGTTVTVSS
(SEQ ID NO: 62)
SHDMH
(SEQ ID NO: 69)
GIGTRGDTYYPDSVKG
(SEQ ID NO: 75)
DKYSPTGHYYGMDV
(SEQ ID NO: 76)
VL mAb LC4 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLVKGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYESYWTFGQGTKVEIK
(SEQ ID NO: 63)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLVK
(SEQ ID NO: 77)
QQYESYWT
(SEQ ID NO: 74)
VH mAb LC5 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSHDMHWVRQATGKGLEWVSGIGTAGDTYYPDSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDRYSPTGHYYGMDVWGQGTTVTVSS
(SEQ ID NO: 79)
SHDMH
(SEQ ID NO: 69)
GIGTAGDTYYPDSVKG
(SEQ ID NO: 70)
DRYSPTGHYYGMDV
(SEQ ID NO: 71)
VL mAb LC5 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLVKGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYESYWTFGQGTKVEIK
(SEQ ID NO: 63)
RASQSISSWLA
(SEQ ID NO: 1)
KASSLVK
(SEQ ID NO: 77)
QQYESYWT
(SEQ ID NO: 74)

Таблица 8
Нуклеотидные последовательности VL и VH для mAb к альфа-токсину
SEQ ID NO: Описание Последовательность
SEQ ID NO: 29 Нуклеотидная последовательность VL mAb 2A3.1 GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAACTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACTTATTACTGCCAACAGTATAATAGTTATTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA
SEQ ID NO: 30 Нуклеотидная последовательность VH mAb 2A3.1 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTACGACATGCACTGGGTCCGCCAAGCTACAGGAAAAGGTCTGGAGTGGGTCTCAGGTATTGGCACTGCTGGTGACACATATTATCCAGGCTCCGTGAAGGGCCGATTCACCATCTCCAGAGAAAATGCCAAGAACTCCTTGTATCTTCAATTGAACAGCCTGAGAGCCGGGGACACGGCTGTGTACTTCTGTGCAAGAGACAATTATAGCAGCACCGGGGGGTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA

SEQ ID NO: 31 Нуклеотидная последовательность VL mAb 10A7.5 GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAACTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACTTATTACTGCCAACAGTATAATAGTTATTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA
SEQ ID NO: 32 Нуклеотидная последовательность VH mAb 10A7.5 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGGTACGACATGCACTGGGTCCGCCAAGCTACAGGAAAAGGTCTGGAGTGGGTCTCAGTTATTGGTACTGATGGTGACACATACTATCCAGGCTCCGTGAAGGGCCGATTCATCATCTCCAGAGAAAATGCCAAGAACTCCTTGTATCTTGAAATGAACAGCCTGAGAGCCGGGGACACGGCTGTGTATTACTGTGCAAGAGATCGGTATAGCAGCTCGAACCACTACAACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA

SEQ ID NO: 33 Нуклеотидная последовательность VL mAb 12B8.19 GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGGTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACTTATTACTGCCAACAGTATAATAGTTATTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA
SEQ ID NO: 34 Нуклеотидная последовательность VH mAb 12B8.19 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGGTACGACATGCACTGGGTCCGCCAAGCTACAGGAAAAGGTCTGGAGTGGGTCTCAGTTATTGGTACTGATGGTGACACATACTATCCAGGCTCCGTGAAGGGCCGATTCATCATCTCCAGAGAAAATGCCAAGAACTCCTTGTATCTTGAAATGAACAGCCTGAGAGCCGGGGACACGGCTGTGTATTACTGTGCAAGAGATCGGTATAGCAGCTCGAACCACTACAACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA

SEQ ID NO: 35 Нуклеотидная последовательность VL mAb 28F6.1 GCCATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATGATGCATCCAGTTTACAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGCACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAAGATTACAATTACCCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA
SEQ ID NO: 36 Нуклеотидная последовательность VH mAb 28F6.1 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCAGCTATGCCATGACCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAATGGGTCTCAGTTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCGTCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGAAAGATGGGAGGCAGGTCGAGGATTACTACTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA

SEQ ID NO: 37 Нуклеотидная последовательность VL mAb 25E9.1 GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACTTATTACTGCCAACAGTATAATAGTTATTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA
SEQ ID NO: 38 Нуклеотидная последовательность VH mAb 25E9.1 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTACAGCCTCTGGATTCACCTTCAGTAGTTACGACATGCACTGGGTCCGCCAAGCTACAGGAAAAGGTCTGGAGTGGGTCTCAGTTATTGATACTGCTGGTGACACATACTATCCAGGCTCCGTGAAGGGCCGATTCACCATCTCCAGAGAAAATGCCAAGAACTCCTTGTATCTTCAAATGAACAGCCTGAGAGCCGGGGACACGGCTGTGTATTACTGTGTAAGAGATAGGTATAGTGGGAACTTCCACTACAACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA

Таблица 9
Сводная таблица CDR VL и VH для альфа-токсина
Описание SEQ ID NO
CDR 1 VL 1, 4

CDR 2 VL 2, 5, 73, 77
CDR 3 VL 3, 6, 64, 68, 74
CDR 1 VH 7, 10, 13, 69
CDR 2 VH 8, 11, 14, 17, 70, 75
CDR 3 VH 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76, 78

Таблица 11
Аминокислотные последовательности альфа-токсина
Альфа-токсин Staphylococcus aureus adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgtiagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygfngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwgpydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkaskqqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn (SEQ ID NO: 39)
Мутантный альфа-токсин H35L S. aureus adsdiniktgttdigsnttvktgdlvtydkengmlkkvfysfiddknhnkkllvirtkgtiagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygfngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwgpydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkaskqqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn (SEQ ID NO:40)

Таблица 12
Иллюстративные аминокислотные последовательности антител, которые специфично связываются с поверхностным антигеном S. aureus IsdH
Описание Последовательность VH или VL (с CDR, выделенными жирным шрифтом) CDR1 CDR2 CDR3
mAb 2F4 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSPYMMQWVRQAPGKGLEWVSSIWPSGGKTYYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCARVRRGGATDYWGQGTLVTVSS
(SEQ ID NO: 80)
PYMMQ
(SEQ ID NO: 90)
SIWPSGGKTYYADSVKG (SEQ ID NO: 91) VRRGGATDY (SEQ ID NO: 92)
mAb 2F4 VL DIQMTQSPATLSVSPGERATLSCRASQSVSSNLGWYQQKPGQAPRLLIYGASTRATGIPTRFSGSGSGTEFTLTISSLQS
EDFATYYCQQYQNWPLLTFGGGTKVEIK
(SEQ ID NO: 81)
RASQSVSSNLG (SEQ ID NO: 93) GASTRAT (SEQ ID NO: 94) QQYQNWPLLT (SEQ ID NO: 95)
mAb A7 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYYMWWVRQAPGKGLEWVSVIGPSGGPTQYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCARWGGRYSVFETWGQGTMVTVSS
(SEQ ID NO: 82)
NYYMW (SEQ ID NO: 96) VIGPSGGPTQYADSVKG (SEQ ID NO: 97) WGGRYSVFET (SEQ ID NO: 98)

mAb A7 VL DIQMTQSPATLSVSPGGRATLSCRASQSVRKNVAWYQQKPGQPPRLLIYGASTRATGVPARFSGSGSGTEFTLTISRMQP
EDFVVYHCQQYSSWPAFGQGTMVEIN
(SEQ ID NO: 83)
RASQSVRKNVA (SEQ ID NO: 99) GASTRAT (SEQ ID NO: 100) QQYSSWPAF (SEQ ID NO: 101)
mAb 1C1 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYFMGWVRQAPGKGLEWVSSIYSSGGYTSYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCARRWRDGTFDYWGQGTLVTVSS
(SEQ ID NO: 84)
RYFMG (SEQ ID NO: 102) SIYSSGGYTSYADSVKG (SEQ ID NO: 103) RWRDGTFDY (SEQ ID NO: 104)
mAb 1C1 VL DIQMTQSPSSLSASIGDRVTISCRASQSVREYLNWYQQKPGKAPKLLIFAASSLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQSYSTRFTFGPGTKVDIK
(SEQ ID NO: 85)
RASQSVREYLN (SEQ ID NO: 105) AASSLQS (SEQ ID NO: 106) QQSYSTRFT (SEQ ID NO: 107)
IsdH0003 VH QVQLQQSGAEVKKPGSSVKVSCKASGGTFSSYPISWVRQAPGQGLEWMGKIIPIFGTTNYAQKFQGRVTITADESTSTAY
MELSSLRSEDTAIYYCASPNRPYNIGWHYYFDYWGKGTLVTVSS
(SEQ ID NO: 86)
SYPIS
(SEQ ID NO: 108)
KIIPIFGTTNYAQKFQG (SEQ ID NO: 109) PNRPYNIGWHYYFDY (SEQ ID NO: 110)

IsdH0003 VL QSVLTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEGSKRPSGVSNRFSGSRSGNTASLTISGL
QAEDEADYYCSSYTTRSTRVFGGGTKLTVL
(SEQ ID NO: 87)
TGTSSDVGGYNYVS
(SEQ ID NO: 111)
EGSKRPS
(SEQ ID NO: 112)
SSYTTRSTRV
(SEQ ID NO: 113)
IsdH0016 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCARDQDEGRANNWWIPPGGRWGQGTMVTVSS
(SEQ ID NO: 88)
SYAMS
(SEQ ID NO: 114)
AISGSGGSTYYADSVKG
(SEQ ID NO: 115)
DQDEGRANNWWIPPGGR
(SEQ ID NO: 116)
IsdH0016 VL SSELTQDPTLSVALGQTVRITCQGDSLRRSFASWYQKKPGQAPVLLIYGQNKRPAGIPDRFSGSRSGNSASLTITGAQ
AEDEADYYCNSRDARLNPYILFGGGTKLTVL
(SEQ ID NO: 89)
QGDSLRRSFAS
(SEQ ID NO: 117)
GQNKRPA (SEQ ID NO: 118) NSRDARLNPYIL (SEQ ID NO: 119)

Таблица 13
Нуклеотидные последовательности, кодирующие аминокислотные последовательности VH и VL для mAb, направленных против поверхностных антигенов S. aureus IsdH и ClfA
SEQ ID NO: Описание Последовательность
SEQ ID NO: 120 Нуклеотидная последовательность VH mAb 2F4 GAAGTTCAATTGTTAGAGTCTGGTGGCGGTCTTGTTCAGCCTGGTGGTTCTTTACGTCTTTCTTGCGCTGCTTCCGGATTCACTTTCTCTCCTTACATGATGCAGTGGGTTCGCCAAGCTCCTGGTAAAGGTTTGGAGTGGGTTTCTTCTATCTGGCCTTCTGGTGGCAAGACTTATTATGCTGACTCCGTTAAAGGTCGCTTCACTATCTCTAGAGACAACTCTAAGAATACTCTCTACTTGCAGATGAACAGCTTAAGGGCTGAGGACACGGCCGTGTATTACTGTGCGAGAGTGCGGAGGGGGGGAGCTACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCAAGC
SEQ ID NO: 121 Нуклеотидная последовательность VL mAb 2F4 GACATCCAGATGACCCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAACTTAGGCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTGGTATCCCAACCAGGTTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAGATTTTGCAACTTATTACTGTCAGCAGTATCAGAACTGGCCCTTGCTCACTTTCGGCGGAGGGACCAAGGTGGAAATCAAA

