Количественная оценка неправильно свернутого tnfr2:fc



Количественная оценка неправильно свернутого tnfr2:fc
Количественная оценка неправильно свернутого tnfr2:fc
Количественная оценка неправильно свернутого tnfr2:fc
Количественная оценка неправильно свернутого tnfr2:fc
Количественная оценка неправильно свернутого tnfr2:fc
G01N2333/70578 - Исследование или анализ материалов путем определения их химических или физических свойств (разделение материалов вообще B01D,B01J,B03,B07; аппараты, полностью охватываемые каким-либо подклассом, см. в соответствующем подклассе, например B01L; измерение или испытание с помощью ферментов или микроорганизмов C12M,C12Q; исследование грунта основания на стройплощадке E02D 1/00;мониторинговые или диагностические устройства для оборудования для обработки выхлопных газов F01N 11/00; определение изменений влажности при компенсационных измерениях других переменных величин или для коррекции показаний приборов при изменении влажности, см. G01D или соответствующий подкласс, относящийся к измеряемой величине; испытание
C07K1/16 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2698671:

САНДОЗ АГ (CH)

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая способ определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, способ получения и очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 и композиция TNFR2:Fc для лечения заболевания, выбранного из анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита и ревматоидного артрита. В одном из вариантов реализации способ получения и очистки TNFR2:Fc включает в себя стадию получения композиции, содержащей TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88. Изобретение расширяет арсенал способов определения и очистки TNFR2:Fc в образце. 5 н. и 10 з.п. ф-лы, 7 ил., 7 табл., 4 пр.

 

Настоящее изобретение относится к способам определения относительного количества специфического TNFR2:Fc с некорректными дисульфидными связями в образце TNFR2:Fc, который представляет собой слитый белок, который используют в различных терапевтических применениях. Кроме того, изобретение относится к способу очистки TNFR2:Fc с использованием указанного способа для определения относительного количества указанного TNFR2:Fc с некорректными дисульфидными связями, и к композициям TNFR2:Fc, полученным таким образом.

УРОВЕНЬ ТЕХНИКИ

Фактор некроза опухоли альфа (TNF-альфа) является членом группы цитокинов, которые стимулируют реакцию острой фазы, и, таким образом, он представляет собой цитокин, участвующий в системном воспалении. TNF-альфа может вызывать воспаление, индуцировать апоптоз клеток и ингибировать онкогенез и репликацию вируса. Дисрегуляция продуцирования TNF-альфа вовлечена в различные заболевания человека, такие как аутоиммунное заболевание, анкилозирующий спондилит, ювенильный ревматоидный артрит, псориаз, псориатический артрит, ревматоидный артрит, болезнь Вегенера (гранулематоз), болезнь Крона или воспалительное заболевание кишечника, хроническое обструктивное заболевание легких (COPD), гепатит С, эндометриоз, астма, кахексия, атопический дерматит, болезнь Альцгеймера, а также рак.

Молекулы его рецептора включают TNFR1 и TNFR2. TNF-R1 экспрессируется в клетках большинства тканей, в то время как TNF-R2 обнаруживается только в клетках иммунной системы. При контакте с гомотримерами TNF-альфа TNF-рецепторы образуют тримеры и тем самым инициируют внутриклеточную сигнальную систему клеток.

Соответственно, растворимые молекулы TNFR или их фрагменты, которые способны связываться с TNF-альфа, могут использоваться в качестве конкурентного ингибитора TNF-альфа. Настоящее изобретение относится к таким растворимым молекулам TNFR2, слитым с Fc-частью человеческого иммуноглобулина (TNFR2:Fc), и, более конкретно, к способам определения, получения и очистки таких молекул TNFR2:Fc.

TNFR2:Fc может быть получен с помощью биопроцесса с использованием рекомбинантных клеток СНО, например, с помощью клеток (dhfr-) СНО, дефицитных по дигидрофолатредуктазе. Одна конкретная форма TNFR2:Fc представляет собой этанерцепт, который состоит из 934 аминокислот со средней молекулярной массой 125 кДа. Он включает в себя гомодимер внеклеточной лиганд-связывающей части рецептора человеческого фактора некроза опухоли (p75), связанный с Fc-частью человеческого IgG1. Компонент Fc в обеих молекулах гомодимера содержит полные шарнирные, СН2- и СН3-области, но не содержит СН1-область IgG1 (см. Фигуру 1). Он предпочтительно синтезируется в виде димерного, секретируемого растворимого белка, в то время как димеризация Fc-области посредством трех дисульфидных связей происходит пост-трансляционно.

При использовании рентгеноструктурной кристаллографии, а также масс-спектрометрии может быть выявлен полный профиль дисульфидных связей предпочтительной формы человеческого TNFR2:Fc, этанерцепта (см. Таблицу 1). Соответствующие части выясненных структур TNFR2 и области его контакта с TNF-альфа представлены на Фигуре 2 и на Фигуре 3, в то время как способности связывания вариантов дисульфидов для основного варианта TNFR2:Fc суммированы в Таблице 1 (см. также Фигуру 4).

Таблица 1 Профиль дисульфидных связей этанерсепта

Внутрицепочечные (Рецептор/Fc-часть) Межцепочечные
Cys(18)-Cys(31) Cys(98)-Cys(115) Cys(240)-Cys(240ʹ)
Cys(32)-Cys(45) Cys(121)-Cys(139) Cys(246)-Cys(246ʹ)
Cys(35)-Cys(53) Cys(142)-Cys(157) Cys(249)-Cys(249ʹ)
Cys(56)-Cys(71) Cys(163)-Cys(178)
Cys(74)-Cys(88) Cys(281)-Cys(341)
Cys(78)-Cys(96) Cys(387)-Cys(445)
Cys(104)-Cys(112)

Однако неправильно свернутый TNFR2:Fc был обнаружен во всех анализируемых препаратах TNFR2:Fc. Такой неправильно свернутый TNFR2:Fc не является предпочтительным, когда TNFR2:Fc используется в любой из вышеуказанных терапий. В US 7294481 сообщается, что такой неправильно свернутый TNFR:Fc, такой как TNFR2:Fc, образуется на ранней стадии процесса культивирования клеток, транспортируется и представляет собой значительную часть (примерно 25-50%) продукта экспрессии. Кроме того, сообщается, что количество такого неправильно свернутого TNFR:Fc может быть уменьшено, если TNFR:Fc-продуцирующую клетку-хозяин культивировать при температуре 25-34°С в течение фазы продуцирования. Кроме того, сообщается, что такие неправильно свернутые TNFR:Fc могут быть отделены с помощью хроматографии гидрофобного взаимодействия.

Однако, как представлено в разделе примеров в настоящем документе, доступные в настоящее время препараты TNFR2:Fc (продаются как ENBREL®) все еще содержат TNFR2:Fc с некорректными дисульфидными связями (см. Таблицу 4 ниже). Это может быть связано с трудностями его отделения от корректно свернутого TNFR2:Fc.

Соответственно, существует потребность данной области техники в способах определения чистоты TNFR2:Fc в образце - в данном случае количества TNFR2:Fc с некорректными дисульфидными связями - которое дает возможность выбора, например, фракций, имеющих целевую более высокую степень чистоты.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Авторы изобретения идентифицировали вариант TNFR2:Fc, содержащий некорректную дисульфидную связь в области связывания части рецептора TNF-альфа с TNF-альфа (Cys78-Cys88) (см Фигуры 5 и 6). В данном документе продемонстрировано с помощью корреляции между биоактивностью и количеством варианта с некорректной дисульфидной связью Cys78-Cys88 («вариант Т7» или «Т7»), что большие количества этого варианта Т7 оказывают негативное влияние на эффективность (см. Фигуру 7).

Исходя из этого факта, авторы настоящего изобретения разработали способ количественной оценки варианта Т7 с помощью пептидного картирования в невосстанавливающих условиях. Путем расщепления образцов TNFR2:Fc с помощью трипсина при невосстанавливающих условиях белок может быть расщеплен на более мелкие компоненты, в то время как структуры дисульфидных связей остаются интактными. После этого полученные пептиды дополнительно хроматографически разделяли с помощью хроматографии с обращенной фазой и детектировали с помощью УФ/визуального обнаружения. Этот способ дает возможность относительной количественной оценки количества так называемого пептида Т7, который представляет собой пептид, полученный из вариантов T7 с некорректными дисульфидными связями. Предпочтительно, количество пептида Т7 с некорректными дисульфидными связями может быть определено на основе сигнала для пептида Т7 в полученной хроматограмме. Например, оно может быть выражено в виде площади пика для пептида Т7 относительно площади пика для эталонного пептида, который не подвержен влиянию дисульфидных связей, или эталонного пептида, который не подвержен влиянию дисульфидной связи остатков Cys74, Cys78, Cys88 и Cys96. Путем использования нового разработанного способа можно идентифицировать образцы, в которых совместно элюируется TNFR2:Fc с корректными дисульфидными связями и вариант Т7, и которые, таким образом, не могут быть объединены с образцами чистого TNFR2:Fc и/или с образцами с уменьшенным количеством варианта Т7, достигая таким образом повышенной чистоты/эффективности конечной композиции TNFR2:Fc.

Более конкретно, предлагается способ определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 (т.е. вариант Т7) в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, где способ включает стадии:

(a) предоставления образца, содержащего смесь TNFR2:Fc с дисульфидной связью Cys78-Cys88 и TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96;

(b) денатурации и алкилирования образца стадии (а);

(c) подвергания образца, полученного на стадии (b), расщеплению трипсином;

(d) подвергания образца, полученного на стадии (с), ВЭЖХ, тем самым отделяя фрагменты, характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88; и

(e) проведения интегрирования для пика, характерного для TNFR2:Fc с дисульфидной связью Cys78-Cys88 и для пика, не подверженного влиянию дисульфидных связей Cys74, Cys78, Cys88 и Cys96, полученного на стадии (d);

где аминокислотная последовательность TNFR2-части TNFR2:Fc имеет по меньшей мере 97% идентичности, предпочтительно, по меньшей мере 98%, более предпочтительно, по меньшей мере 99% идентичности; наиболее предпочтительно, 100% идентичности с аминокислотами 23-257 аминокислотной последовательности SEQ ID NO: 1.

Также предлагается способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, где способ включает подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 по меньшей мере, одной хроматографической стадии, где по меньшей мере, одна хроматографическая стадия включает хроматографию гидрофобного взаимодействия (HIC); и разделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, которые содержат уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом, подвергнутым указанной, по меньшей мере, одной хроматографической стадии; где указанные одна или несколько фракций содержат менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88 на основе суммарного TNFR2:Fc, предпочтительно менее чем 2,1%, предпочтительно менее чем 2%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6%, и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, как было определено с использованием способа определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, раскрытого в данном документе, и с использованием интегрирования пика пептидных сигналов Т7 (SEQ ID NO: 4) и Т27 (SEQ ID NO: 5) и вычисления относительного количества по формуле (1), как описано ниже.