SEQ ID NO: 122 Нуклеотидная последовательность VH mAb A7 GAAGTTCAATTGTTAGAGTCTGGTGGCGGTCTTGTTCAGCCTGGTGGTTCTTTACGTCTTTCTTGCGCTGCTTCCGGATTCACTTTCTCTAATTACTATATGTGGTGGGTTCGCCAAGCTCCTGGTAAAGGTTTGGAGTGGGTTTCTGTTATCGGTCCTTCTGGTGGCCCTACTCAGTATGCTGACTCCGTTAAAGGTCGCTTCACTATCTCTAGAGACAACTCTAAGAATACTCTCTACTTGCAGATGAACAGCTTAAGGGCTGAGGACACGGCCGTGTATTACTGTGCGAGATGGGGTGGGAGGTACTCTGTATTTGAAACCTGGGGCCAAGGGACAATGGTCACCGTCTCAAGC
SEQ ID NO: 123 Нуклеотидная последовательность VL mAb A7 GACATCCAGATGACCCAGTCTCCAGCCACTCTGTCTGTGTCTCCAGGGGGAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGAAAAAACGTAGCCTGGTATCAGCAGAAACCTGGCCAGCCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTGGTGTCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGGATGCAGCCTGAAGATTTTGTAGTTTATCACTGTCAGCAGTATAGTAGCTGGCCGGCGTTCGGCCAGGGGACCATGGTGGAAATCAAC

SEQ ID NO: 124 Нуклеотидная последовательность VH mAb 1C1 GAAGTTCAATTGTTAGAGTCTGGTGGCGGTCTTGTTCAGCCTGGTGGTTCTTTACGTCTTTCTTGCGCTGCTTCCGGATTCACTTTCTCTCGTTACTTTATGGGTTGGGTTCGCCAAGCTCCTGGTAAAGGTTTGGAGTGGGTTTCTTCTATCTATTCTTCTGGTGGCTATACTTCTTATGCTGACTCCGTTAAAGGTCGCTTCACTATCTCTAGAGACAACTCTAAGAATACTCTCTACTTGCAGATGAACAGCTTAAGGGCTGAGGACACGGCCGTGTATTACTGTGCGAGACGGTGGCGAGATGGCACCTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCAAGC
SEQ ID NO: 125 Нуклеотидная последовательность VL mAb 1C1 GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTATTGGAGACAGAGTCACCATCTCTTGCCGGGCAAGTCAGAGCGTTAGAGAGTATCTAAATTGGTATCAACAAAAACCAGGGAAAGCCCCTAAACTCCTGATCTTTGCTGCATCCAGTTTGCAGAGTGGGGTCCCATCAAGATTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTATTACTGTCAACAGAGTTACAGTACCCGATTCACTTTCGGCCCTGGGACCAAAGTGGACATCAAA

SEQ ID NO: 126 Нуклеотидная последовательность VH mAb IsdH0003 CAGGTACAGCTGCAGCAGTCAGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGG
CACCTTCAGCAGCTATCCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAAAGATCATCCCTA
TCTTTGGTACAACAAACTACGCGCAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCACGAGCACTGCCTAC
ATGGAACTGAGCAGCCTGAGATCTGAGGACACGGCCATATATTACTGTGCGAGCCCCAATCGACCCTATAACATTGGCTG
GCACTACTACTTTGACTACTGGGGCAAAGGAACCCTGGTCACCGTCTCCTCA
SEQ ID NO: 127 Нуклеотидная последовательность VL mAb IsdH0003 CAGTCTGTGCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTATGTCTCCTGGTACCAACAACACCCAGGCAAAGCCCCCAAACTCATGATTTATGAGGGCAGTAAGCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAGGTCTGGCAACACGGCCTCCCTGACAATCTCTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGCAGCTCATATACAACCAGGAGCACTCGAGTCTTCGGCGGAGGGACCAAGCTGACCGTCCTA

SEQ ID NO: 128 Нуклеотидная последовательность VH mAb IsdH0016 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCAGCTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCAAGAGATCAGGACGAAGGTAGAGCGAACAACTGGTGGATCCCCCCCGGGGGTCGCTGGGGCCAGGGGACAATGGTCACCGTCTCGAGT
SEQ ID NO: 129 Нуклеотидная последовательность VL mAb IsdH0016 TCTTCTGAGCTGACTCAGGACCCTACTCTGTCTGTGGCCCTGGGACAGACAGTCAGAATCACATGCCAAGGAGACAGCCTCCGAAGATCTTTTGCAAGTTGGTACCAGAAGAAGCCAGGACAGGCCCCTGTACTTCTCATCTATGGTCAAAATAAGCGGCCCGCAGGGATCCCAGACCGATTCTCTGGCTCCAGGTCAGGAAACTCAGCTTCGTTGACCATCACAGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAATTCCCGCGACGCCAGACTTAACCCTTATATACTCTTCGGCGGTGGGACCAAGCTGACCGTCCTA

Таблица 14
Иллюстративные аминокислотные последовательности антител, которые специфично связываются с поверхностным антигеном S. aureus ClfA
Описание Последовательность VH или VL (с CDR, выделенными жирным шрифтом) CDR1 CDR2 CDR3
mAb 23D6 VH QVQLVESGGGVVQPGRSLRLSCAASVFTFSSYGMHWVRQAPGKGLEWVALIWFDGSNEYYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCARDRGGGYYYYGMDVWGQGTTVTVSS (SEQ ID NO:132 )
SYGMH (SEQ ID NO:133) LIWFDGSNEYYADSVKG (SEQ ID NO: 134) RGGGYYYYGMDV (SEQ ID NO: 135)
mAb 23D6 VL DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQP
EDFATYYCLQHNSYPYTFGQGTKLEIK (SEQ ID NO:136)
RASQGIRNDLG (SEQ ID NO: 137) AASSLQS (SEQ ID NO: 138) LQHNSYPYT (SEQ ID NO: 139)
mAb 27H4 VH QVQLVQSGAEVKKPGASVKVSCKTSGYTFTSYGISWVRQAPGQGHEWMGWISSYNGNTNYAQKLQGRVTMTSDTSTSTAYMELRSLRSDDTAVYYCARIAARGYYYGMDVWGQGTTVTVSS (SEQ ID NO:140) SYGIS (SEQ ID NO: 141) WISSYNGNTNYAQKLQG (SEQ ID NO: 142) AARGYYYGMD (SEQ ID NO: 143)

mAb 27H4 VL EIVLTQSPGTLSLSPGERATLSCRASQSISGSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE
PEDFAVYYCQQYGSSPWTFGQGTKVEIK (SEQ ID NO:144)
RASQSISGSYLA (SEQ ID NO: 145) GASSRAT (SEQ ID NO: 146) QQYSSWPAF(SEQ ID NO: 147)

[00241] Приведенные ранее примеры и таблицы предназначены для иллюстрации и никоим образом не для ограничения настоящего раскрытия. Специалистам в данной области будут очевидны другие варианты осуществления раскрываемых устройств и способов после рассмотрения описания и практического применения раскрываемых в настоящем документе устройств и способов.

[00242] Далее приведены варианты осуществления настоящего изобретения:

1. Выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном IsdH Staphylococcus aureus (S. aureus), являющимся поверхностной детерминантой,

где выделенное антитело или его антигенсвязывающий фрагмент содержат вариабельную область тяжелой цепи (VH) и вариабельную область легкой цепи (VH), каждая из которых содержит три определяющие комплементарность области (CDR1, CDR2 и CDR3),

и где:

a. CDR1 VH идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 90, 96, 102, 108 или 114;

b. CDR2 VH идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 91, 97, 103, 109 или 115; и

с. CDR3 VH идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 92, 98, 104, 110 или 116;

и/или

d. CDR1 VL идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 93, 99, 105, 111 или 117;

e. CDR2 VL идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 94, 100, 106, 112 или 118; и

f. CDR3 VL идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 95, 101, 107, 113 или 119.

2. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 1,где выделенное антитело или его антигенсвязывающий фрагмент содержат:

a. CDR1 VH, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 90, 96, 102, 108 или 114;

b. CDR2 VH, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 91, 97, 103, 109 или 115;

с. CDR3 VH, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 92, 98, 104, 110 или 116;

d. CDR1 VL, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 93, 99, 105, 111 или 117;

e. CDR2 VL, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 94, 100, 106, 112 или 118; и

f. CDR3 VL, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 95, 101, 107, 113 или 119.

3. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 1 или 2, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL соответствуют набору аминокислотных последовательностей, выбранных из группы, состоящей из SEQ ID NO: 90, 91, 92, 93, 94 и 95; SEQ ID NO: 96, 97, 98, 99, 100 и 101; SEQ ID NO: 102, 103, 104, 105, 106 и 107; SEQ ID NO: 108, 109, 110, 111, 112 и 113 и SEQ ID NO: 114, 115, 116, 117, 118 и 119.

4. Выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном IsdH Staphylococcus aureus (S. aureus), являющимся поверхностной детерминантой, где аминокислотная последовательность VH по меньшей мере на 80%, 85%, 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 80, 82, 84, 86 или 88.

5. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 4, где аминокислотная последовательность VH идентична или содержит 1-10 мутаций аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 80, 82, 84, 86 или 88.

6. Выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном IsdH Staphylococcus aureus (S. aureus), являющимся поверхностной детерминантой, где аминокислотная последовательность VL по меньшей мере на 80%, 85%, 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 81, 83, 85, 87 или 89.

7. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 6, где аминокислотная последовательность VL идентична или содержит 1-10 мутаций аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 81, 83, 85, 87 или 89.

8. Выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 1-7, где аминокислотная последовательность VH по меньшей мере на 80%, 85%. 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 80, 82, 84, 86 или 88, а аминокислотная последовательность VL по меньшей мере на 80%, 85%. 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 81, 83, 85, 87 или 89.

9. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 8, где аминокислотная последовательность VH соответствует аминокислотной последовательности SEQ ID NO: 80, 82, 84, 86 или 88, а аминокислотная последовательность VL соответствует аминокислотной последовательности SEQ ID NO: 81, 83, 85, 87 или 89.

10. Выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 1-8, где VH и VL выбраны из группы, состоящей из SEQ ID NO: 80 и 81; SEQ ID NO: 82 и 83; SEQ ID NO: 84 и 85; SEQ ID NO: 86 и 87 и SEQ ID NO: 88 и 89.

11. Выделенное антитело или фрагмент по любому из вариантов осуществления 1-3, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL соответствуют набору аминокислотных последовательностей, выбранных из группы, состоящей из SEQ ID NO: 90, 91, 92, 93, 94 и 95.

12. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 1 или 2, где аминокислотная последовательность VH содержит четыре каркасные области VH (FR1, FR2, FR3, FR4), и где четыре каркасные области VH имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 80, 82, 84, 86 или 88.

13. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 1 или 2, где аминокислотная последовательность VL содержит четыре каркасные области VL (FR1, FR2, FR3, FR4), и где четыре каркасные области VL имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 81, 83, 85, 87 или 89.

14. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 1 или 2, где четыре каркасные области VH имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 80, 82, 84, 86 или 88, и где четыре каркасные области VL имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 81, 83, 85, 87 или 89.

15. Выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 1-14, где VH и VL соответствуют SEQ ID NO 80 и 81.

16. Выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 1-15, где антитело или его антигенсвязывающий фрагмент характеризуются по меньшей мере одним из следующих:

a. константой диссоциации (KD) для поверхностного антигена S. aureus, равной приблизительно 70 нМ или менее;

b. возможностью уменьшать способность S. aureus уклоняться от опсонофагоцитоза по меньшей мере на 50%, по результатам измерения с помощью анализа опсонофагоцитирующего киллинга; или

c. возможностью уменьшать количество колониеобразующих единиц (CFU) S. aureus по меньшей мере на 50%, по результатам измерения с помощью модели бактериемии.

17. Выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном IsdH Staphylococcus aureus (S. aureus), являющимся поверхностной детерминантой, и где антитело или его антигенсвязывающий фрагмент характеризуются по меньшей мере одним из следующих:

a. константой диссоциации (KD) для поверхностного антигена S. aureus, равной приблизительно 70 нМ или менее;

b. возможностью уменьшать способность S. aureus уклоняться от опсонофагоцитоза по меньшей мере на 50%, по результатам измерения с помощью анализа опсонофагоцитирующего киллинга;

c. возможностью уменьшать количество колониеобразующих единиц (CFU) S. aureus по меньшей мере на 50%, по результатам измерения с помощью модели бактериемии;

d. возможностью уменьшать инфильтрацию иммунными клетками, бактериальную нагрузку и высвобождение провоспалительных цитокинов, по результатам измерения в животной модели нагрузки органа.

18. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 17, имеющее аминокислотную последовательность антитела или его антигенсвязывающего фрагмента по любому из вариантов осуществления 1-16.

19. Композиция, содержащая выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 1-18 и фармацевтически приемлемое вспомогательное средство.

20. Выделенная нуклеиновая кислота, кодирующая аминокислотную последовательность по любому из вариантов осуществления 1-15.

21. Выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном ClfA Staphylococcus aureus (S. aureus), являющимся поверхностной детерминантой,

где выделенное антитело или его антигенсвязывающий фрагмент содержат вариабельную область тяжелой цепи (VH) и вариабельную область легкой цепи (VH), каждая из которых содержит три определяющие комплементарность области (CDR1, CDR2 и CDR3),

и где:

a. CDR1 VH идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 133 или 141;

b. CDR2 VH идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 134 или 142;

и

с. CDR3 VH идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 135 или 143;

и/или

d. CDR1 VL идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 137 или 145;

e. CDR2 VL идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 138 или 146;

и

f. CDR3 VL идентична или содержит 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 139 или 147.

22. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 21,где выделенное антитело или его антигенсвязывающий фрагмент содержат:

a. CDR1 VH, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 133 или 141;

b. CDR2 VH, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 134 или 142;

с. CDR3 VH, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 135 или 143;

d. CDR1 VL, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 137 или 145;

e. CDR2 VL, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 138 или 146;

и

f. CDR3 VL, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 139 или 147.

23. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 21 или 22, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL соответствуют набору аминокислотных последовательностей, выбранных из группы, состоящей из SEQ ID NO: 133, 134, 135, 137, 138 и 139 и SEQ ID NO: 137, 138, 139, 145, 146 и 147.

24. Выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном ClfA Staphylococcus aureus (S. aureus), являющимся поверхностной детерминантой, где аминокислотная последовательность VH по меньшей мере на 80%, 85%, 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 132 или 140.

25. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 24, где аминокислотная последовательность VH идентична или содержит 1-10 мутаций аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 132 или 140.

26. Выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном ClfA Staphylococcus aureus (S. aureus), являющимся поверхностной детерминантой, где аминокислотная последовательность VL по меньшей мере на 80%, 85%, 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 136 или 144.

27. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 26, где аминокислотная последовательность VL идентична или содержит 1-10 мутаций аминокислотных остатков по отношению к аминокислотной последовательности SEQ ID NO: 136 или 144.

28. Выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 21-27, где аминокислотная последовательность VH по меньшей мере на 80%, 85%, 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 132 или 140, а аминокислотная последовательность VL по меньшей мере на 80%, 85%, 90%, 95% или 100% идентична аминокислотной последовательности SEQ ID NO: 136 или 144.

29. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 28, где аминокислотная последовательность VH соответствует аминокислотной последовательности SEQ ID NO: 132 или 140, а аминокислотная последовательность VL соответствует аминокислотной последовательности SEQ ID NO: 136 или 144.

30. Выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 21-28, где VH и VL выбраны из группы, состоящей из SEQ ID NO: 132 и 136 и SEQ ID NO: 140 и 144.

31. Выделенное антитело или фрагмент по любому из вариантов осуществления 21-23, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL соответствуют набору аминокислотных последовательностей, выбранных из группы, состоящей из SEQ ID NO: 141, 142, 143, 144, 145, 146 и 147.

32. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 21 или 22, где аминокислотная последовательность VH содержит четыре каркасные области VH (FR1, FR2, FR3, FR4), и где четыре каркасные области VH имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 132 или 140.

33. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 21 или 22, где аминокислотная последовательность VL содержит четыре каркасные области VL (FR1, FR2, FR3, FR4), и где четыре каркасные области VL имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 136 или 144.

34. Выделенное антитело или его антигенсвязывающий фрагмент по варианту осуществления 21 или 22, где четыре каркасные области VH имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VH в SEQ ID NO: 132 или 144, и где четыре каркасные области VL имеют аминокислотные последовательности, которые по меньшей мере приблизительно на 80%, 85%, 90%, 95% или 100% идентичны соответствующим аминокислотным последовательностям четырех каркасных областей VL в SEQ ID NO: 136 или 144.

35. Выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 21-34, где VH и VL соответствуют SEQ ID NO 140 и 144.

36. Композиция, содержащая выделенное антитело или его антигенсвязывающий фрагмент по любому из вариантов осуществления 21-35 и фармацевтически приемлемое вспомогательное средство.

37. Выделенная нуклеиновая кислота, кодирующая аминокислотную последовательность по любому из вариантов осуществления 21-35.

38. Композиция, содержащая выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с альфа-токсином (AT) S. aureus, и выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с антигеном S. aureus, являющимся поверхностной детерминантой.

39. Композиция по варианту осуществления 38, где антиген S. aureus, являющийся поверхностной детерминантой, выбран из группы, состоящей из SdrC, SdrD, SdrE, ClfA, ClfB, IsdA, IsdB, IsdC, IsdE, IsdH, SpA, FnbA и PNAG.

40. Композиция по варианту осуществления 38 или 39, где антигеном, являющимся поверхностной детерминантой, является IsdH.

41. Композиция по варианту осуществления 40, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают IsdH, является антителом или его антигенсвязывающим фрагментом по любому из вариантов осуществления 1-18.

42. Композиция по варианту осуществления 38 или 39, где антигеном, являющимся поверхностной детерминантой, является ClfA.

43. Композиция по варианту осуществления 42, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают ClfA, является антителом или его антигенсвязывающим фрагментом по любому из вариантов осуществления 21-35.

44. Композиция по любому из вариантов осуществления 38-43, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают AT, содержат:

a. CDR1 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO: 7, 10, 13 или 69;

b. CDR2 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO 8, 11, 14, 17, 70 или 75; и

c. CDR3 VH, содержащую аминокислотную последовательность, идентичную или содержащую 1, 2 или 3 мутации аминокислотных остатков по отношению к SEQ ID NO 9, 12, 15, 16, 18, 65, 66, 67, 71, 72, 76 или 78;

и/или

d. CDR1 VL, содержащую аминокислотную последовательность SEQ ID NO: 1 или 4;

e. CDR2 VL, содержащую аминокислотную последовательность SEQ ID NO: 2, 5, 73 или 77; и

f. CDR3 VL, содержащую аминокислотную последовательность SEQ ID NO: 3, 6, 64, 68 или 74.

45. Композиция по любому из вариантов осуществления 38-43, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают AT, содержат:

a. CDR1 VH, содержащую аминокислотную последовательность SEQ ID NO: 7, 10, 13 или 69;

b. CDR2 VH, содержащую аминокислотную последовательность SEQ ID NO: 8, 11, 14, 17, 70 или 75;

c. CDR3 VH, содержащую аминокислотную последовательность SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 или 78;

d. CDR1 VL, содержащую аминокислотную последовательность SEQ ID NO: 1 или 4;

e. CDR2 VL, содержащую аминокислотную последовательность SEQ ID NO: 2, 5, 73 или 77; и

f. CDR3 VL, содержащую аминокислотную последовательность SEQ ID NO: 3, 6, 64, 68 или 74.

46. Композиция по любому из вариантов осуществления 38-45, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL выделенного антитела или его антигенсвязывающего фрагмента, которые специфично связывают AT, соответствуют аминокислотным последовательностям SEQ ID NO: 7, 8, 9, 1, 2 и 3; SEQ ID NO: 10, 11, 12, 1, 2 и 3; SEQ ID NO: 13, 14, 15, 4, 5 и 6; SEQ ID NO: 7, 17, 18, 1, 2 и 3; SEQ ID NO: 7, 8, 16, 1, 2 и 64; SEQ ID NO: 7, 8, 65, 1, 2 и 64; SEQ ID NO; 7, 8, 66, 1, 2 и 64; SEQ ID NO: 7, 8, 67, 1, 2 и 68; SEQ ID NO: 7, 8, 67, 1, 2 и 64; SEQ ID NO: 7, 8, 78, 1, 2 и 64; SEQ ID NO: 7, 8, 65, 1, 2 и 68; SEQ ID NO: 69, 70, 71, 1, 2 и 68; SEQ ID NO: 7, 8, 72, 1, 73 и 74; SEQ ID NO: 69, 75, 71, 1, 2 и 68; SEQ ID NO: 69, 75, 76, 1, 2 и 68; SEQ ID NO: 69, 75, 76, 1, 77 и 74; SEQ ID NO: 69, 70, 71, 1, 77 и 74.

47. Композиция по любому из вариантов осуществления 38-43, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают AT, содержат вариабельный домен тяжелой цепи, который по меньшей мере на 90% идентичен аминокислотной последовательности SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62; и/или (iii) содержат вариабельный домен легкой цепи, по меньшей мере на 90% идентичный аминокислотной последовательности SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63.