Кроме того, предлагается способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, причем способ включает подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, по меньшей мере, одной хроматографической стадии, где, по меньшей мере, одна хроматографическая стадия включает гидрофобную хроматографию (HIC); и отделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, которые содержат уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом, подвергнутым указанной, по меньшей мере, одной хроматографической стадии; где количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 определяется с использованием способа, описанного в настоящем документе.

Кроме того, в настоящем изобретении предлагается способ, включающий

(a) получение композиции, содержащей TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 в подходящей клетке-хозяине; и

(b) очистку полученной комбинации TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 с помощью способа очистки, описанного в настоящем документе.

Наконец, также раскрыта композиция TNFR2:Fc, где аминокислотная последовательность TNFR2:Fc имеет, по меньшей мере, 97% идентичности, предпочтительно, по меньшей мере, 98%, более предпочтительно, по меньшей мере, 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3, содержащая менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88, предпочтительно менее 2,1%, предпочтительно менее чем 2%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6%, и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, как было определено с использованием способа определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, раскрытого в настоящем документе и с использованием интегрирования пиков пептидных сигналов Т7 (SEQ ID NO: 4) и Т27 (SEQ ID NO: 5) и путем вычисления относительного количества по формуле (1), как описано ниже.

Такая композиция особенно подходит для применения в медицине, например, для применения в предотвращении и/или лечении заболевания, выбранного из аутоиммунного заболевания, анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита, ревматоидного артрита, гранулематоза, воспалительного заболевания кишечника, хронической обструктивной болезни легких (COPD), гепатита С, эндометриоза, астмы, кахексии, атопического дерматита, болезни Альцгеймера и рака; предпочтительно подходит при лечении заболевания, выбранного из анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита и ревматоидного артрита.

ПОДРОБНОЕ ОПИСАНИЕ ПРЕДПОЧТИТЕЛЬНЫХ ВОПЛОЩЕНИЙ

В настоящем изобретении предлагается способ определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, где способ включает стадии:

(a) предоставление образца, содержащего смесь TNFR2:Fc с дисульфидной связью Cys78-Cys88 и TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96;

(b) денатурация и алкилирование образца, полученного на стадии (а);

(c) подвергание образца, полученного на стадии (b), трипсиновому расщеплению;

(d) подвергание образца, полученного на стадии (с), ВЭЖХ, тем самым отделяя фрагменты, характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88; и

(e) проведение интегрирования для пика, характерного для TNFR2:Fc с дисульфидной связью Cys78-Cys88 и для пика, не подверженного влиянию дисульфидных связей Cys74, Cys78, Cys88 и Cys96, как получено на стадии (d);

где аминокислотная последовательность TNFR2-части TNFR2:Fc имеет по меньшей мере 97% идентичности, предпочтительно, по меньшей мере 98%, более предпочтительно, по меньшей мере 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотами 23-257 из аминокислотной последовательности SEQ ID NO: 1. Аминокислоты 1-22 из SEQ ID NO: 1 соответствуют сигнальному пептиду, который вырезается в зрелом секретируемом белке.

В контексте настоящего описания, TNFR2-часть TNFR2:Fc относится к любому TNFR-полипептиду, имеющему по меньшей мере 97% идентичности, предпочтительно, по меньшей мере 98%, более предпочтительно, по меньшей мере 99% и наиболее предпочтительно 100% идентичности по всей длине аминокислотной последовательности, содержащей, по меньшей мере, 150-235, предпочтительно 200-235, наиболее предпочтительно 233-235 аминокислот внеклеточной части TNFR2, и сохраняющему связывание с TNF-альфа, как определено с помощью тИФА или любого другого удобного анализа. Более предпочтительно, TNFR способен связываться с TNF-альфа и лимфотоксином альфа (LT-альфа), как определено методом тИФА или любым другим удобным анализом. Такие анализы хорошо известны специалисту в данной области.

CDS и белковые последовательности TNFR2 (TNF-рецептора типа 2; CD120b; р75/80; для человека: RefSeq (мРНК): NM_001066, RefSeq (белок): NP_001057 (SEQ ID NO: 1)), известны в данной области техники.

Как правило, полипептид имеет «по меньшей мере х% идентичности» по всей длине последовательности аминокислот определенной длины с другим полипептидом, если рассматриваемая последовательность выровнена наилучшим образом с согласующейся аминокислотной последовательностью, и идентичность последовательности между ней и выровненной последовательностью составляет, по меньшей мере х%. Такое выравнивание может осуществляться с использованием, например, общедоступных компьютерных программ поиска гомологии, таких как «BLAST», таких как «blastp», предоставляемых на домашней странице NCBI по адресу www.ncbi.nlm.nih.gov/blast/blast.cgi, используя предусмотренные там параметры по умолчанию. Другие методы расчета процента идентичности последовательности групп полипептидов известны в данной области техники.

Fc-область (фрагмент кристаллизующейся области) относится к хвостовой области антитела, в случае IgG, состоящий из второго и третьего константного домена двух тяжелых цепей антитела. В некоторых воплощениях, Fc-полипептид содержит константную область тяжелой цепи IgG-класса или ее фрагмента и/или варианта, и в других воплощениях константная область других изотипов иммуноглобулинов может быть использована для создания таких химер TNFR2:Fc. Например, может быть использован полипептид TNFR2:Fc, содержащий константную область тяжелой цепи класса IgM, или его фрагмент и/или вариант. Предпочтительно, Fc-фрагмент получают из IgG, более предпочтительно из IgG1, еще более предпочтительно из IgG1 человека. Константная область тяжелых цепей иммуноглобулина с конкретным примером константного домена тяжелой цепи иммуноглобулина класса IgG1 человека, представленная в SEQ ID NO: 2, содержит домен CH1 (аминокислоты 1-98 из SEQ ID NO: 2), шарнирную область (аминокислоты 99-110 SEQ ID NO: 2), домен СН2 (аминокислоты 111-223 из SEQ ID NO: 2), и домен СН3 (аминокислоты 224-330 SEQ ID NO: 2). Используемый в настоящем документе Fc-домен может содержать один из следующих компонентов или их все: домен СН1 тяжелой цепи, шарнирную область, домены CH2 и CH3, описанные выше, или их фрагменты или варианты. Некоторые воплощения изобретения включают TNFR2:Fc, содержащий весь или часть внеклеточного домена TNFR2 (SEQ ID NO: 1), слитого со всей последовательностью SEQ ID NO: 2 или с ее частью, необязательно с линкерным полипептидом между участком TNFR2 и участком Fc из TNFR2:Fc. Например, в молекуле могут присутствовать СН1, СН2 и вся шарнирная область. В других воплощениях, константная область тяжелой цепи, содержащая, по меньшей мере, часть CH1, представляет собой Fc-часть TNFR2:Fc. Некоторые воплощения могут также включать, например, всю шарнирную область или С-концевую половину шарнирной области, чтобы обеспечить дисульфидную связь между тяжелыми цепями. Если требуется мультимерный, например, димерный TNFR2:Fc, то важно включать часть шарнирной области, вовлеченной в образование дисульфидных связей между тяжелыми цепями (например, часть аминокислот 99-110 SEQ ID NO: 2, которая включает аминокислоту 109 SEQ ID NO: 2). В предпочтительном воплощении Fc-часть состоит из полноразмерной шарнирной области и доменов СН2 и СН3. Однако, TNFR2:Fc может содержать части домена СН3, которые не включают С-концевой остаток лизина (аминокислота 330 SEQ ID NO: 2), поскольку было замечено, что этот остаток должен быть удален в пост-трансляционном процессинге полипептидов тяжелой цепи IgG. Fc-химеры и Fc-фрагменты хорошо известны в данной области техники.

Предпочтительно, TNFR2:Fc, по существу, идентичен/аналогичен этанерцепту, более предпочтительно, TNFR2:Fc представляет собой этанерцепт. Этанерцепт представляет собой димер двух молекул внеклеточной части р75 рецептора TNF-альфа, причем каждая молекула состоит из 235 аминокислот полипептида, полученного из TNFR, который слит с 232-аминокислотной Fc-частью человеческого IgG1. Аминокислотная последовательность мономерного компонента этанерцепта представлена в виде SEQ ID NO: 3. В димерной форме этой молекулы два из этих слитых полипептидов (или «мономеров») удерживаются вместе с помощью трех дисульфидных связей, которые образуются между иммуноглобулиновыми частями двух мономеров. Поэтому димер этанерцепта состоит из 934 аминокислот и имеет кажущуюся молекулярную массу, составляющую приблизительно 125 кДа. В Северной Америке, этанерцепт продается компанией Amgen под торговым названием ENBREL®. Wyeth/Pfizer является единственным продавцом ENBREL® за пределами Северной Америки, за исключением Японии, где Takeda Pharmaceuticals продает лекарственные средства.

Термин «по существу идентичен/подобен этанерсепту», используемый в настоящем документе, означает, что аминокислотная последовательность TNFR2:Fc, применяемая на стадии (а), имеет, по меньшей мере, 97% идентичности с аминокислотной последовательностью, представленной в SEQ ID NO: 3, предпочтительно, по меньшей мере, 98% идентичности, более предпочтительно 99% идентичности с аминокислотной последовательностью, представленной в SEQ ID NO: 3. В качестве альтернативы или дополнительно, TNFR2:Fc может иметь 100% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 3 и может или нет отличаться от этанерцепта по пост-трансляционным модификациям (только), например, путем гликозилирования. Приемлемые процедуры изменения профиля гликозилирования и тесты для определения профиля гликозилирования хорошо известны специалисту в данной области.

TNFR2:Fc может быть получен рекомбинантным способом, предпочтительно путем использования системы экспрессии на основе клеток млекопитающих. Предпочтительно, указанная система экспрессии на основе клеток млекопитающих представляет собой, по меньшей мере, одну, выбранную из группы, состоящей из клеточных линий почек детеныша хомяка (например, ВНК21); клеточной линии яичников китайского хомяка (например, CHO-K1, CHO-DG44, CHO-DXB или CHO-dhfr-); мышиных клеточных линий миеломы (например, SP2/0); мышиных клеточных линий миеломы (например, NS0); Человеческих эмбриональных почечных клеточных линий (например, НЕК-293); Человеческих клеточных линий, полученных из сетчатки (например, PER-С6), и/или клеточных линий амниоцитов (например, CAP). Предпочтительно, используются системы экспрессии на основе клеток хомяка. Клетки ВНК21 («почки детеныша хомяка») принадлежат к квази-диплоидной клеточной линии, созданной из клеток сирийских хомяков с происхождением из клона необычно быстро растущей первичной культуры ткани почек новорожденного хомяка. Неограничивающие примеры клеточных линий ВНК-21, которые являются коммерчески доступными и могут быть использованы в контексте настоящего изобретения, представляют собой ВНК-21 (С-13); ВНК21-pcDNA3.1-HC; BHK570; клеточную линию FLP-In-ВНК; и/или клеточную линию хомяка ВНК 21 (клон 13).