48. Композиция по любому из вариантов осуществления 38-43, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают AT, содержат вариабельный домен тяжелой цепи, который имеет аминокислотную последовательность SEQ ID NO: 20, 22, 24, 26, 28, 41, 43, 45, 47, 49, 51, 53, 55, 57, 79, 59, 61 или 62, и (iii) содержит вариабельный домен легкой цепи, который имеет аминокислотную последовательность SEQ ID NO: 19, 21, 23, 25, 27, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60 или 63.

49. Композиция по любому из вариантов осуществления 38-48, где CDR1 VH, CDR2 VH, CDR3 VH, CDR1 VL, CDR2 VL и CDR3 VL выделенного антитела или его антигенсвязывающего фрагмента, которые специфично связывают AT, соответствуют аминокислотным последовательностям SEQ ID NO: 69, 70, 71, 1, 2 и 68.

50. Композиция по любому из вариантов осуществления 38-49, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают AT, содержат вариабельный домен тяжелой цепи, который имеет аминокислотную последовательность SEQ ID NO: 57, и содержат вариабельный домен легкой цепи, причем домен имеет аминокислотную последовательность SEQ ID NO: 58.

51. Композиция по любому из вариантов осуществления 38-50, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают AT, дополнительно содержат вариантную Fc-область.

52. Композиция по варианту осуществления 51, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают AT, содержат: 130 и SEQ ID NO: 131.

53. Композиция по любому из вариантов осуществления 30 или 40-41, дополнительно содержащая выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связываются с ClfA.

54. Композиция по варианту осуществления 53, где выделенное антитело или его антигенсвязывающий фрагмент, которые специфично связывают ClfA, является антителом или его антигенсвязывающим фрагментом по любому из вариантов осуществления 21-35.

55. Способ определения наличия S. aureus в тестируемом образце, включающий приведение тестируемого образца в контакт с выделенным антителом или его антигенсвязывающим фрагментом по любому из вариантов осуществления 1-15 или 21-34 и детектируемой меткой.

56. Способ по варианту осуществления 55, включающий:

a. приведение тестируемого образца в контакт с антителом или его антигенсвязывающим фрагментом, при этом антитело или его антигенсвязывающий фрагмент связываются с антигеном S. aureus, являющимся поверхностной детерминантой, с образованием первого комплекса;

b. приведение комплекса в контакт с детектируемой меткой, при этом детектируемая метка связывается с антителом или его антигенсвязывающим фрагментом или с антигеном с образованием второго комплекса; и

c. детектирование наличия S. aureus в тестируемом образце на основании сигнала, создаваемого детектируемой меткой во втором комплексе, при этом наличие S. aureus прямо коррелирует с сигналом, создаваемым детектируемой меткой.

57. Способ по варианту осуществления 55, включающий:

a. приведение тестируемого образца в контакт с антителом или его антигенсвязывающим фрагментом, при этом антитело или его антигенсвязывающий фрагмент связываются с антигеном S. aureus, являющимся поверхностной детерминантой с тем, чтобы образовать первый комплекс;

b. приведение комплекса в контакт с детектируемой меткой, при этом детектируемая метка конкурирует с антигеном за связывание с антителом или его антигенсвязывающим фрагментом с тем, чтобы образовать второй комплекс; и

c. детектирование наличия S. aureus в тестируемом образце на основании сигнала, создаваемого детектируемой меткой во втором комплексе, при этом наличие S. aureus опосредованно коррелирует с сигналом, создаваемым детектируемой меткой.

58. Способ по любому из вариантов осуществления 55-57, где образец является образцом пациента, и способ дополнительно включает диагностику пациента с инфекцией S. aureus.

59. Способ по любому из вариантов осуществления 55-58, где способ адаптируют для применения в автоматической системе или полуавтоматической системе.

60. Способ определения наличия S. aureus в тестируемом образце, включающий приведение тестируемого образца в контакт с композицией по п. 19 или 36 и по меньшей мере одной детектируемой меткой.

61. Способ по варианту осуществления 60, включающий:

a. приведение тестируемого образца в контакт с композицией по варианту осуществления 13, при этом композиция связывается с антигеном S. aureus, являющимся поверхностной детерминантой, и с полипептидом секретируемого токсина S. aureus;

b. приведение тестируемого образца в контакт по меньшей мере с одной детектируемой меткой, при этом по меньшей мере одна детектируемая метка связывается с антигеном, являющимся поверхностной детерминантой, секретируемым токсином или антителом или его антигенсвязывающим фрагментом, которые связаны с антигеном, являющимся поверхностной детерминантой, или секретируемым токсином; и

c. детектирование наличия S. aureus в тестируемом образце на основании сигнала, создаваемого по меньшей мере одной детектируемой меткой, при этом наличие S. aureus прямо коррелирует с сигналом, создаваемым по меньшей мере одной детектируемой меткой.

62. Способ по варианту осуществления 60, включающий:

a. приведение тестируемого образца в контакт с композицией по варианту осуществления 13, при этом композиция связывается с антигеном S. aureus, являющимся поверхностной детерминантой, и с полипептидом секретируемого токсина S. aureus;

b. приведение тестируемого образца в контакт по меньшей мере с одной детектируемой меткой, причем по меньшей мере одна детектируемая метка конкурирует с антигеном, являющимся поверхностной детерминантой, или секретируемым токсином за связывание с антителом в композиции по варианту осуществления 13; и

c. детектирование наличия S. aureus в тестируемом образце на основании сигнала, создаваемого по меньшей мере одной детектируемой меткой, при этом наличие S. aureus опосредованно коррелирует с сигналом, создаваемым по меньшей мере одной детектируемой меткой.

63. Способ по любому из вариантов осуществления 60-62, где образец является образцом пациента, и способ дополнительно включает диагностику пациента с инфекцией S. aureus.

64. Способ по любому из вариантов осуществления 60-63, где способ адаптируют для применения в автоматической системе или полуавтоматической системе.

65. Способ лечения инфекции S. aureus у пациента, включающий введение пациенту выделенного антитела или его антигенсвязывающего фрагмента по любому из вариантов осуществления 1-18 или 21-35 или композиции по любому из вариантов осуществления 19, 36 или 38-54.

66. Способ предупреждения или уменьшения тяжести связанного с S. aureus-сепсиса у пациента, включающий введение пациенту выделенного антитела или его антигенсвязывающего фрагмента по любому из вариантов осуществления 1-18 или 21-35, или композиции по любому из вариантов осуществления 19, 36 или 38-54.

67. Способ замедления начала сепсиса, связанного с инфекцией S. aureus, у пациента, включающий введение пациенту выделенного антитела или его антигенсвязывающего фрагмента по любому из вариантов осуществления 1-18 или 21-35 или композиции по любому из вариантов осуществления 19, 36 или 38-54.

68. Способ предупреждения начала сепсиса, связанного с инфекцией S. aureus, у пациента, включающий введение пациенту выделенного антитела или его антигенсвязывающего фрагмента по любому из вариантов осуществления 1-18 или 21-35 или композиции по любому из вариантов осуществления 19, 36 или 38-54.

69. Способ уменьшения бактериальной нагрузки S. aureus в кровотоке или сердце пациента, включающий введение указанному пациенту эффективного количества выделенного антитела или его антигенсвязывающего фрагмента по любому из вариантов осуществления 1-18.

70. Способ уменьшения агглютинации бактерий S. aureus и/или формирования очагов тромбоэмболического поражения у пациента, включающий введение указанному пациенту эффективного количества выделенного антитела или его антигенсвязывающего фрагмента по любому из вариантов осуществления 1-18.

71. Способ по любому из вариантов осуществления 65-70, дополнительно включающий введение пациенту антибиотика.

72. Способ по варианту осуществления 69, где антибиотиком является пенициллин, оксациллин, флуклоксациллин или ванкомицин.

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

<110> MEDIMMUNE, LLC

<120> АНТИТЕЛА К ПОВЕРХНОСТНЫМ ДЕТЕРМИНАНТАМ S. AUREUS

<130> ATOX-150WO1

<140> PCT/US2013/068624

<141> 2013-11-06

<150> 61/782,405

<151> 2013-03-14

<150> 61/723,137

<151> 2012-11-06

<160> 148

<170> PatentIn версия 3.5

<210> 1

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 1

Arg Ala Ser Gln Ser Ile Ser Ser Trp Leu Ala

1 5 10

<210> 2

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 2

Lys Ala Ser Ser Leu Glu Ser

1 5

<210> 3

<211> 8

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 3

Gln Gln Tyr Asn Ser Tyr Trp Thr

1 5

<210> 4

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 4

Arg Ala Ser Gln Gly Ile Arg Asn Asp Leu Gly

1 5 10

<210> 5

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 5

Asp Ala Ser Ser Leu Gln Ser

1 5

<210> 6

<211> 9

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 6

Leu Gln Asp Tyr Asn Tyr Pro Trp Thr

1 5

<210> 7

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 7

Ser Tyr Asp Met His

1 5

<210> 8

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 8

Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys Gly

1 5 10 15

<210> 9

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 9

Asp Asn Tyr Ser Ser Thr Gly Gly Tyr Tyr Gly Met Asp Val

1 5 10

<210> 10

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 10

Arg Tyr Asp Met His

1 5

<210> 11

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 11

Val Ile Gly Thr Asp Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys Gly

1 5 10 15

<210> 12

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 12

Asp Arg Tyr Ser Ser Ser Asn His Tyr Asn Gly Met Asp Val

1 5 10

<210> 13

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 13

Ser Tyr Ala Met Thr

1 5

<210> 14

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 14

Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys

1 5 10 15

Gly

<210> 15

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 15

Asp Gly Arg Gln Val Glu Asp Tyr Tyr Tyr Tyr Tyr Gly Met Asp Val

1 5 10 15

<210> 16

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 16

Asp Arg Tyr Ser Pro Thr Gly His Tyr Met Gly Met Asp Val

1 5 10

<210> 17

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 17

Val Ile Asp Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys Gly

1 5 10 15

<210> 18

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 18

Asp Arg Tyr Ser Gly Asn Phe His Tyr Asn Gly Met Asp Val

1 5 10

<210> 19

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 19

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asn Ser Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 20

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 20

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Leu Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Phe Cys Ala

85 90 95

Arg Asp Asn Tyr Ser Ser Thr Gly Gly Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 21

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 21

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asn Ser Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 22

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 22

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Val Ile Gly Thr Asp Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Ile Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Glu Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Ser Ser Asn His Tyr Asn Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 23

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 23

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Val Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asn Ser Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 24

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 24

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Val Ile Gly Thr Asp Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Ile Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Glu Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Ser Ser Asn His Tyr Asn Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 25

<211> 107

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 25

Ala Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn Asp

20 25 30

Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Asp Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Asp Tyr Asn Tyr Pro Trp

85 90 95

Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 26

<211> 125

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 26

Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val

50 55 60

Lys Gly Arg Phe Thr Val Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Lys Asp Gly Arg Gln Val Glu Asp Tyr Tyr Tyr Tyr Tyr Gly Met