Клетки яичника китайского хомяка (СНО) представляют собой клеточную линию, полученную из яичника китайского хомяка. Они часто используются в биологических и медицинских исследованиях и коммерчески используются в производстве терапевтических белков. Они были получены в 1960-х годах и первоначально выращивались в виде монослойной культуры. На сегодняшний день клетки СНО являются наиболее часто используемыми клетками-хозяевами из млекопитающих для промышленного получения рекомбинантных белковых терапевтических средств и обычно выращиваются в суспензионной культуре.

Неограничивающие примеры клеточных линий СНО, которые являются коммерчески доступными и могут использоваться в контексте настоящего изобретения, представляют собой клетки FreeStyle СНО-S; клеточную линию ER-СНО; CHO 1-15 500 CHINESE HAM; CHO-DXB, CHO-dhfr-, CHO DP-12 клон#1934; CHO-CD36; CHO-ICAM-1; CHO-K1; яичники; HuZP3-CHOLec3.2.8.1; xrs5; CHO-K1/BB2 клетки; CHO-K1/BB3 клетки; CHO-K1/EDG8/Galpha15 клетки; CHO-K1/M5 клетки; CHO-K1/NK1 клетки; CHO-K1/NK3 клетки; CHO-K1/NMUR1 клетки; CHO-K1/NTSR1 клетки; CHO-K1/OX1 клетки; CHO-K1/PAC1/Gα15 клетки; CHO-K1/PTAFR клетки; CHO-K1/TRH1 клетки; CHO-K1/V1B клетки; 5HT1A Galpha-15-NFAT-BLA CHO-K1 клеточную линию; AVPR2 CRE-BLA CHO-K1 клеточную линию; CHO-S клетки SFM адаптированные; DG44 клетки; Flp-In-CHO клеточную линию; GeneSwitch-CHO клеточную линию; NFAT-bla CHO-K1 клеточную линию; T-REx-CHO клеточную линию; GenoStat CHO K-1 стабильную клеточную линию; набор GenoStat CHO K-1 стабильной клеточной линии; CHO-K1 клеточную линию хомяка, CHO-PEPT1 клеточную линию, CHO SSF3 и/или CHO-HPT1 клеточную линию. В особенно предпочтительном воплощении, система экспрессии на основе клеток хомяка представляет собой клеточную линию СНО-dhfr-.

Образец, содержащий TNFR2:Fc, для применения на стадии (а), может представлять собой материал, такой как надосадочная жидкость клеточной культуры или клеточный лизат. Предпочтительно, раствор представляет собой бесклеточную и бессывороточную надосадочную жидкость клеточной культуры. В еще более предпочтительном воплощении, раствор дополнительно очищают, например, с помощью аффинной хроматографии и/или хроматографии гидрофобного взаимодействия. Как правило, TNFR2:Fc, применяемый на стадии (а) способа, раскрытого в настоящем документе, содержит смесь TNFR2:Fc с дисульфидной связью Cys78-Cys88 и TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96.

В предпочтительном воплощении, стадию (b) денатурации и алкилирования осуществляют в буфере, имеющем рН в диапазоне от 7 до 9, предпочтительно от 7,5 до 8,5, наиболее предпочтительно примерно рН 8. Например, буфер может представлять собой TRIS-буфер, такой как буфер, содержащий 10-100 мМ TRIS, более предпочтительно, 20-80 мМ TRIS. Буфер дополнительно содержит алкилирующий агент, например, 0,5-1,5 М иодацетамид, предпочтительно 0,9-1,2 М иодацетамид. Кроме того, предпочтительно, что буфер стадии (b) включает 0,02% -0,5% расщепляемого поверхностно-активного вещества, предпочтительно 0,1%-0,2% расщепляемого поверхностно-активного вещества. Вообще, может быть использовано любое поверхностно-активное вещество, которое не препятствует трипсиновому расщеплению. Особенно предпочтительные расщепляемые поверхностно-активные вещества выбирают из 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфоната натрия, 3-((1-(фуран-2-ил)ундецилокси)карбониламино)-пропан-1-сульфоната натрия и 3-(4-(1,1-бис(гексилокси)этил)пиридиний-1-ил)пропан-1-сульфоната натрия. В более предпочтительном воплощении поверхностно-активное вещество представляет собой 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфонат натрия. В общем, стадию (b) проводят при температуре и в течение времени, достаточных для денатурации и алкилирования смеси TNFR2:Fc, применяемой на стадии (a). Например, стадия (b) может быть проведена при температуре 40-70°C в течение 30-60 мин. В предпочтительном воплощении, стадия (b) может быть проведена при температуре 50-60°C в течение 30-45 мин.

Расщепление трипсином на стадии (с) проводят с использованием эффективного количества трипсина и применения достаточного времени и соответствующей температуры в условиях, которые облегчают расщепление. Например, трипсиновое расщепление может быть проведен в подходящем буфере в течение 1-24ч, предпочтительно в течение 6-18ч; и при 32-38°С, например, при 36-37°С. Во многих случаях буферные условия на стадии (b) не будут пригодны для стадии (с). В таких случаях, стадия (с) может включать замену буфера образца, полученного из стадии (b) в подходящем буфере для расщепления перед расщеплением. Предпочтительно, указанный буфер для расщепления имеет рН в диапазоне 5-7, более предпочтительно в диапазоне от 5,5 до 6,5. Подходящие буферы для расщепления включают буферы для расщепления, содержащие MES в качестве буферного агента, например, в концентрации 10-100 мМ MES, более предпочтительно 30-60 мМ MES. В дополнение к буферному агенту буфер для расщепления может также содержать расщепляемое поверхностно-активное вещество. Расщепляемое поверхностно-активное вещество может быть таким же, как на стадии (b) или может быть другим расщепляемым поверхностно-активным веществом. Соответственно, расщепляемое поверхностно-активное вещество может быть выбрано из 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфоната натрия, 3-((1-(фуран-2-ил)ундецилокси)карбониламино)пропан-1-сульфоната натрия и 3-(4-(1,1-бис(гексилокси)этил)пиридиний-1-ил)пропан-1-сульфоната натрия. В более предпочтительном воплощении поверхностно-активное вещество представляет собой 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфонат натрия. Если они присутствуют, буферы для расщепления содержат 0,02%-0,5% расщепляемого поверхностно-активного вещества, предпочтительно 0,1%-0,2% расщепляемого поверхностно-активного вещества. Наконец, стадия (с) может быть терминирована путем добавления 1% муравьиной кислоты в 10% ацетонитриле. Специалист в данной области заметит, что это расщепление осуществляется в невосстанавливающих условиях.

В Таблице 2 перечислены все фрагменты, которые получаются при трипсиновом расщеплении предпочтительного TNFR2:Fc, а именно этанерцепта, в восстанавливающих (!) условиях.

Таблица 2

Пептид No. No. Аминокислот SEQ ID NO: Последовательность
T1 1- 19 6 LPAQVAFTPYAPEPGSTCR
T2 20- 21 LR
T3 22- 34 7 EYYDQTAQMCCSK
T4 35- 42 8 CSPGQHAK
T5 43- 47 9 VFCTK
T6 48- 77 10 TSDTVCDSCEDSTYTQLWNWVPECLSCGSR
T7 78- 90 4 CSSDQVETQACTR
T8 91- 94 11 EQNR
T9 95-108 12 ICTCRPGWYCALSK
T10 109-113 13 QEGCR
T11 114-119 14 LCAPLR
T12 120-120 K
T13 121-185 15 CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTR
T14 186-201 16 SMAPGAVHLPQPVSTR
T15 202-238 17 SQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPK
T16 239-242 18 SCDK
T17 243-268 19 THTCPPCPAPELLGGPSVFLFPPKPK
T18 269-275 20 DTLMISR
T19 276-294 21 TPEVTCVVVDVSHEDPEVK
T20 295-308 22 FNWYVDGVEVHNAK
T21 309-312 23 TKPR
T22 313-321 24 EEQYNSTYR
T23 322-337 25 VVSVLTVLHQDWLNGK
T24 338-340 EYK
T25 341-342 CK
T26 343-346 26 VSNK
T27 347-354 5 ALPAPIEK
T28 355-358 27 TISK
T29 359-360 AK
T30 361-364 28 GQPR
T31 365-375 29 EPQVYTLPPSR
T32 376-380 30 EEMTK
T33 381-390 31 NQVSLTCLVK
T34 391-412 32 GFYPSDIAVEWESNGQPENNYK
T35 413-429 33 TTPPVLDSDGSFFLYSK
T36 430-434 34 LTVDK
T37 435-436 SR
T38 437-459 35 WQQGNVFSCSVMHEALHNHYTQK
T39 460-467 36 SLSLSPGK

Принимая во внимание дисульфидные связи этанерцепта, представленные в Таблице 1, специалист в данной области сразу поймет, что при невосстанавливающих условиях, как это предусмотрено в способе определения согласно настоящему изобретению, например, индивидуальные фрагменты Т1 (аа 1-19) и Т3 (аа 22-34) не будут получены в молекулах TNFR2:Fc с интактной дисульфидной связью Cys18-Cys31, поскольку они все еще ковалентно связаны этой дисульфидной связью. Аналогичным образом, фрагмент T7 (аа 78-90) не будет получен из молекулы TNFR2:Fc с интактными дисульфидными связями Cys74-Cys88 и/или Cys78-Cys96. Однако если Cys78 образует дисульфидную связь с Cys88, то будет получен фрагмент, соответствующий аминокислотам 78-90 TNFR2:Fc.

Затем образец, полученный на стадии (с), подвергают ВЭЖХ, тем самым отделяя индивидуальные фрагменты, полученные при трипсиновом расщеплении. В частности, в соответствии со способом, представленным в настоящем описании, фрагменты, характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88 от других фрагментов, в частности, от фрагментов, характерных для TNFR2:Fc с дисульфидной связью Cys74-Cys88 и/или Cys78-Cys96. В особенно предпочтительном воплощении, фрагменты, характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88, включают, предпочтительно, состоят из аминокислотной последовательности, представленной в SEQ ID NO: 4 («Т7», см также Таблицу 2 выше).

Условия, применяемые в ВЭЖХ, могут отличаться в зависимости от оборудования и используемых условий, но специалист в данной области техники легко сможет определить тоже самое рутинными измерениями и в свете дополнительных указаний, представленных в разделе примеров ниже. Конкретные подходящие колонки для ВЭЖХ представляют собой такие колонки, которые допускают разделение пептидных фрагментов и использование любой подходящей подвижной фазы для поддержания невосстанавливающих условий. В одном воплощении, стадию (d) проводят в подвижной фазе, содержащей 0,05%-0,5% ТФУ в воде, предпочтительно 0,1% -0,2% ТФУ в воде.

Используя хроматограмму, полученную на стадии (d), специалист может провести интегрирование для пика, характерного для TNFR2:Fc с дисульфидной связью Cys78-Cys88. Для того чтобы оценить относительное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88, наиболее удобно сравнить площадь пика, характерного для случая, когда эта изоформа TNFR2:Fc с площадью пика не подвержена влиянию любой дисульфидной связи из остатков Cys74, Cys78, Cys88 и Cys96. Предпочтительно, пик, не подверженный влиянию дисульфидных связей остатков Cys74, Cys78, Cys88 и Cys96, представляет собой пик фрагмента, который совсем не зависит от дисульфидной связи и, следовательно, является характерным для суммарного TNFR:Fc в образце, независимо от дисульфидных связей. Еще более предпочтительно, этот эталонный пик соответствует пептиду, который, кроме всего прочего, не подвержен влиянию гликозилирования или любой другой пост-трансляционной модификации. Кроме того, предпочтительно, что этот эталонный пик соответствует пептиду, который не содержит остаток метионина, так как метионин может быть подвержен окислению и давать два расщепленных сигнала. Кроме того, предпочтительно, что эталонный пик соответствует пептиду, размер которого примерно такой же, как у фрагментов, характерных для TNFR2:Fc с дисульфидной связью Cys78-Cys88, например примерно такого же размера как пептид, включающий, предпочтительно состоящий из аминокислотной последовательности, представленной в SEQ ID NO: 4 («Т7», см также Таблицу 2 выше). Предпочтительные примеры фрагментов, характерных для суммарного TNFR2:Fc, включают, предпочтительно состоят из аминокислотной последовательности, выбранной из группы SEQ ID NO: 5 («T27»), SEQ ID NO. 24 («Т22»), SEQ ID NO: 29 («Т31»), и SEQ ID NO: 36 («Т36»); Смотри также Таблицу 2 выше. В особенно предпочтительном воплощении, фрагменты, характерные для суммарного TNFR2:Fc, включают, предпочтительно состоят из аминокислотной последовательности, представленной в SEQ ID NO: 5 («Т27»). Однако будет понятно, что другие фрагменты, которые не подвержены влиянию дисульфидных связей Cys74, Cys78, Cys88 и Cys96, могут быть также использованы, в частности, с учетом известного профиля дисульфидных связей, представленных в Таблице 1 выше.

В наиболее предпочтительном воплощении, фрагменты, характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88, включают в себя, предпочтительно состоят из аминокислотной последовательности, представленной в SEQ ID NO: 4 («Т7»); и фрагменты, характерные для суммарного TNFR2:Fc, включают, предпочтительно состоят из аминокислотной последовательности, представленной в SEQ ID NO: 5 («Т27»). В этом случае определяют относительное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 с помощью интегрирования площади пиков в хроматограмме ВЭЖХ, характерной для TNFR2:Fc с дисульфидной связью Cys78-Cys88 («область Т7») и характерной для суммарного TNFR2:Fc («T27 область»); и

вычисления относительного количества согласно формуле (1).

Отн.%(T7)=([площадь (T7)]/([площадь (T7)]+[площадь (T27)]))x100 (1)

Площадь (Т7): площадь пика фрагмента Т7 (SEQ ID NO: 4)

Площадь (Т27): площадь пика фрагмента Т27 (SEQ ID NO: 5)

Описанный выше способ определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, может быть предпочтительно использован в управлении качеством, а также в процесс очистки TNFR2:Fc.

Соответственно, также предлагается способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, где способ включает

подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, по меньшей мере, одной хроматографической стадии, где по меньшей мере, одна хроматографическая стадия включает хроматографию гидрофобного взаимодействия (HIC); и

разделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, которые содержат уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом, подвергнутым указанной, по меньшей мере, одной хроматографической стадии;

где указанная одна или более фракций содержат менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88 на основе суммарного TNFR2:Fc, предпочтительно менее чем 2,1%, предпочтительно менее чем 2%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6%, и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, как было определено с помощью способа с использованием интегрирования пиков Т7 и Т27 и вычисления относительного количества по формула (1), как описано выше.

Аналогичным образом, в настоящем изобретении предлагается способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, причем способ включает

подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, по меньшей мере, одной хроматографической стадии, где по меньшей мере, одна хроматографическая стадия включает хроматографию гидрофобного взаимодействия (HIC); и

разделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, которые содержат уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом, подвергнутым указанной, по меньшей мере, одной хроматографической стадии;

где количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 определяют с использованием способа, описанного в настоящем документе.

В предпочтительном воплощении этих способов, аминокислотная последовательность TNFR2:Fc имеет по меньшей мере 97% идентичности, предпочтительно по меньшей мере 98%, более предпочтительно по меньшей мере 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3.

Раствор, содержащий неочищенный TNFR2:Fc, обычно подвергают аффинной хроматографии в качестве первого стадии. Используемый в настоящем документе термин «подвергание раствора, содержащего указанный TNFR2:Fc, аффинной хроматографии», предназначен для указания того, что аффинная хроматография является специфичной для TNFR2:Fc, т.е., по существу только TNFR2:Fc прежде всего связывается со смолой посредством взаимодействия, которое является специфическим для TNFR2:Fc, затем смолу, обычно промывают, после чего TNFR2:Fc элюируют из смолы путем применения подходящих условий. С аффинных смол может происходить элюирование путем изменения концентрации соли, рН, pI, заряда и ионной силы в одну или несколько стадий или через градиент для разделения TNFR2:Fc. Смола обычно представляет собой гелевую матрицу, часто из агарозы, которая модифицируется для того, чтобы обеспечить специфическое взаимодействие с TNFR:Fc.

Например, аффинная хроматография может проводиться на смоле, модифицированной Протеином А, Протеином G, антителом, способным связываться с Fc-частью указанного TNFR2:Fc, или антителом, направленным против TNFR2-части указанного TNFR2:Fc. Предпочтительно указанная смола модифицируется Протеином А или Протеином G и, более предпочтительно, указанная смола модифицируется Протеином А. Протеин А представляет собой белок, первоначально найденный в клеточной стенке золотистого стафилококка, который связывается с высокой аффинностью с человеческими IgG1 и IgG2, а также с мышиными IgG2a и IgG2b. Кроме того, Протеин А связывается с умеренной аффинностью с человеческими IgA, IgE и IgM, а также с мышиными IgG3 и IgG1. Он не вступает в реакцию с человеческими IgD или IgG3 или с мышиными IgA, IgE и IgM. В качестве альтернативы, могут использоваться другие Fc-связывающие бактериальные белки, такие как Протеин G или Протеин A/G. Протеин G обладает аффинностью связывания с человеческими IgG1, IgG2 и IgG4, и с мышиными IgG2a и IgG2b, что сравнимо с Протеином А. Однако, Протеин G также связывается с человеческим IgG3 и с крысиными иммуноглобулинами, и его аффинность связывания с мышиными IgG1 и IgG3 увеличивается по сравнению с Протеином А. Протеин G не демонстрирует кажущуюся аффинность к IgA, IgD, IgE или IgM. Протеин A/G представляет собой рекомбинантный слитый белок обоих, Протеина А и Протеина G. Связывание Протеина A/G меньше зависит от рН, чем у Протеина А, он связывается со всеми подклассами человеческого и мышиного IgG, связывается с человеческими IgA, IgE, IgM, и (в меньшей степени) IgD, но не связывается с мышиными IgA или IgM. Конкретная подходящая смола с Протеином А представляет собой смолу MabSelect Sure (GE Healthcare).Указанная смола имеет средний размер частиц 85 мкм, а также загрузочную способность 15-22 г/л смолы. Если Fc-часть TNFR2:Fc, не реагирует с Протеином А, Протеином G или Протеином A/G, то можно использовать антитела, которые специфичны для указанной Fc-части или TNFR2-части. Подходящие антитела будут очевидны специалистам в этой области техники и коммерчески доступны.

Связывание TNFR2:Fc с аффинной матрицей или со смолой, как правило, происходит при рН 6-8, предпочтительно при рН 6,5-7,5, и более предпочтительно, примерно при рН 7. Следовательно, может быть необходимо доведение рН раствора перед связыванием с аффинной смолой. В предпочтительном воплощении, смолу после связывания с указанным TNFR2:Fc промывают одним или несколькими подходящими буферами. Такие буферы могут содержать, например, 5-50 мМ фосфат натрия, 20-200 мМ хлорид натрия, рН 6-8; или фосфатный буфер или цитратный буфер или ацетатный буфер или смесь буферов с суммарной молярностью 1-100 мМ, предпочтительно 5-50 мМ с 0-750 мМ хлорид натрия, рН 5-6,5; или промывочные буферы аффинной хроматографии, описанные в данной области.

Элюирование TNFR2:Fc из аффинной матрицы предпочтительно проводят с применением кислых условий, таких как рН от 2,5 до 4,5, более предпочтительно, путем применения рН в диапазоне от 3 до 3,5. В некоторых случаях целесообразно применение градиента, начиная с более высоких значений рН в сторону более низких значений рН. Например, элюирование может быть проведено с использованием буфера, включающего буфер на основе уксусной кислоты, лимонной кислоты и/или фосфорной кислоты в концентрации 1-100 мМ, предпочтительно 5-50 мМ.

Дополнительные параметры, такие как скорость потока, высота слоя колонки и т.д. должны определяться на индивидуальной основе с использованием стандартных методов. Однако для достижения этой цели следует принимать во внимание, что процедуры аффинной хроматографии хорошо известны в данной области техники.

В предпочтительном воплощении, по меньшей мере, одна хроматографическая стадия дополнительно содержит одну или несколько стадий хроматографии ионного обмена, которые предпочтительно проводят перед стадией HIC.

Например, может применяться стадия катионного обмена. В частности, если способ содержит две ионообменные хроматографические стадии, то эта общая практика состоит в применении по меньшей мере, одной катионообменной хроматографической стадии.

В более предпочтительном воплощении, TNFR2:Fc подвергают одной или более стадий анионообменной хроматографии после аффинной хроматографии, что позволяет разделение и очистку молекул на основе их заряда. Анионообменная хроматография может также использовать матрицу мультимодальной хроматографии (MMC), такую как коммерчески доступная от компании GE Healthcare под торговым названием Capto adhere. Анионообменная хроматография может быть осуществлена в режиме связывания/элюирования или в проточном режиме или в обоих. В некоторых случаях может быть предпочтительным, чтобы анионообменная хроматография сначала осуществлялась в режиме связывания/элюирования с последующей второй анионообменной стадией, которую проводят в проточном режиме.

Всего лишь в качестве примера описана следующая классическая стадия анионообменной хроматографии в режиме связывания/элюирования.

TNFR2:Fc связывается с анионообменной смолой при рН 7-8, предпочтительно при рН 7,3-7,7. После того, как TNFR2:Fc связывается с анионообменной смолой, указанную смолу промывают буфером при рН 7-8, соответствующий промывочный буфер может представлять собой фосфатный буфер, например, буфер, содержащий 1-50 мМ фосфат натрия. Элюирование может быть осуществлено путем использования буфера, такого как фосфатный, цитратный или ацетатный буфер или их смесь, например, содержащая 1-50 мМ фосфат натрия, имеющая концентрацию соли, которая нарушает ионное взаимодействие между TNFR:Fc и анионообменной смолой, например, 100-200 мМ хлорида натрия.