100 105 110

Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120 125

<210> 27

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 27

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asn Ser Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 28

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 28

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Val Ile Asp Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Val

85 90 95

Arg Asp Arg Tyr Ser Gly Asn Phe His Tyr Asn Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 29

<211> 318

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 29

gacatccaga tgacccagtc tccttccacc ctgtctgcat ctgtaggaga cagagtcacc 60

atcacttgcc gggccagtca gagtattagt agctggttgg cctggtatca gcagaaacca 120

gggaaagccc ctaaactcct gatctataag gcgtctagtt tagaaagtgg ggtcccatca 180

aggttcagcg gcagtggatc tgggacagaa ttcactctca ccatcagcag cctgcagcct 240

gatgattttg caacttatta ctgccaacag tataatagtt attggacgtt cggccaaggg 300

accaaggtgg aaatcaaa 318

<210> 30

<211> 366

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 30

gaggtgcagc tggtggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60

tcctgtgcag cctctggatt caccttcagt agctacgaca tgcactgggt ccgccaagct 120

acaggaaaag gtctggagtg ggtctcaggt attggcactg ctggtgacac atattatcca 180

ggctccgtga agggccgatt caccatctcc agagaaaatg ccaagaactc cttgtatctt 240

caattgaaca gcctgagagc cggggacacg gctgtgtact tctgtgcaag agacaattat 300

agcagcaccg gggggtacta cggtatggac gtctggggcc aagggaccac ggtcaccgtc 360

tcctca 366

<210> 31

<211> 318

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 31

gacatccaga tgacccagtc tccttccacc ctgtctgcat ctgtaggaga cagagtcacc 60

atcacttgcc gggccagtca gagtattagt agctggttgg cctggtatca gcagaaacca 120

gggaaagccc ctaaactcct gatctataag gcgtctagtt tagaaagtgg ggtcccatca 180

aggttcagcg gcagtggatc tgggacagaa ttcactctca ccatcagcag cctgcagcct 240

gatgattttg caacttatta ctgccaacag tataatagtt attggacgtt cggccaaggg 300

accaaggtgg aaatcaaa 318

<210> 32

<211> 366

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 32

gaggtgcagc tggtggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60

tcctgtgcag cctctggatt caccttcagt aggtacgaca tgcactgggt ccgccaagct 120

acaggaaaag gtctggagtg ggtctcagtt attggtactg atggtgacac atactatcca 180

ggctccgtga agggccgatt catcatctcc agagaaaatg ccaagaactc cttgtatctt 240

gaaatgaaca gcctgagagc cggggacacg gctgtgtatt actgtgcaag agatcggtat 300

agcagctcga accactacaa cggtatggac gtctggggcc aagggaccac ggtcaccgtc 360

tcctca 366

<210> 33

<211> 318

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 33

gacatccaga tgacccagtc tccttccacc ctgtctgcat ctgtaggaga cagagtcacc 60

atcacttgcc gggccagtca gagtattagt agctggttgg cctggtatca gcagaaacca 120

gggaaagccc ctaaggtcct gatctataag gcgtctagtt tagaaagtgg ggtcccatca 180

aggttcagcg gcagtggatc tgggacagaa ttcactctca ccatcagcag cctgcagcct 240

gatgattttg caacttatta ctgccaacag tataatagtt attggacgtt cggccaaggg 300

accaaggtgg aaatcaaa 318

<210> 34

<211> 366

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 34

gaggtgcagc tggtggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60

tcctgtgcag cctctggatt caccttcagt aggtacgaca tgcactgggt ccgccaagct 120

acaggaaaag gtctggagtg ggtctcagtt attggtactg atggtgacac atactatcca 180

ggctccgtga agggccgatt catcatctcc agagaaaatg ccaagaactc cttgtatctt 240

gaaatgaaca gcctgagagc cggggacacg gctgtgtatt actgtgcaag agatcggtat 300

agcagctcga accactacaa cggtatggac gtctggggcc aagggaccac ggtcaccgtc 360

tcctca 366

<210> 35

<211> 321

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 35

gccatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60

atcacttgcc gggcaagtca gggcattaga aatgatttag gctggtatca gcagaaacca 120

gggaaagccc ctaagctcct gatctatgat gcatccagtt tacaaagtgg ggtcccatca 180

aggttcagcg gcagtggatc tggcacagat ttcactctca ccatcagcag cctgcagcct 240

gaagattttg caacttatta ctgtctacaa gattacaatt acccgtggac gttcggccaa 300

gggaccaagg tggaaatcaa a 321

<210> 36

<211> 375

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 36

gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60

tcctgtgcag cctctggatt cacctttagc agctatgcca tgacctgggt ccgccaggct 120

ccagggaagg ggctggaatg ggtctcagtt attagtggta gtggtggtag cacatactac 180

gcagactccg tgaagggccg gttcaccgtc tccagagaca attccaagaa cacgctgtat 240

ctgcaaatga acagcctgag agccgaggac acggccgtat attactgtgc gaaagatggg 300

aggcaggtcg aggattacta ctactactac ggtatggacg tctggggcca agggaccacg 360

gtcaccgtct cctca 375

<210> 37

<211> 318

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 37

gacatccaga tgacccagtc tccttccacc ctgtctgcat ctgtaggaga cagagtcacc 60

atcacttgcc gggccagtca gagtattagt agctggttgg cctggtatca gcagaaacca 120

gggaaagccc ctaagctcct gatctataag gcgtctagtt tagaaagtgg ggtcccatca 180

aggttcagcg gcagtggatc tgggacagaa ttcactctca ccatcagcag cctgcagcct 240

gatgattttg caacttatta ctgccaacag tataatagtt attggacgtt cggccaaggg 300

accaaggtgg aaatcaaa 318

<210> 38

<211> 366

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 38

gaggtgcagc tggtggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60

tcctgtacag cctctggatt caccttcagt agttacgaca tgcactgggt ccgccaagct 120

acaggaaaag gtctggagtg ggtctcagtt attgatactg ctggtgacac atactatcca 180

ggctccgtga agggccgatt caccatctcc agagaaaatg ccaagaactc cttgtatctt 240

caaatgaaca gcctgagagc cggggacacg gctgtgtatt actgtgtaag agataggtat 300

agtgggaact tccactacaa cggtatggac gtctggggcc aagggaccac ggtcaccgtc 360

tcctca 366

<210> 39

<211> 293

<212> БЕЛОК

<213> Staphylococcus aureus

<400> 39

Ala Asp Ser Asp Ile Asn Ile Lys Thr Gly Thr Thr Asp Ile Gly Ser

1 5 10 15

Asn Thr Thr Val Lys Thr Gly Asp Leu Val Thr Tyr Asp Lys Glu Asn

20 25 30

Gly Met His Lys Lys Val Phe Tyr Ser Phe Ile Asp Asp Lys Asn His

35 40 45

Asn Lys Lys Leu Leu Val Ile Arg Thr Lys Gly Thr Ile Ala Gly Gln

50 55 60

Tyr Arg Val Tyr Ser Glu Glu Gly Ala Asn Lys Ser Gly Leu Ala Trp

65 70 75 80

Pro Ser Ala Phe Lys Val Gln Leu Gln Leu Pro Asp Asn Glu Val Ala

85 90 95

Gln Ile Ser Asp Tyr Tyr Pro Arg Asn Ser Ile Asp Thr Lys Glu Tyr

100 105 110

Met Ser Thr Leu Thr Tyr Gly Phe Asn Gly Asn Val Thr Gly Asp Asp

115 120 125

Thr Gly Lys Ile Gly Gly Leu Ile Gly Ala Asn Val Ser Ile Gly His

130 135 140

Thr Leu Lys Tyr Val Gln Pro Asp Phe Lys Thr Ile Leu Glu Ser Pro

145 150 155 160

Thr Asp Lys Lys Val Gly Trp Lys Val Ile Phe Asn Asn Met Val Asn

165 170 175

Gln Asn Trp Gly Pro Tyr Asp Arg Asp Ser Trp Asn Pro Val Tyr Gly

180 185 190

Asn Gln Leu Phe Met Lys Thr Arg Asn Gly Ser Met Lys Ala Ala Asp

195 200 205

Asn Phe Leu Asp Pro Asn Lys Ala Ser Ser Leu Leu Ser Ser Gly Phe

210 215 220

Ser Pro Asp Phe Ala Thr Val Ile Thr Met Asp Arg Lys Ala Ser Lys

225 230 235 240

Gln Gln Thr Asn Ile Asp Val Ile Tyr Glu Arg Val Arg Asp Asp Tyr

245 250 255

Gln Leu His Trp Thr Ser Thr Asn Trp Lys Gly Thr Asn Thr Lys Asp

260 265 270

Lys Trp Thr Asp Arg Ser Ser Glu Arg Tyr Lys Ile Asp Trp Glu Lys

275 280 285

Glu Glu Met Thr Asn

290

<210> 40

<211> 293

<212> БЕЛОК

<213> Staphylococcus aureus

<400> 40

Ala Asp Ser Asp Ile Asn Ile Lys Thr Gly Thr Thr Asp Ile Gly Ser

1 5 10 15

Asn Thr Thr Val Lys Thr Gly Asp Leu Val Thr Tyr Asp Lys Glu Asn

20 25 30

Gly Met Leu Lys Lys Val Phe Tyr Ser Phe Ile Asp Asp Lys Asn His

35 40 45

Asn Lys Lys Leu Leu Val Ile Arg Thr Lys Gly Thr Ile Ala Gly Gln

50 55 60

Tyr Arg Val Tyr Ser Glu Glu Gly Ala Asn Lys Ser Gly Leu Ala Trp

65 70 75 80

Pro Ser Ala Phe Lys Val Gln Leu Gln Leu Pro Asp Asn Glu Val Ala

85 90 95

Gln Ile Ser Asp Tyr Tyr Pro Arg Asn Ser Ile Asp Thr Lys Glu Tyr

100 105 110

Met Ser Thr Leu Thr Tyr Gly Phe Asn Gly Asn Val Thr Gly Asp Asp

115 120 125

Thr Gly Lys Ile Gly Gly Leu Ile Gly Ala Asn Val Ser Ile Gly His

130 135 140

Thr Leu Lys Tyr Val Gln Pro Asp Phe Lys Thr Ile Leu Glu Ser Pro

145 150 155 160

Thr Asp Lys Lys Val Gly Trp Lys Val Ile Phe Asn Asn Met Val Asn

165 170 175

Gln Asn Trp Gly Pro Tyr Asp Arg Asp Ser Trp Asn Pro Val Tyr Gly

180 185 190

Asn Gln Leu Phe Met Lys Thr Arg Asn Gly Ser Met Lys Ala Ala Asp

195 200 205

Asn Phe Leu Asp Pro Asn Lys Ala Ser Ser Leu Leu Ser Ser Gly Phe

210 215 220

Ser Pro Asp Phe Ala Thr Val Ile Thr Met Asp Arg Lys Ala Ser Lys

225 230 235 240

Gln Gln Thr Asn Ile Asp Val Ile Tyr Glu Arg Val Arg Asp Asp Tyr

245 250 255

Gln Leu His Trp Thr Ser Thr Asn Trp Lys Gly Thr Asn Thr Lys Asp

260 265 270

Lys Trp Thr Asp Arg Ser Ser Glu Arg Tyr Lys Ile Asp Trp Glu Lys

275 280 285

Glu Glu Met Thr Asn

290

<210> 41

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 41

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Pro Thr Gly His Tyr Met Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 42