Всего лишь в качестве примера далее описана стадия мультимодальной анионообменной хроматографии.

Для достижения наилучших результатов проводимость TNFR2:Fc-содержащего раствора доводят до 20-60 мСм/см, предпочтительно до 25-46 мСм/см; и рН до 5,5-6,5, предпочтительно до рН 5,5-6,2. Буфер может представлять собой фосфатный, цитратный или ацетатный буфер, или их смесь, например, буфер, содержащий 1-50 мМ фосфат натрия, цитрат натрия или ацетат натрия; и 200-700 мМ хлорид натрия, предпочтительно 250-600 мМ хлорид натрия.

TNFR:Fc-содержащая фракция(и), полученная после стадии(й) анионообменной хроматографии, может затем быть подвергнута хроматографии гидрофобного взаимодействия (HIC).

Как установлено выше, способ очистки содержит, по меньшей, мере одну стадию хроматографии гидрофобного взаимодействия (HIC). При высоких концентрациях соли неполярные группы на поверхности белка взаимодействуют с гидрофобными группами, например, с октильными или фенильными группами смолы HIC. Особенно удобные смолы HIC представляют собой коммерчески доступные Фенилсефарозу HP (GE Healthcare) и Toyopearl Phenyl 650, например, Toyopearl Phenyl 650 (М). Поскольку гидрофобные эффекты дополняются повышенной ионной силой, элюат обычно представляет собой водный буфер с уменьшением концентрации соли, увеличением концентрации детергента (который разрушает гидрофобные взаимодействия) и/или с изменениями рН. В предпочтительном воплощении HIC осуществляют в буфере, имеющем рН в интервале от 5,5-6,5, предпочтительно при рН 5,8-6,5, таком как рН 6.

Кроме того, перед связыванием TNFR2:Fc со смолой HIC может быть необходимо регулировать фракцию(и), содержащую TNFR2:Fc, таким образом, чтобы проводимость раствора находилась в диапазоне 50-100 мСм/см, предпочтительно 70-85 мСм/см. Это может быть достигнуто, например, путем разбавления фракции(й), содержащей TNFR2:Fc, с помощью буфера цитрата натрия, фосфата натрия или ацетата натрия, дополнительно содержащего сульфат натрия в концентрации 1 М или выше.

После загрузки TNFR2:Fc смолу HIC промывают подходящим буфером. Например, смола может быть промыта промывочным буфером, содержащим 50-150 мМ цитрат натрия, фосфат натрия или ацетат натрия, предпочтительно 50-100 мМ цитрат натрия или фосфат натрия; и сульфат натрия в подходящей концентрации. В предпочтительном воплощении смолу промывают промывочным буфером, содержащим 100 мМ фосфата натрия и 0,6 М сульфат натрия; 50 мМ фосфат натрия и сульфат натрия 0,8 М; 50 мМ фосфат натрия и сульфат натрия 0,95 М; или 50 мМ цитрат натрия и 0,8 М сульфат натрия. Концентрация буфера и/или сульфата натрия может быть выбрана в виде градиента, или может каждый может иметь одну концентрацию, попадающую в указанные выше диапазоны.

В случае, когда элюирования должно быть достигнуто за счет уменьшения концентрации соли, TNFR2:Fc можно элюировать с применением 0-100% градиента от указанного промывочного буфера до элюцирующего буфера, имеющего более низкую концентрацию ионов. Например, элюирующий буфер может представлять собой цитратный, фосфатный или ацетатный буфер, предпочтительно такой же буферной системы, какая используется в указанном промывочном буфере. Более предпочтительно, элюирующий буфер содержит 1-100 мМ цитрат натрия, фосфат натрия или ацетат натрия, предпочтительно 10-50 мМ цитрат натрия или фосфат натрия; и 0-100 мМ сульфат натрия, и более предпочтительно 0-10 мМ сульфат натрия. На основе фактических данных, касающихся выхода и биоактивности для полученных элюированных фракций, специалист в данной области может выбрать оптимальное окно элюирования, что представляет собой наилучший компромисс между выходом, чистотой и биологической активностью.

При использовании стадии HIC степень чистоты образца, как определено с помощью эксклюзионной хроматографии (SEC), может быть увеличена до значений выше 90%, предпочтительно выше 92%, еще более предпочтительно выше 95%. В частности, эта стадия HIC позволяет уменьшить количество примесей, связанных с продуктом, таких как продукты деградации (DP) из TNFR2:Fc, продукты агрегации (AP) из TNFR2:Fc, неправильно процессируемые белки или димеры TNFR:Fc, неправильно свернутые белки TNFR:Fc или белки или димеры TNFR:Fc с некорректными внутрицепочечными и/или межцепочечными дисульфидными связями. Квалифицированным специалистам понятно, что некорректные дисульфидные связи и некорректное свертывание могут быть взаимозависимыми и/или синергетическими. В частности, стадия HIC может быть использована для уменьшения количества TNFR2:Fc с дисульфидной связью Cys78-Cys88.

В других предпочтительных воплощениях способ может дополнительно включать стадию, в которой элюат на стадии HIC подвергают нанофильтрации, ультрафильтрации и/или диафильтрации, для того, чтобы отделить любые инактивированные вирусы или другие загрязняющие вещества из очищенного раствора и/или перенести очищенный TNFR2:Fc в более подходящий буфер для того, чтобы сделать TNFR2:Fc готовым для дальнейшей обработки. Например, очищенный TNFR2:Fc может быть приготовлен в виде фармацевтической композиции. Такие фармацевтические композиции содержат обычно 5-100 мг TNFR2:Fc на аликвоту, предпочтительно 10-75 мг TNFR2:Fc на аликвоту, еще более предпочтительно 20-60 мг TNFR2:Fc на аликвоту, и наиболее предпочтительно 25-50 мг TNFR2:Fc на аликвоту.

Однако, процент TNFR2:Fc с дисульфидной связью Cys78-Cys88 также зависит от условий в процессе производства (т.е. ферментации) TNFR2:Fc. Таким образом, также предлагается способ, включающий

(a) получение композиции, содержащей TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 в подходящей клетке-хозяине; и

(b) очистку полученной комбинации TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 с помощью способа очистки, как описано выше.

В предпочтительном воплощении, TNFR2:Fc получают с использованием клетки-хозяина CHO. В основе способа получения TNFR2:Fc-продуцирующей клеточной культуры лежит четыре этапа:

1. Фаза инокуляции: После размораживания флакона с банком клеток культуру наращивают в серии встряхиваемых колб увеличивающегося размера для получения достаточного количества суспензии клеток, чтобы запустить первый биореактор.

2. Фаза наращивания: После ряда инокуляций запускают один или несколько биореакторов до стадий культивирования для дополнительного наращивания культуры до начала продуцирования в конечном биореакторе. Ключевой параметр «рН» контролируется в заданных точках во время этой фазы наращивания. Во время обеих фаз, фазы инокуляции и наращивания, культуру поддерживают в экспоненциальной фазе роста путем надлежащего контроля переноса и плотности посева клеток.

3. Фаза продуцирования: Применяют периодический, подпитываемый или перфузионный процесс получения клеточной культуры. Если исходная температура клеточной культуры выше, например, 37°С, то температура может быть снижена в процессе стадии продуцирования, например, до 30,5-36,5°С, предпочтительно до 30,5-35°C, более предпочтительно до температуры 31-34°С, еще более предпочтительно до температуры 31,5-33°C, и наиболее предпочтительно до температуры 31,5-32,5°С. Однако в равной степени целесообразно поддерживать температуру постоянно в вышеуказанных диапазонах, начиная с диапазона продуцирования.

4. Осветление: После окончания фазы продуцирования начинают сбор. Клетки отделяют центрифугированием с последующей фильтрацией для удаления дебриса.

Способ получения TNFR2:Fc-продуцироующих CHO может работать с в средах для фаз инокуляции или в других средах наращивания и продуцирования. Подходящие среды для продуцирования гликопротеина в клетках СНО известны в данной области техники и описаны, например, в US 6048728, WO 2011/134920 и WO 2011/134921. Предпочтительно, все среды и, если используются, любые подпитки химически определены и свободны от компонентов животного происхождения.

Как было объяснено выше, рН и температура являются критическими параметрами во избежание образования TNFR2:Fc с дисульфидными связями Cys78-Cys88.

Следовательно, в предпочтительном воплощении, клетку-хозяин на стадии (а) культивируют при температуре 30,5-36,5°С в течение фазы продуцирования; предпочтительно при температуре 30,5-35°C, более предпочтительно при температуре 31-34°С, еще более предпочтительно при температуре 31,5-33°C, и наиболее предпочтительно при температуре 31,5-32,5°С. Кроме того, указанную клетку-хозяин предпочтительно культивируют при рН 6,75-7 на стадии продуцирования; предпочтительно при рН 6,8-6,95, и наиболее предпочтительно при рН 6,85-6,9. Например, рН можно регулировать с помощью рСО2 и/или 2% раствора NaOH. В этом контексте см. также данные в разделе Примеров.

Композиция TNFR2:Fc, которая может быть получена с использованием указанных выше способов, раскрытых в настоящем документе, представляет собой композицию с особенно низким содержанием TNFR2:Fc с дисульфидной связью Cys78-Cys88 на основе суммарного содержания TNFR2:Fc. Таким образом, в настоящем изобретении также предлагается композиция TNFR2:Fc, где аминокислотная последовательность TNFR2:Fc имеет, по меньшей мере, 97% идентичности, предпочтительно, по меньшей мере, 98%, более предпочтительно, по меньшей мере, 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3, содержащей менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88, предпочтительно менее чем 2,1%, предпочтительно менее чем 2%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6%, и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, как определено согласно способу с использованием интегрирования пиков Т7 и Т27, как описано выше.

Такая композиция может быть использована в медицине, например, в способе лечения объекта, где композицию вводят объекту. Более конкретно, композиция, как описано в настоящем документе, может быть использована для предотвращения и/или лечения заболевания, выбранного из аутоиммунного заболевания, анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита, ревматоидного артрита, гранулематоза, воспалительного заболевания кишечника, хронического обструктивного заболевания легких (COPD), гепатита С, эндометриоза, астмы, кахексии, атопического дерматита, болезни Альцгеймера и рака; предпочтительно для лечения заболевания, выбранного из анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита и ревматоидного артрита.

Настоящее изобретение дополнительно описывается следующими воплощениями.