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 42

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asp Thr Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 43

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 43

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Arg Thr Gly His Tyr Met Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 44

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 44

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asp Thr Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 45

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 45

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Arg Thr Gly His Tyr Met Gly Met Ser Leu Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 46

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 46

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asp Thr Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 47

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 47

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Asn Tyr Ser Arg Thr Gly His Tyr Met Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 48

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 48

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Lys Gln Tyr Ala Asp Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 49

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 49

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Asn Tyr Ser Arg Thr Gly His Tyr Met Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 50

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 50

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asp Thr Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 51

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 51

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Pro Thr Gly His Tyr Met Gly Met Ser Leu Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 52

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 52

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asp Thr Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 53

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 53

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Arg Thr Gly His Tyr Met Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 54

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 54

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Lys Gln Tyr Ala Asp Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 55

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 55

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Asn Tyr Ser Ser Thr Gly Gly Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 56

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 56

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asn Ser Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 57

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 57

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Asp Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Pro Thr Gly His Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 58

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 58

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Lys Gln Tyr Ala Asp Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 59

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 59

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Asn Tyr Ser Pro Thr Gly Gly Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 60

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 60

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Lys Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Glu Ser Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 61

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 61

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Arg Gly Asp Thr Tyr Tyr Pro Asp Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Pro Thr Gly His Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 62

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 62

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Arg Gly Asp Thr Tyr Tyr Pro Asp Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Lys Tyr Ser Pro Thr Gly His Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 63

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 63

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Val Lys Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Glu Ser Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 64

<211> 8

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 64

Gln Gln Tyr Asp Thr Tyr Trp Thr

1 5

<210> 65

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 65

Asp Arg Tyr Ser Arg Thr Gly His Tyr Met Gly Met Asp Val

1 5 10

<210> 66

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 66

Asp Arg Tyr Ser Arg Thr Gly His Tyr Met Gly Met Ser Leu

1 5 10

<210> 67

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 67

Asp Asn Tyr Ser Arg Thr Gly His Tyr Met Gly Met Asp Val

1 5 10

<210> 68

<211> 8

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 68

Lys Gln Tyr Ala Asp Tyr Trp Thr

1 5

<210> 69

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 69

Ser His Asp Met His

1 5

<210> 70

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 70

Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Asp Ser Val Lys Gly

1 5 10 15

<210> 71

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 71

Asp Arg Tyr Ser Pro Thr Gly His Tyr Tyr Gly Met Asp Val

1 5 10

<210> 72

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 72

Asp Asn Tyr Ser Pro Thr Gly Gly Tyr Tyr Gly Met Asp Val

1 5 10

<210> 73

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 73

Lys Ala Ser Ser Leu Lys Ser

1 5

<210> 74

<211> 8

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 74

Gln Gln Tyr Glu Ser Tyr Trp Thr

1 5

<210> 75

<211> 16

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 75

Gly Ile Gly Thr Arg Gly Asp Thr Tyr Tyr Pro Asp Ser Val Lys Gly

1 5 10 15

<210> 76

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 76

Asp Lys Tyr Ser Pro Thr Gly His Tyr Tyr Gly Met Asp Val

1 5 10

<210> 77

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 77

Lys Ala Ser Ser Leu Val Lys

1 5

<210> 78

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 78

Asp Arg Tyr Ser Pro Thr Gly His Tyr Met Gly Met Ser Leu

1 5 10

<210> 79

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 79

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Asp Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Pro Thr Gly His Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 80

<211> 118

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 80

Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Pro Tyr

20 25 30

Met Met Gln Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Ser Ile Trp Pro Ser Gly Gly Lys Thr Tyr Tyr Ala Asp Ser Val

50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Val Arg Arg Gly Gly Ala Thr Asp Tyr Trp Gly Gln Gly Thr

100 105 110

Leu Val Thr Val Ser Ser

115

<210> 81

<211> 108

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 81

Asp Ile Gln Met Thr Gln Ser Pro Ala Thr Leu Ser Val Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Asn

20 25 30

Leu Gly Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile

35 40 45

Tyr Gly Ala Ser Thr Arg Ala Thr Gly Ile Pro Thr Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Ser

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Gln Asn Trp Pro Leu

85 90 95

Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys

100 105

<210> 82

<211> 119

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 82

Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr

20 25 30

Tyr Met Trp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Val Ile Gly Pro Ser Gly Gly Pro Thr Gln Tyr Ala Asp Ser Val

50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Trp Gly Gly Arg Tyr Ser Val Phe Glu Thr Trp Gly Gln Gly

100 105 110

Thr Met Val Thr Val Ser Ser

115

<210> 83

<211> 106

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 83

Asp Ile Gln Met Thr Gln Ser Pro Ala Thr Leu Ser Val Ser Pro Gly

1 5 10 15

Gly Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Arg Lys Asn

20 25 30

Val Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Arg Leu Leu Ile

35 40 45

Tyr Gly Ala Ser Thr Arg Ala Thr Gly Val Pro Ala Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Arg Met Gln Pro

65 70 75 80

Glu Asp Phe Val Val Tyr His Cys Gln Gln Tyr Ser Ser Trp Pro Ala

85 90 95

Phe Gly Gln Gly Thr Met Val Glu Ile Asn

100 105

<210> 84

<211> 118

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 84

Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr

20 25 30

Phe Met Gly Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Ser Ile Tyr Ser Ser Gly Gly Tyr Thr Ser Tyr Ala Asp Ser Val

50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Arg Trp Arg Asp Gly Thr Phe Asp Tyr Trp Gly Gln Gly Thr

100 105 110

Leu Val Thr Val Ser Ser

115

<210> 85

<211> 107

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 85

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Ile Gly

1 5 10 15

Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Ser Val Arg Glu Tyr

20 25 30

Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Phe Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Arg Phe

85 90 95

Thr Phe Gly Pro Gly Thr Lys Val Asp Ile Lys

100 105

<210> 86

<211> 124

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 86

Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser Ser Tyr

20 25 30

Pro Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met

35 40 45

Gly Lys Ile Ile Pro Ile Phe Gly Thr Thr Asn Tyr Ala Gln Lys Phe

50 55 60

Gln Gly Arg Val Thr Ile Thr Ala Asp Glu Ser Thr Ser Thr Ala Tyr

65 70 75 80

Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Ile Tyr Tyr Cys

85 90 95

Ala Ser Pro Asn Arg Pro Tyr Asn Ile Gly Trp His Tyr Tyr Phe Asp

100 105 110

Tyr Trp Gly Lys Gly Thr Leu Val Thr Val Ser Ser

115 120

<210> 87

<211> 110

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 87

Gln Ser Val Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln

1 5 10 15

Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr

20 25 30

Asn Tyr Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu

35 40 45

Met Ile Tyr Glu Gly Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe

50 55 60

Ser Gly Ser Arg Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu

65 70 75 80

Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Ser Ser Tyr Thr Thr Arg

85 90 95

Ser Thr Arg Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu

100 105 110

<210> 88

<211> 126

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 88

Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val

50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Asp Gln Asp Glu Gly Arg Ala Asn Asn Trp Trp Ile Pro Pro

100 105 110

Gly Gly Arg Trp Gly Gln Gly Thr Met Val Thr Val Ser Ser

115 120 125

<210> 89

<211> 109

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 89

Ser Ser Glu Leu Thr Gln Asp Pro Thr Leu Ser Val Ala Leu Gly Gln

1 5 10 15

Thr Val Arg Ile Thr Cys Gln Gly Asp Ser Leu Arg Arg Ser Phe Ala

20 25 30

Ser Trp Tyr Gln Lys Lys Pro Gly Gln Ala Pro Val Leu Leu Ile Tyr

35 40 45

Gly Gln Asn Lys Arg Pro Ala Gly Ile Pro Asp Arg Phe Ser Gly Ser

50 55 60

Arg Ser Gly Asn Ser Ala Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu

65 70 75 80

Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Arg Asp Ala Arg Leu Asn Pro

85 90 95

Tyr Ile Leu Phe Gly Gly Gly Thr Lys Leu Thr Val Leu

100 105

<210> 90

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 90

Pro Tyr Met Met Gln

1 5

<210> 91

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 91

Ser Ile Trp Pro Ser Gly Gly Lys Thr Tyr Tyr Ala Asp Ser Val Lys

1 5 10 15

Gly

<210> 92

<211> 9

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 92

Val Arg Arg Gly Gly Ala Thr Asp Tyr

1 5

<210> 93

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 93

Arg Ala Ser Gln Ser Val Ser Ser Asn Leu Gly

1 5 10

<210> 94

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 94

Gly Ala Ser Thr Arg Ala Thr

1 5

<210> 95

<211> 10

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 95

Gln Gln Tyr Gln Asn Trp Pro Leu Leu Thr

1 5 10

<210> 96

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 96

Asn Tyr Tyr Met Trp

1 5

<210> 97

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 97

Val Ile Gly Pro Ser Gly Gly Pro Thr Gln Tyr Ala Asp Ser Val Lys

1 5 10 15

Gly

<210> 98

<211> 10

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 98

Trp Gly Gly Arg Tyr Ser Val Phe Glu Thr

1 5 10

<210> 99

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 99

Arg Ala Ser Gln Ser Val Arg Lys Asn Val Ala

1 5 10

<210> 100

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 100

Gly Ala Ser Thr Arg Ala Thr

1 5

<210> 101

<211> 9

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 101

Gln Gln Tyr Ser Ser Trp Pro Ala Phe

1 5

<210> 102

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 102

Arg Tyr Phe Met Gly

1 5

<210> 103

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 103

Ser Ile Tyr Ser Ser Gly Gly Tyr Thr Ser Tyr Ala Asp Ser Val Lys

1 5 10 15

Gly

<210> 104

<211> 9

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 104

Arg Trp Arg Asp Gly Thr Phe Asp Tyr

1 5

<210> 105

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 105

Arg Ala Ser Gln Ser Val Arg Glu Tyr Leu Asn

1 5 10

<210> 106

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 106

Ala Ala Ser Ser Leu Gln Ser

1 5

<210> 107

<211> 9

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 107

Gln Gln Ser Tyr Ser Thr Arg Phe Thr

1 5

<210> 108

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 108

Ser Tyr Pro Ile Ser

1 5

<210> 109

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 109

Lys Ile Ile Pro Ile Phe Gly Thr Thr Asn Tyr Ala Gln Lys Phe Gln

1 5 10 15

Gly

<210> 110

<211> 15

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 110

Pro Asn Arg Pro Tyr Asn Ile Gly Trp His Tyr Tyr Phe Asp Tyr

1 5 10 15

<210> 111

<211> 14

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 111

Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Tyr Val Ser

1 5 10

<210> 112

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 112

Glu Gly Ser Lys Arg Pro Ser

1 5

<210> 113

<211> 10

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 113

Ser Ser Tyr Thr Thr Arg Ser Thr Arg Val

1 5 10

<210> 114

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 114

Ser Tyr Ala Met Ser

1 5

<210> 115

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 115

Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys

1 5 10 15

Gly

<210> 116

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 116

Asp Gln Asp Glu Gly Arg Ala Asn Asn Trp Trp Ile Pro Pro Gly Gly

1 5 10 15

Arg

<210> 117

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 117

Gln Gly Asp Ser Leu Arg Arg Ser Phe Ala Ser

1 5 10

<210> 118

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 118

Gly Gln Asn Lys Arg Pro Ala

1 5

<210> 119

<211> 12

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 119

Asn Ser Arg Asp Ala Arg Leu Asn Pro Tyr Ile Leu

1 5 10

<210> 120

<211> 354

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 120

gaagttcaat tgttagagtc tggtggcggt cttgttcagc ctggtggttc tttacgtctt 60

tcttgcgctg cttccggatt cactttctct ccttacatga tgcagtgggt tcgccaagct 120

cctggtaaag gtttggagtg ggtttcttct atctggcctt ctggtggcaa gacttattat 180

gctgactccg ttaaaggtcg cttcactatc tctagagaca actctaagaa tactctctac 240

ttgcagatga acagcttaag ggctgaggac acggccgtgt attactgtgc gagagtgcgg 300

agggggggag ctactgacta ctggggccag ggaaccctgg tcaccgtctc aagc 354

<210> 121

<211> 324

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 121

gacatccaga tgacccagtc tccagccacc ctgtctgtgt ctccagggga aagagccacc 60

ctctcctgca gggccagtca gagtgttagc agcaacttag gctggtacca gcagaaacct 120

ggccaggctc ccaggctcct catctatggt gcatccacca gggccactgg tatcccaacc 180

aggttcagtg gcagtgggtc tgggacagag ttcactctca ccatcagcag cctgcagtct 240

gaagattttg caacttatta ctgtcagcag tatcagaact ggcccttgct cactttcggc 300

ggagggacca aggtggaaat caaa 324

<210> 122

<211> 357

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 122

gaagttcaat tgttagagtc tggtggcggt cttgttcagc ctggtggttc tttacgtctt 60

tcttgcgctg cttccggatt cactttctct aattactata tgtggtgggt tcgccaagct 120

cctggtaaag gtttggagtg ggtttctgtt atcggtcctt ctggtggccc tactcagtat 180

gctgactccg ttaaaggtcg cttcactatc tctagagaca actctaagaa tactctctac 240

ttgcagatga acagcttaag ggctgaggac acggccgtgt attactgtgc gagatggggt 300

gggaggtact ctgtatttga aacctggggc caagggacaa tggtcaccgt ctcaagc 357

<210> 123

<211> 318

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 123

gacatccaga tgacccagtc tccagccact ctgtctgtgt ctccaggggg aagagccacc 60

ctctcctgca gggccagtca gagtgttaga aaaaacgtag cctggtatca gcagaaacct 120

ggccagcctc ccaggctcct catctatggt gcatccacca gggccactgg tgtcccagcc 180

aggttcagtg gcagtgggtc tgggacagag ttcactctca ccatcagcag gatgcagcct 240

gaagattttg tagtttatca ctgtcagcag tatagtagct ggccggcgtt cggccagggg 300

accatggtgg aaatcaac 318

<210> 124

<211> 354

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 124

gaagttcaat tgttagagtc tggtggcggt cttgttcagc ctggtggttc tttacgtctt 60

tcttgcgctg cttccggatt cactttctct cgttacttta tgggttgggt tcgccaagct 120

cctggtaaag gtttggagtg ggtttcttct atctattctt ctggtggcta tacttcttat 180

gctgactccg ttaaaggtcg cttcactatc tctagagaca actctaagaa tactctctac 240

ttgcagatga acagcttaag ggctgaggac acggccgtgt attactgtgc gagacggtgg 300

cgagatggca cctttgacta ctggggccag ggaaccctgg tcaccgtctc aagc 354

<210> 125

<211> 321

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 125

gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctattggaga cagagtcacc 60

atctcttgcc gggcaagtca gagcgttaga gagtatctaa attggtatca acaaaaacca 120

gggaaagccc ctaaactcct gatctttgct gcatccagtt tgcagagtgg ggtcccatca 180

agattcagtg gcagtggatc tgggacagat ttcactctca ccatcagcag tctgcaacct 240

gaagattttg caacttatta ctgtcaacag agttacagta cccgattcac tttcggccct 300

gggaccaaag tggacatcaa a 321

<210> 126

<211> 372

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 126

caggtacagc tgcagcagtc aggggctgag gtgaagaagc ctgggtcctc ggtgaaggtc 60

tcctgcaagg cttctggagg caccttcagc agctatccta tcagctgggt gcgacaggcc 120

cctggacaag ggcttgagtg gatgggaaag atcatcccta tctttggtac aacaaactac 180

gcgcagaagt tccagggcag agtcacgatt accgcggacg aatccacgag cactgcctac 240

atggaactga gcagcctgag atctgaggac acggccatat attactgtgc gagccccaat 300

cgaccctata acattggctg gcactactac tttgactact ggggcaaagg aaccctggtc 360

accgtctcct ca 372

<210> 127

<211> 330

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 127

cagtctgtgc tgactcagcc tgcctccgtg tctgggtctc ctggacagtc gatcaccatc 60

tcctgcactg gaaccagcag tgacgttggt ggttataact atgtctcctg gtaccaacaa 120

cacccaggca aagcccccaa actcatgatt tatgagggca gtaagcggcc ctcaggggtt 180

tctaatcgct tctctggctc caggtctggc aacacggcct ccctgacaat ctctgggctc 240

caggctgagg acgaggctga ttattactgc agctcatata caaccaggag cactcgagtc 300

ttcggcggag ggaccaagct gaccgtccta 330

<210> 128

<211> 378

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 128

gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60

tcctgtgcag cctctggatt cacctttagc agctatgcca tgagctgggt ccgccaggct 120

ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac 180

gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240

ctgcaaatga acagcctgag agccgaggac acggccgtgt attactgtgc aagagatcag 300

gacgaaggta gagcgaacaa ctggtggatc ccccccgggg gtcgctgggg ccaggggaca 360

atggtcaccg tctcgagt 378

<210> 129

<211> 327

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полинуклеотид

<400> 129

tcttctgagc tgactcagga ccctactctg tctgtggccc tgggacagac agtcagaatc 60

acatgccaag gagacagcct ccgaagatct tttgcaagtt ggtaccagaa gaagccagga 120

caggcccctg tacttctcat ctatggtcaa aataagcggc ccgcagggat cccagaccga 180

ttctctggct ccaggtcagg aaactcagct tcgttgacca tcacaggggc tcaggcggaa 240

gatgaggctg actattactg taattcccgc gacgccagac ttaaccctta tatactcttc 300

ggcggtggga ccaagctgac cgtccta 327

<210> 130

<211> 452

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 130

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His

20 25 30

Asp Met His Trp Val Arg Gln Ala Thr Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Gly Ile Gly Thr Ala Gly Asp Thr Tyr Tyr Pro Asp Ser Val Lys

50 55 60

Gly Arg Phe Thr Ile Ser Arg Glu Asn Ala Lys Asn Ser Leu Tyr Leu

65 70 75 80

Gln Met Asn Ser Leu Arg Ala Gly Asp Thr Ala Val Tyr Tyr Cys Ala

85 90 95

Arg Asp Arg Tyr Ser Pro Thr Gly His Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro

115 120 125

Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr

130 135 140

Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr

145 150 155 160

Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro

165 170 175

Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr

180 185 190

Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn

195 200 205

His Lys Pro Ser Asn Thr Lys Val Asp Lys Arg Val Glu Pro Lys Ser

210 215 220

Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu

225 230 235 240

Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu

245 250 255

Tyr Ile Thr Arg Glu Pro Glu Val Thr Cys Val Val Val Asp Val Ser

260 265 270

His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu

275 280 285

Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr

290 295 300

Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn

305 310 315 320

Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro

325 330 335

Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln

340 345 350

Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val

355 360 365

Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val

370 375 380

Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro

385 390 395 400

Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr

405 410 415

Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val

420 425 430

Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu

435 440 445

Ser Pro Gly Lys

450

<210> 131

<211> 212

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 131

Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Trp

20 25 30

Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile

35 40 45

Tyr Lys Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Asp Asp Phe Ala Thr Tyr Tyr Cys Lys Gln Tyr Ala Asp Tyr Trp Thr

85 90 95

Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro

100 105 110

Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr

115 120 125

Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys

130 135 140

Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu

145 150 155 160

Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser

165 170 175

Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala

180 185 190

Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe

195 200 205

Asn Arg Gly Glu

210

<210> 132

<211> 122

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 132

Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Val Phe Thr Phe Ser Ser Tyr

20 25 30

Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ala Leu Ile Trp Phe Asp Gly Ser Asn Glu Tyr Tyr Ala Asp Ser Val

50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Asp Arg Gly Gly Gly Tyr Tyr Tyr Tyr Gly Met Asp Val Trp

100 105 110

Gly Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 133

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 133

Ser Tyr Gly Met His

1 5

<210> 134

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 134

Leu Ile Trp Phe Asp Gly Ser Asn Glu Tyr Tyr Ala Asp Ser Val Lys

1 5 10 15

Gly

<210> 135

<211> 12

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 135

Arg Gly Gly Gly Tyr Tyr Tyr Tyr Gly Met Asp Val

1 5 10

<210> 136

<211> 107

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 136

Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly

1 5 10 15

Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn Asp

20 25 30

Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Arg Leu Ile

35 40 45

Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro

65 70 75 80

Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln His Asn Ser Tyr Pro Tyr

85 90 95

Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys

100 105

<210> 137

<211> 11

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 137

Arg Ala Ser Gln Gly Ile Arg Asn Asp Leu Gly

1 5 10

<210> 138

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 138

Ala Ala Ser Ser Leu Gln Ser

1 5

<210> 139

<211> 9

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 139

Leu Gln His Asn Ser Tyr Pro Tyr Thr

1 5

<210> 140

<211> 121

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 140

Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Thr Ser Gly Tyr Thr Phe Thr Ser Tyr

20 25 30

Gly Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly His Glu Trp Met

35 40 45

Gly Trp Ile Ser Ser Tyr Asn Gly Asn Thr Asn Tyr Ala Gln Lys Leu

50 55 60

Gln Gly Arg Val Thr Met Thr Ser Asp Thr Ser Thr Ser Thr Ala Tyr

65 70 75 80

Met Glu Leu Arg Ser Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Ile Ala Ala Arg Gly Tyr Tyr Tyr Gly Met Asp Val Trp Gly