1. Способ определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, где способ включает стадии:

(a) получение образца, содержащего смесь TNFR2:Fc с дисульфидной связью Cys78-Cys88 и TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96;

(b) денатурация и алкилирование образца, полученного на стадии (а);

(c) подвергание образца, полученного на стадии (b), трипсиновому расщеплению;

(d) подвергание образца, полученного на стадии (с), ВЭЖХ, тем самым отделяя фрагменты, характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88; и

(e) проведение интегрирования для пика, характерного для TNFR2:Fc с дисульфидной связью Cys78-Cys88 и для пика, не подверженного влиянию дисульфидных связей Cys74, Cys78, Cys88 и Cys96, как получено на стадии (d);

где аминокислотная последовательность TNFR2-части TNFR2:Fc имеет, по меньшей мере, 97% идентичности, предпочтительно, по меньшей мере, 98%, более предпочтительно, по меньшей мере, 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотами 23-257 из аминокислотной последовательности SEQ ID NO: 1.

2. Способ воплощения 1, где аминокислотная последовательность TNFR2:Fc, применяемого на стадии (а), имеет, по меньшей мере, 97% идентичности, предпочтительно, по меньшей мере, 98%, более предпочтительно, по меньшей мере, 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3 (этанерцепт).

3. Способ воплощения 1 или 2, где пик, не подверженный влиянию дисульфидных связей Cys74, Cys78, Cys88, и Cys96, не подвержен влиянию дисульфидных связей совсем, и это характерно для суммарного TNFR:Fc в образце.

4. Способ воплощения 3, где фрагменты характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88, включают, предпочтительно состоят из аминокислотной последовательности, представленной в SEQ ID NO: 4 («Т7»).

5. Способ воплощения 4, где фрагменты, характерные для суммарного TNFR2:Fc, включают, предпочтительно состоят из аминокислотной последовательности, представленной в SEQ ID NO: 5 («Т27»).

6. Способ воплощения 5, где определяют относительное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 с помощью

(I) интегрирования площади пиков в хроматограмме ВЭЖХ, характерной для TNFR2:Fc с дисульфидной связью Cys78-Cys88 («площадь Т7») и характерной для суммарного TNFR2:Fc («площадь T27»); и

(II) вычисления относительного количества в соответствии с формулой (1).

Отн.%(T7)=([площадь (T7)]/([площадь (T7)]+[площадь (T27)]))x100 (1)

7. Способ любого из предыдущих воплощений, где стадию (b) осуществляют в буфере, содержащем 0,5-1,5 М иодацетамид, предпочтительно 0,9-1,2 М иодацетамид.

8. Способ любого из предыдущих воплощений, где стадию (b) проводят в буфере, содержащем 0,02%-0,5% расщепляемого поверхностно-активного вещества, предпочтительно 0,1%-0,2%; в частности, где поверхностно-активное вещество выбирают из 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфоната натрия, 3-((1-(фуран-2-ил)ундецилокси)карбониламино)пропан-1-сульфоната натрия, и 3-(4-(1,1-бис(гексилокси)этил)пиридиний-1-ил)пропан-1-сульфоната натрия; более предпочтительно, где поверхностно-активное вещество представляет собой 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфонат натрия.

9. Способ любого из предыдущих воплощений, где стадию (b) осуществляют в буфере, имеющем рН в диапазоне 7-9, предпочтительно 7,5-8,5, наиболее предпочтительно примерно рН 8.

10. Способ любого из предыдущих воплощений, где стадию (b) проводят в буфере TRIS, предпочтительно в буфере, содержащем 10-100 мМ TRIS, более предпочтительно 20-80 мМ TRIS.

11. Способ любого из предыдущих воплощений, где стадию (b) проводят при 40-70°С в течение 30-60 мин, предпочтительно при 50-60°С в течение 30-45 мин.

12. Способ любого из предыдущих воплощений, где стадия (с) включает замену буфера образца, полученного на стадии (b), на подходящий буфер для расщепления.

13. Способ любого из предыдущих воплощений, где стадию (с) проводят в буфере для расщепления, имеющем рН в диапазоне 5-7, предпочтительно 5,5-6,5.

14. Способ любого из предыдущих воплощений, где стадию (с) проводят в буфере для расщепления, содержащем MES в качестве буферного агента, предпочтительно в буфере, содержащем 10-100 мМ MES, более предпочтительно 30-60 мМ MES.

15. Способ любого из предыдущих воплощений, где стадию (с) проводят в буфере для расщепления, содержащем 0,02%-0,5% расщепляемого поверхностно-активного вещества, предпочтительно 0,1% -0,2%; в частности, где поверхностно-активное вещество выбирают из 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфоната натрия, 3-((1-(фуран-2-ил)ундецилокси)карбониламино)пропан-1-сульфоната натрия, и 3-(4-(1,1-бис(гексилокси)этил)пиридиний-1-ил)пропан-1-сульфоната натрия; более предпочтительно, где поверхностно-активное вещество представляет собой 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфонат натрия.

16. Способ любого из предыдущих воплощений, где стадию (с) проводят с использованием эффективного количества трипсина в течение 1-24ч, предпочтительно в течение 6-18ч; и при 32-38°С, предпочтительно при 36-37°С.

17. Способ любого из предыдущих воплощений, где стадию (с), прекращают путем добавления 1% муравьиной кислоты в 10% ацетонитриле.

18. Способ любого из предыдущих воплощений, где стадию (d) проводят в подвижной фазе, содержащей 0,05%-0,5% ТФУ в воде, предпочтительно 0,1% -0,2% ТФУ в воде.

19. Способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, причем способ включает

подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, по меньшей мере одной хроматографической стадии, где, по меньшей мере одна хроматографическая стадия включает хроматографию гидрофобного взаимодействия (HIC); и

отделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, и которые содержат уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом, подвергнутым указанной, по меньшей мере, одной хроматографической стадии;

где указанная одна или несколько фракций содержат менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88 на основе суммарного содержания TNFR2:Fc, предпочтительно менее чем 2,1%, предпочтительно менее чем 2%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6%, и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, как было определено с использованием способа согласно воплощению 6.

20. Способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, причем способ включает

подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, по меньшей мере одной хроматографической стадии, где по меньшей мере одна хроматографическая стадия включает хроматографию гидрофобного взаимодействия (HIC); и

отделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, которые имеют уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом, подвергнутого указанной, по меньшей мере, одной хроматографической стадии;

где количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 определяется с использованием способа по любому из воплощений 1-18.

21. Способ воплощения 19 или 20, где, по меньшей мере, одна хроматографическая стадия дополнительно содержит одну или несколько стадий ионообменной хроматографии, которые предпочтительно проводят до HIC.

22. Способ воплощения 21, где одна или несколько стадий ионообменной хроматографии представляют собой одну или более стадий анионообменной хроматографии.

23. Способ воплощения 22, где, по меньшей мере, одна из одной или нескольких стадий анионообменной хроматографии включает мультимодальную анионообменную хроматографию.

24. Способ любого из воплощений 19-23, где способ дополнительно содержит стадию аффинной хроматографии, предпочтительно с использованием Протеина A или Протеина G; причем указанную стадию аффинной хроматографии проводят перед любой другой хроматографической стадией.

25. Способ любого из воплощений 19-24, где аминокислотная последовательность TNFR2:Fc имеет, по меньшей мере, 97% идентичности, предпочтительно по меньшей мере 98%, более предпочтительно по меньшей мере 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3.

26. Способ, включающий:

(a) получение композиции, содержащей TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 в подходящей клетке-хозяине; и

(b) очистку полученной комбинации TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 с помощью способа очистки любого из воплощений 19-25.

27. Способ воплощения 26, где указанную клетку-хозяин культивируют при температуре 30,5-36,5°С в течение фазы продуцирования; предпочтительно при температуре 30,5-35°С, более предпочтительно при температуре 31-34°С, еще более предпочтительно при температуре 31,5-33°C, и наиболее предпочтительно при температуре 31,5-32,5°С.

28. Способ воплощения 26 или 27, где указанную клетку-хозяин культивируют при рН 6,75-7 в фазе продуцирования; предпочтительно при рН 6,80-6,95, а наиболее предпочтительно при рН 6,85-6,9.

29. Способ любого из воплощений 26-28, где указанная клетка-хозяин представляет собой клетку CHO.

30. Композиция TNFR2:Fc, где аминокислотная последовательность TNFR2:Fc имеет, по меньшей мере, 97% идентичности, предпочтительно, по меньшей мере, 98%, более предпочтительно, по меньшей мере, 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3, содержащей менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88 на основе суммарного содержания TNFR2:Fc, предпочтительно менее чем 2,1%, предпочтительно менее чем 2%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6%, и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, как определено согласно способу воплощения 6.

31. Композиция, как определено в воплощении 30, для применения в медицине.

32. Композиция, как определено в воплощении 31, для применения в предотвращении и/или лечении заболевания, выбранного из аутоиммунного заболевания, анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита, ревматоидного артрита, гранулематоза, воспалительного заболевания кишечника, хронического обструктивного заболевания легких ( COPD), гепатита С, эндометриоза, астмы, кахексии, атопического дерматита, болезни Альцгеймера и рака; предпочтительно в лечении заболевания, выбранного из анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита и ревматоидного артрита.

33. Способ любого из воплощений 19-25, где очистку осуществляют в крупном масштабе (100 г TNFR2:Fc или более).

В дальнейшем настоящее изобретение дополнительно проиллюстрировано следующими фигурами и примерами, которые не предназначены для ограничения объема настоящего изобретения. Все ссылки, приведенные в настоящем документе, включены в качестве ссылки в явном виде.

ОПИСАНИЕ ФИГУР

Фигура 1: Схематическое изображение TNFR2:Fc.

Фигура 2: TNFR2:Fc (слева), TNF-альфа (справа).

Фигура 3: Комплекс TNFR2:Fc и TNF-альфа.

Фигура 4: структурное представление TNFR2:Fc с N-концевым доменом рецептора TNF-альфа (см. также SEQ ID NO: 1). Аминокислоты обозначены однобуквенным кодом. Аспарагин-связанные N-гликаны и серин- или треонин-связанные O-гликаны обозначены графически. Корректные дисульфидные связи показаны светло-серыми полосками между конкретными остатками цистеина.

Фигура 5: структурное представление пептида Т7 с некорректными дисульфидными связями (см. также SEQ ID NO: 4) и пептид Т27 внутреннего эталона (см. также SEQ ID NO: 5). Аминокислоты обозначены однобуквенным кодом. Пептид T7 демонстрирует аберрантную дисульфидную связь между цистеинами 78 и 88, и ее представленность отрицательно коррелирует с биологической активностью. Эталонный пептид T27 не вовлечен в дисульфидные связи.

Фигура 6: Дисульфидные связи рецептора (рентгеновская структура, взятая из «Solution of the Structure of the TNF-TNFR2 Complex.» Mukai et al., Sci Signal 3(148), ra83, Nov 2010; добавлены отметки связей и текст).

Фигура 7: Репрезентативные данные, демонстрирующие относительное количество Т7, определенного согласно способу с использованием интегрирования пиков Т7 и Т27, как описано выше, в различных образцах с различной степенью биологической активности. Эффективность на оси у определяли с использованием анализа гена-репортера, значения являются произвольными. Были проанализированы образцы различного качества и корреляцию определяли на основании всех представленных точек на графике.