100 105 110

Gln Gly Thr Thr Val Thr Val Ser Ser

115 120

<210> 141

<211> 5

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 141

Ser Tyr Gly Ile Ser

1 5

<210> 142

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 142

Trp Ile Ser Ser Tyr Asn Gly Asn Thr Asn Tyr Ala Gln Lys Leu Gln

1 5 10 15

Gly

<210> 143

<211> 10

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 143

Ala Ala Arg Gly Tyr Tyr Tyr Gly Met Asp

1 5 10

<210> 144

<211> 108

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

полипептид

<400> 144

Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Ile Ser Gly Ser

20 25 30

Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu

35 40 45

Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser

50 55 60

Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu

65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Ser Ser Pro

85 90 95

Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys

100 105

<210> 145

<211> 12

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 145

Arg Ala Ser Gln Ser Ile Ser Gly Ser Tyr Leu Ala

1 5 10

<210> 146

<211> 7

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 146

Gly Ala Ser Ser Arg Ala Thr

1 5

<210> 147

<211> 9

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 147

Gln Gln Tyr Ser Ser Trp Pro Ala Phe

1 5

<210> 148

<211> 17

<212> БЕЛОК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: синтетическая

пептид

<400> 148

Ser Val Ile Asp Thr Ala Gly Asp Thr Tyr Tyr Pro Gly Ser Val Lys

1 5 10 15

Gly

1. Фармацевтическая композиция, содержащая выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с альфа-токсином (AT) S.aureus, и выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с антигеном S.aureus, являющимся поверхностной детерминантой, выбранным из группы, состоящей из IsdH и ClfA;

где VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 и VL CDR3 выделенного антитела или его антигенсвязывающего фрагмента, которое специфично связывается с AT, соответствуют аминокислотным последовательностям SEQ ID NO:69, 70, 71, 1, 2 и 68 соответственно;

где VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 и VL CDR3 выделенного антитела или его антигенсвязывающего фрагмента, которое специфично связывается с IsdH, соответствуют аминокислотным последовательностям SEQ ID NO:90, 91, 92, 93, 94 и 95 соответственно; и

где VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2 и VL CDR3 выделенного антитела или его антигенсвязывающего фрагмента, которое специфично связывается с ClfA, соответствуют аминокислотным последовательностям SEQ ID NO:141, 142, 143, 145, 146 и 147 соответственно.

2. Фармацевтическая композиция по п.1, в которой выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с AT, содержит вариабельный домен тяжелой цепи с аминокислотной последовательностью SEQ ID NO:57 и вариабельный домен легкой цепи с аминокислотной последовательностью SEQ ID NO:58.

3. Фармацевтическая композиция по п.1, в которой выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с AT, дополнительно содержит вариант Fc-области.

4. Фармацевтическая композиция по п.3, в которой выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с AT, содержит SEQ ID NO:130 и SEQ ID NO:131.

5. Фармацевтическая композиция по п.1, содержащая выделенное антитело или его антиген-связывающий фрагмент, которое специфически связывается с ClfA, и выделенное антитело или его антиген-связывающий фрагмент, которое специфически связывается с IsdH.

6. Способ лечения инфекции S.aureus у пациента, включающий введение пациенту композиции по п.1.

7. Способ уменьшения агглютинации бактерий S.aureus и/или формирования очагов тромбоэмболического поражения у пациента, включающий введение указанному пациенту композиции по п.1.

8. Способ по любому из пп.6 или 7, дополнительно включающий введение пациенту антибиотика.

9. Способ по п.8, где антибиотиком является пенициллин, оксациллин, флуклоксациллин или ванкомицин.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к линкерному звену, и может быть использовано в качестве сшивающего средства для объединения различных антител или иных биологически активных агентов в конъюгаты и построения молекулярных конструкций с конкретной комбинацией нацеливающих и эффекторных элементов с применением химического синтеза, либо рекомбинантной технологии.

Изобретение относится к области биохимии, в частности к вариабельным доменам тяжелой и легкой цепей мышиного антитела против интерферона альфа (IFN-α) человека. Также раскрыт антигенсвязывающий фрагмент (Fab), включающий указанные вариабельные домены.

Изобретение относится к композиция для применения в лечении глиобластомы, где указанная композиция содержит: (a) эффективное количество антитела, фрагмента антитела или диатела, которое обладает специфичностью в отношении В7-Н3, и (b) эффективное количество антитела или фрагмента антитела, которое обладает специфичностью в отношении VEGF или VEGFR.

Изобретение относится к области биохимии, в частности к антителу к TSLP-рецептору. Также раскрыты экспрессионный вектор, клетка-хозяин для получения указанного антитела.

Изобретение относится к области биотехнологии, конкретно к антителам и их антиген-связывающим фрагментам, сконструированным для связывания трансформирующего фактора роста-β (TGFβ1, TGFβ2 и TGFβ3), что может быть использовано в медицине.

Изобретение относится к биотехнологии. Описана выделенная мультиспецифическая гетеромультимерная конструкция для индуцирования киллинга В-клетки, содержащая: первую полипептидную конструкцию, содержащую CD3-связывающую полипептидную конструкцию, которая связывается с комплексом человека CD3 по меньшей мере на одной экспрессирующей CD3 клетке, при этом первая полипептидная конструкция представляет собой scFv-область; вторую полипептидную конструкцию, содержащую антигенсвязывающую полипептидную конструкцию, которая связывается с целевым антигеном человека CD19 по меньшей мере на одной В-клетке, при этом вторая полипептидная конструкция представляет собой Fab-область или scFv-область; и гетеродимерную Fc-область IgG1 человека, содержащую вариант домена СН3 иммуноглобулина, содержащий первую СН3 последовательность и вторую СН3 последовательность, первая СН3 последовательность содержит аминокислотные замены в L351, F405 и Y407, а вторая СН3 последовательность содержит аминокислотные замены в Т366, K392 и Т394, при этом аминокислотными заменами для L в L351 являются Y, F или W, для F в F405 являются А или G и для Y в Y407 являются V, М, L или I, а аминокислотными заменами для Т в Т366 являются L, I, М или V, для K в K392 являются М, I, L или V и для Т в Т394 являются W, Y или F, при этом и первая полипептидная конструкция, и вторая полипептидная конструкция связаны с N-концом гетеродимерной Fc-области IgG1 человека.

Изобретение относится к биохимии. Описано рекомбинантное антитело или его антигенсвязывающий фрагмент.

Изобретение относится к биохимии. Предложен способ получения мультиспецифической связывающей молекулы, содержащей по меньшей мере две связывающих группировки, такой как антитело, где способ включает культивирование клетки, содержащей нуклеиновую кислоту, кодирующую растворимую сортазу А из S.

Настоящая группа изобретений относится к биотехнологии и иммунологии. Предложены способы получения целевого антитела с модулированным галактозилированием (варианты), способы модулирования галактозилирования целевого антитела (варианты) путем оптимизации культуральной среды.

Изобретение относится к биотехнологии. Описано антитело, содержащее зрелую вариабельную область тяжелой цепи, содержащую три CDR по Кабату (Kabat), из последовательности SEQ ID NO: 44, и по меньшей мере на 90% идентичную последовательности SEQ ID NO: 44, и легкую цепь, содержащую три CDR по Кабату, из последовательности SEQ ID NO: 45, и по меньшей мере на 90% идентичную последовательности SEQ ID NO: 45, где антитело специфически связывается с человеческим альфа-синуклеином.

Настоящее изобретение относится к биотехнологии, а именно к мышиным моноклональным антителам, которые соответствуют моноклональным антителам, выделяемым клеточными линиями гибридом 3G8/C11 и 7G4/A12, и которые реагируют на М-антиген hMPV.

Настоящее изобретение относится к ингибированию прогрессирования структурных повреждений у пациентов с псориатическим артритом. Описан способ такого ингибирования, в котором ежемесячно подкожно вводят примерно 150 мг или примерно 300 мг анти-IL-17 антитела с соответствующими аминокислотными последовательностями VH и VL.

Настоящее изобретение относится к области иммунологии. Предложены антитела, связывающиеся с человеческим альфа-синуклеином, а также конъюгат антитела с челночным модулем для гематоэнцефалического барьера.

Изобретение относится к EGFRvIII-связывающему белку, содержащему EGFRvIII-связывающий сайт, и его использованию. Предложен EGFRvIII-связывающий белок, содержащий EGFRvIII-связывающий сайт, и, необязательно, (i) содержащий по меньшей мере один дополнительный функциональный домен или (ii) являющийся мультиспецифичным.

Изобретение относится к области биотехнологии, конкретно к линкерному звену, и может быть использовано в качестве сшивающего средства для объединения различных антител или иных биологически активных агентов в конъюгаты и построения молекулярных конструкций с конкретной комбинацией нацеливающих и эффекторных элементов с применением химического синтеза, либо рекомбинантной технологии.

Изобретение относится к биотехнологии. Описана иммуносвязывающая молекула, содержащая: CDR1, CDR2 и CDR3 легкой цепи от донорной иммуносвязывающей молекулы зайцеобразного и CDR1, CDR2 и CDR3 тяжелой цепи от донорной иммуносвязывающей молекулы зайцеобразного; каркас вариабельной области легкой цепи человека и каркас вариабельной области тяжелой цепи человека, который по меньшей мере на 85% идентичен последовательности SEQ ID NO: 4 и содержит треонин (T) в положении 24 (нумерация AHo).

Изобретение относится к области биохимии, в частности к конструкции нуклеиновой кислоты для получения биспецифического антитело-подобного связывающего белка, связывающего пару антигенов.

Изобретение относится к биотехнологии. Описан вектор экспрессии на основе поксвируса, который содержит молекулу(ы) нуклеиновой кислоты, кодирующую(ие) гибрид гетероолигомерных микобактериальных антигенов ESAT6 и CFP10 и предпочтительно гибрид, содержащий аминокислотную последовательность, представленную в SEQ ID NO: 1.

Изобретение относится к биотехнологии и решает задачу лечения заболеваний, в частности системной красной волчанки, фрагментом антитела, специфически связывающимся с CD154.

Изобретение относится к области биотехнологии, конкретно к способу получения конъюгатов терапевтического соединения с пролонгированным периодом полувыведения, и может быть использовано в медицине.

Изобретение относится к биотехнологии. Описан вектор экспрессии на основе поксвируса, который содержит молекулу(ы) нуклеиновой кислоты, кодирующую(ие) гибрид гетероолигомерных микобактериальных антигенов ESAT6 и CFP10 и предпочтительно гибрид, содержащий аминокислотную последовательность, представленную в SEQ ID NO: 1.

Изобретение относится к области биохимии, в частности к фармацевтической композиции, содержащей выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с альфа-токсином S.aureus, и выделенное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с антигеном S.aureus, являющимся поверхностной детерминантой, выбранным из группы, состоящей из IsdH и ClfA. Также раскрыты способ лечения инфекции S.aureus с помощью указанной композиции, способ уменьшения агглютинации бактерий S.aureus с помощью указанной композиции. Изобретение обладает способностью эффективно лечить инфекции S.aureus. 3 н. и 6 з.п. ф-лы, 11 пр., 7 табл., 18 ил.

Наверх