ОПИСАНИЕ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

(SEQ ID NO: 1)

(Человеческий TNF рецептор типа 2; CD120осн; р75/80; RefSeq (белок): NP_001057)

MAPVAVWAAL AVGLELWAAA HALPAQVAFT PYAPEPGSTC RLREYYDQTA QMCCSKCSPG 60

QHAKVFCTKT SDTVCDSCED STYTQLWNWV PECLSCGSRC SSDQVETQAC TREQNRICTC 120

RPGWYCALSK QEGCRLCAPL RKCRPGFGVA RPGTETSDVV CKPCAPGTFS NTTSSTDICR 180

PHQICNVVAI PGNASMDAVC TSTSPTRSMA PGAVHLPQPV STRSQHTQPT PEPSTAPSTS 240

FLLPMGPSPP AEGSTGDFAL PVGLIVGVTA LGLLIIGVVN CVIMTQVKKK PLCLQREAKV 300

PHLPADKARG TQGPEQQHLL ITAPSSSSSS LESSASALDR RAPTRNQPQA PGVEASGAGE 360

ARASTGSSDS SPGGHGTQVN VTCIVNVCSS SDHSSQCSSQ ASSTMGDTDS SPSESPKDEQ 420

VPFSKEECAF RSQLETPETL LGSTEEKPLP LGVPDAGMKP S 461

SEQ ID NO: 2 (константный домен тяжелой цепи человеческого IgG класса IgG1)

Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys

SEQ ID NO: 3 (этанерцепт)

LPAQVAFTPY APEPGSTCRL REYYDQTAQM CCSKCSPGQH AKVFCTKTSD TVCDSCEDST 60

YTQLWNWVPE CLSCGSRCSS DQVETQACTR EQNRICTCRP GWYCALSKQE GCRLCAPLRK 120

CRPGFGVARP GTETSDVVCK PCAPGTFSNT TSSTDICRPH QICNVVAIPG NASMDAVCTS 180

TSPTRSMAPG AVHLPQPVST RSQHTQPTPE PSTAPSTSFL LPMGPSPPAE GSTGDEPKSC 240

DKTHTCPPCP APELLGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD 300

GVEVHNAKTK PREEQYNSTY RVVSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK 360

GQPREPQVYT LPPSREEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS 420

DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPGK 467

ПРИМЕРЫ

Пример 1: Определение относительного количества T7

TNFR2:Fc представляет собой слитый белок, состоящий из С-концевого Fc-домена антитела и N-концевого домена 2 рецептора TNF-альфа. Структура домена 2 рецептора TNF-альфа имеет решающее значение для биологической активности этого биофармацевтического средства и является весьма сложной, содержащей множество O-гликанов, два N-гликана и одиннадцать дисульфидных связей (см. Фигуры 4 и 6). Можно показать, что форма, по меньшей мере, одного варианта молекулы представлена в конечном лекарственном веществе TNFR2:Fc в результате различных дисульфидных связей.

Путем расщепления образцов TNFR2:Fc с помощью трипсина при невосстанавливающих условиях белок может быть расщеплен на более мелкие компоненты, в то время как структуры дисульфидных связей остаются интактными. Прояснение структуры пептидов с использованием анализа ОФ-ВЭЖХ-МС показало наличие ожидаемых пептидов с корректными дисульфидными связями, а также пептида, обозначенного Т7, который, как было показано, содержит аберрантную дисульфидную связь между цистеинами 78 и 88 (см. Фигуры 5 и 6 и Таблицу 2 выше). В то время как было обнаружено, что относительное содержание некоторых корректных мостиковых структур коррелирует с повышенной биологической активностью, их разнообразие и сложные профили элюирования исключают их использование в качестве стабильных показателей биоактивности с помощью способа ЖХ-УФ/Визуализация. Однако пептид Т7 с некорректными дисульфидными связями демонстрировал устойчивую корреляцию с пониженной биологической активностью. Репрезентативные данные представлены на Фигуре 7, демонстрируя сильную корреляцию между биоактивностью и относительным количеством Т7, определенным в соответствии со способ с использованием интегрирования пиков Т7 и Т27, как описано выше.

Относительное количество Т7 может быть определено следующим образом.

Все образцы размораживали при комнатной температуре. Все стадии центрифугирования проводили на охлаждаемой центрифуге (например, Центрифуга Eppendorf 5804R; Eppendorf, Гамбург, Германия). Использовали, как правило, примерно 80-300 мкг, предпочтительно 100-200 мкг белка на образец. Для того чтобы адаптировать буфер, может быть необходимо сконцентрировать образцы до соответствующей концентрации белка, например, с помощью устройства концентрирования, такого как Vivaspin 500, 10 кДа, Sartorius Art.Nr.: VS0102. К образцам или их концентратам добавляли промывочный буфер (50 мМ TRIS, рН 8) до конечного объема примерно 200 мкл промывочного буфера для промывки. Добавляли 100 мкл денатурирующего раствора. Денатурирующий раствор получали путем смешивания 950мкл 0,1% RapiGest (Waters, no. 186001861) в 50 мМ TRIS рН 8 вместе с 50 мкл 1 М йодацетамида (Sigma, no. I1149) в 50 мМ TRIS, рН 8. Реактив готовили непосредственно перед использованием и закрывали, например, алюминиевой фольгой для защиты от света. Пузыри удаляли путем легкого постукивания, и образец инкубировали в течение 40 мин при 50°C (например, с помощью Thermomixer Comfort; Eppendorf Гамбург, Германия).

Образцам давали возможность остыть до комнатной температуры, а затем заменяли буфер до конечного объема 20-40 мкл буфера для расщепления (50 мМ MES (Sigma, M5287) в воде ВЭЖХ, рН 6). Затем каждый из образцов переносили в реакционную пробирку с безопасной блокировкой и добавляли 25 мкл 50 мМ буфера для расщепления (50 мМ MES в воде ВЭЖХ, рН)+25 мкл буфера для расщепления с поверхностно-активным веществом (0,1% RapiGest (Waters, № 186001861) в буфере 50 мМ MES, рН 6). Добавляли 12мкл свежевосстановленного трипсина, 1нг/мкл (Promega, Трипсин Gold, класс чистоты Масс-Спектр., восстанавливали буфером 50мм MES, рН 6, непосредственно перед использованием). Образец осторожно перемешивали путем осторожного встряхивания, затем недолго осаждали центрифугированием и инкубировали в течение 17 ч при 37°С в нагревательном блоке (например, Thermomixer Comfort; Eppendorf Hamburg, Германия).

После инкубирования образцы удаляли из термомиксера и добавляли 49 мкл терминирующего раствора (1% муравьиной кислоты (класса чистоты ВЭЖХ, например, ThermoScientific, № 40967) в 10% ацетонитрила (ацетонитрил класса чистоты ВЭЖХ ≥ 99,9%, например, Merck № (1.00030.2500)). Его осторожно перемешивали, слегка встряхивая. Образцы центрифугировали в течение прибл. 10мин при 16000g и 6°C. После центрифугирования может быть едва заметен немного непрозрачный осадок. Если образец оставался непрозрачным после первого центрифугирования, то его повторяли. Затем надосадочную жидкость переносили автосэмплером в стеклянную пробирку емкостью 300 мкл, добавляли воду до общего объема приблизительно 236 мкл, и образцы помещали в охлаждаемый автосэмплер.

ВЭЖХ проводили с использованием жидкостного хроматографа с УФ-детектором (например, система 1200SL серии LC с онлайн-дегазатором (G1322A), бинарным модулем насоса (G1312), термостатируемым автосамплером (G1329A/G1330A), термостатируемым отделом колонки (G1316A), детектором VWD (G1314A);. все от Agilent Technologies, Вальдброн, Германия) и соответствующей колонки (например, Ascentis Express Peptide ES-C18, 2,1 мм ID х 15 см L № по кат. 53307-U; Supelco). Использовали следующие параметры:

Время прогона: 45 мин
Скорость потока: 0,8 мл/мин
Сжимаемость Левый насос 46
Сжимаемость Правый насос 115
Температура колонки: 60°C (= заданное значение) 60°C (= заданное значение)
Объем вкола: 50 мкл
Температура автосэмплера: 2-10°C
УФ-детектор: Длина волны: 215 нм
Ширина Пика: 0,025мин
MWD/DAD Детектор: Длина волны: 215 нм
Ширина пика:0,03мин
Ширина полосы: 4нм
Нет Ссылки
Ширина щели: 4нм
Подвижная фаза А 0,1% ТФК (класс ВЭЖХ, Fluka № 40967) в воде ВЭЖХ
Мобильная фаза В 0,1% ТФК в 90% ацетонитриле и 10% воды ВЭЖХ
Градиент

Таблица 3

Время [мин] %B Скорость потока [мл/мин]
0 0 0,8
2,5 0 0,8
25 16 0,8
28 18 0,8
33 100 0,8
37 100 0,8
40 0 0,8
45 0 0,8

Для контроля примесей пустые образцы (подвижная фаза А) могут быть введены каждую, например, 10-ую инъекцию.

Интегрирование хроматограмм осуществляли с использованием подходящей системы данных хроматографии, например Chromeleon (Dionex, Саннивейл, Калифорния, США). Относительное количество пептида Т7 рассчитывали в соответствии со следующим уравнением (формула (1)):

Отн.%(T7)=([площадь (T7)]/([площадь (T7)]+[площадь (T27)]))x100 (1)

Площадь (Т7): площадь пика T7

Площадь (T27): площадь пика T27

Для того чтобы гарантировать, что на колонку нанесли надлежащее количество образца, площадь пика Т27 в заданном образце сравнивали со средней площадью пика инъекции эталонного вещества. Расчеты осуществляли в соответствии с уравнением:

Количество наносимого образца [%]=(аобразцаэталона)*100

аобразца площадь пика T27 образца TNFR:Fc

аэталона средняя площадь пика T27 инъекции эталонного вещества TNFR:Fc

Все используемые вещества относились к классу Ph. Eur. или имели сопоставимое качество. Буферы готовили с использованием очищенной и деионизированной воды. Поставщики и номера заказов для указанных инструментов, материалов и реагентов приведены в качестве примеров. Эти продукты можно считать взаимозаменяемыми с аналогичными продуктами такого же или лучшего качества.

Следует особо отметить, что относительные количества T7, обнаруженные во всех исследованных партиях США и ЕС ENBREL®, показали значения 2,3% или выше при анализе и расчете в соответствии со способом определения по настоящему изобретению с использованием сигнала пептида T27 в качестве эталонного пика, см. Таблицу 5.

Таблица 4. Относительное количество Т7 в эталонном продукте ENBREL®

Партия T7 [%]
#1026663 (US) 2,4
#F36988 (EU) 2,4
#F76195 (EU) 2,8
#1028435 (US) 2,3
#1026662 (US) 2,3
#F69006 (EU) 2,8

Это свидетельствует о том, что способы получения и очистки, представленные в настоящем документе, способны производить TNFR2:Fc и, в частности, этанерцепт с беспрецедентным уровнем уменьшенного количества Т7.

Пример 2: Получение TNFR2:Fc с различными количествами T7

Известно, что варианты с некорректными дисульфидными связями уже могут быть сформированы в процессе выше (USP) для производства TNFR2:Fc. Анализируя образцы DoE (планирование эксперимента) процесса описательных исследований можно было бы показать, что количество вариантов с некорректными дисульфидными связями может влиять на уровень USP (см. Таблицу 4). Приведенные значения получены из статистической модели. Образцы TNFR2:Fc, взятые для создания этой модели, подвергали только аффинной хроматографии с Протеином А и не очищали с помощью гидрофобной хроматографии. Относительное количество T7 определяли в соответствии со способом с использованием интегрирования пиков Т7 и Т27, как описано ниже.

Таблица 5

95% доверительный интервал 95% доверительный интервал
pH T7 [%] Нижний предел Верхний предел Температура [°C] T7 [%] Нижний предел Верхний предел
6,65 3,86 3,59 4,14 30,5 2,21 1,92 2,5
6,70 3,59 3,42 3,76 31,5 2,4 2,24 2,55
6,80 3,25 3,12 3,38 33,0 3,19 3,05 3,32
6,90 3,2 3,04 3,35 34,5 4,59 4,3 4,88
6,95 3,27 3,07 3,48 35,5 5,87 5,31 6,42

Пример 3: Очистка TNFR2:Fc

Во время нижеследующих процессов (DSP) варианты с некорректными дисульфидными связями в основном исчерпанные на стадии очистки HIC, при этом в небольших количествах могут быть уже исчерпанными на предыдущей стадии анионообменной очистки, такой как стадия очистки ММС в проточном режиме.

Аффинная хроматография (Протеин А)

Процесс очистки начинали с бесклеточных надосадочных жидкостей. Материал фильтровали на фильтре 0,2 мкм. Используя Fc-часть слитого белка, TNFR:Fc захватывали с помощью аффинной хроматографии на смоле с Протеином А. Взаимодействие Протеина А с Fc-частью очень специфично. Таким образом, захватывающая хроматография очень эффективно отделяет белки клетки-хозяина (НСР), ДНК и вирус от продукта.

Температура процесса составила 21°C. Надосадочную жидкость клеточной культуры загружали на смолу MabSelect SuRe (GE Healthcare), уравновешенную натрий-фосфатным буфером, pH 7, дополнительно содержащим 150 мМ хлорида натрия. Затем колонку промывали тем же самым буфером до тех пор, пока значение при УФ280 не возвращалось к сигналу, близкому к базовому (примерно 2-6 объемов колонки).

Для увеличения удаляющей способности HCP стадии захвата вводили дополнительную стадию промывки. Этот промывочный буфер содержал ацетат натрия и 0-500 мМ хлорида натрия. За этим следовало элюирование продукта кислотным буфером, имеющим рН ~ 3,2. Элюаты объединяли и обрабатывали для следующей стадии очистки.

Анионообменная хроматография (AEX)

Промежуточный продукт, полученный на стадии аффинной хроматографии, доводили до рН 7,5 и загружали на смолу Фрактогель ТМАЕ HiCap (M) (Merck). После этого колонку промывали натрий-фосфатным буфером и, наконец, продукт элюировали натрий-фосфатным буфером, содержащим 150 мМ хлорида натрия. Элюаты объединяли и обрабатывали для следующей стадии очистки.

ММ хроматография (ММС)

Объединенные элюаты из стадии анионообменной хроматографии доводили по проводимости с использованием 4 М хлорида натрия, и рН доводили до рН 6 с использованием раствора фосфорной кислоты рН ≤ 2. Затем промежуточный продукт загружали на смолу Capto adhere (GE Healthcare), уравновешенную 20 мМ фосфатом натрия, 450 мМ хлоридом натрия, рН 6, и колонку затем промывали 20 мМ фосфатом натрия, 450 мМ хлоридом натрия, рН 6. Элюат и раннюю промывку, содержащую продукт, собирали и объединяли.

Хроматография гидрофобного взаимодействия (HIC)

Объединенные фракции из хроматографии ММ разводили буфером цитрата натрия с рН 6, содержащим 1,4 М сульфат натрия. Проводимость раствора составляла примерно 80 мСм/см. Затем раствор загружали на Toyopearl Phenyl 650 (М) и уравновешивали буфером цитрата натрия с рН 6, содержащим сульфат натрия. Затем колонку промывали тем же самым буфером. Наконец, проводили элюирование с колонк с использованием 0-100% градиента от уравновешивающего буфера до элюирующего буфера (25 мМ цитрат натрия, рН 6).

Чистоту продукта определяли с использованием эксклюзионной хроматографии (SEC), а также путем определения количества ДНК, белков клетки-хозяина (НСР), Протеина А и эндотоксина. Кроме того, рассчитывали для каждой стадии очистки выход постадийно и суммарный выход. Таблица 8 ниже демонстрирует данные, полученные с помощью описанного выше способа, по меньшей мере, для трех прогонов.

Таблица 6 Исчерпание пептида T7 во время нижеследующей обработки

Партия Стадии очистки T7 [%] Эффективность [относительные единицы]
1 Прот A 3,63 71
1 + AEX+MMC 3,05 74
1 + HIC 1,54 91
2 Прот A 3,44 72
2 + AEX+MMC 3,16 75
2 + HIC 1,23 93

Пример 4: Стабильность в условиях стресса

Применение способов, описанных в настоящем документе, позволяет получить препараты TNFR:Fc с пониженным относительным количеством Т7 по сравнению с препаратами TNFR:Fc, известными из уровня техники. Низкое количество T7 также поддерживали при стрессовой обработке.

Таблица 7

Образец No. T7 относительно T27 (% T7)
3 Конечный состав 1,2
3 1 месяц при 40°C 1,8
4 1 месяц при 40°C 1,9

Список использованной литературы

US 7294481

US 6048728

WO 2011/134920

WO 2011/134921

Mukai et al. (2010) «Solution of the Structure of the TNF-TNFR2 Complex.», Sci Signal 3 (148), ra83

1. Способ определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, где способ включает стадии:

(a) предоставления образца, содержащего смесь TNFR2:Fc с дисульфидной связью Cys78-Cys88 и TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96;

(b) денатурации и алкилирования образца стадии (а);

(c) подвергание образца, полученного на стадии (b), трипсиновому расщеплению в невосстанавливающих условиях;

(d) подвергания образца, полученного на стадии (с), ВЭЖХ, тем самым отделяя фрагменты, характерные для TNFR2:Fc с дисульфидной связью Cys78-Cys88, где указанные фрагменты состоят из аминокислотной последовательности, представленной в SEQ ID NO: 4 («Т7»); и

(e) проведения интегрирования для пика, характерного для фрагментов, состоящих из аминокислотной последовательности, представленной в SEQ ID NO: 4 («Т7»), и для пика, не подверженного влиянию дисульфидных связей Cys74, Cys78, Cys88 и Cys96, как получено на стадии (d);

где аминокислотная последовательность TNFR2-части TNFR2:Fc имеет по меньшей мере 97% идентичности, предпочтительно по меньшей мере 98%, более предпочтительно по меньшей мере 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотами 1-235 из аминокислотной последовательности SEQ ID NO: 1.

2. Способ по п.1, отличающийся тем, что аминокислотная последовательность TNFR2:Fc, применяемого на стадии (а), имеет по меньшей мере 97% идентичности, предпочтительно по меньшей мере 98%, более предпочтительно по меньшей мере 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3 (этанерцепт).

3. Способ по п.1 или 2, отличающийся тем, что пик, не подверженный влиянию дисульфидных связей Cys74, Cys78, Cys88 и Cys96, не подвержен влиянию дисульфидных связей совсем и является характерным для суммарного TNFR:Fc в образце.

4. Способ по п.3, отличающийся тем, что фрагменты, характерные для суммарного TNFR2:Fc, содержат, предпочтительно состоят из аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID NO: 5 («Т27»), SEQ ID NO: 24 («Т22»), SEQ ID NO: 29 («Т31»), и SEQ ID NO: 36 («Т39»), более предпочтительно, где фрагменты, характерные для суммарного TNFR2:Fc, содержат, предпочтительно состоят из SEQ ID NO: 5 («T27»).

5. Способ по п.4, отличающийся тем, что относительное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 определяют с помощью

(i) интегрирования площадей пиков в хроматограмме ВЭЖХ, характерных для TNFR2:Fc с дисульфидной связью Cys78-Cys88 («площадь Т7») и характерных для суммарного TNFR2:Fc («площадь T27»); и

(ii) расчета относительного количества согласно формуле (1)

X (в %)=([площадь T7]/([площадь T7]+[площадь T27]))x100 .

6. Способ по любому из предыдущих пунктов, отличающийся тем, что стадию (b) проводят в буфере, имеющем рН в диапазоне 7-9, предпочтительно 7,5-8,5, наиболее предпочтительно примерно рН 8, содержащем

10-100 мМ Tris, более предпочтительно 20-80 мМ Tris; и/или

0,5-1,5 М йодацетамид, предпочтительно 0,9-1,2 M йодацетамид; и/или

расщепляемое поверхностно-активное вещество.

7. Способ по любому из предыдущих пунктов, отличающийся тем, что стадию (b) проводят при 40-70°C в течение 30-60 мин, предпочтительно при 50-60°С в течение 30-45 мин.

8. Способ по любому из предыдущих пунктов, отличающийся тем, что стадию (с) проводят в буфере для расщепления, имеющем рН в диапазоне 5-7, предпочтительно 5,5-6,5; и где буфер для расщепления содержит MES в качестве буферного агента, предпочтительно в буфере, содержащем 10-100 мМ MES, более предпочтительно 30-60 мМ MES; и/или

0,02%-0,5% расщепляемого поверхностно-активного вещества, предпочтительно 0,1% -0,2%.

9. Способ по п.6 или 8, отличающийся тем, что поверхностно-активное вещество независимо выбирают из

3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфоната натрия,

3-((1-(фуран-2-ил)ундецилокси)карбониламино)пропан-1-сульфоната натрия, и

3-(4-(1,1-бис(гексилокси)этил)пиридиний-1-ил)пропан-1-сульфоната натрия;

более предпочтительно, где поверхностно-активное вещество представляет собой 3-[(2-метил-2-ундецил-1,3-диоксолан-4-ил)метокси]-1-пропансульфонат натрия.

10. Способ по любому из предыдущих пунктов, отличающийся тем, что стадию (с) проводят с использованием эффективного количества трипсина в течение 1-24 ч, предпочтительно в течение 6-18 ч; и

при 32-38°С, предпочтительно при 36-37°С.

11. Способ по любому из предыдущих пунктов, отличающийся тем, что стадию (d) проводят в подвижной фазе, содержащей 0,05%-0,5% ТФУ в воде, предпочтительно 0,1% -0,2% ТФУ в воде.

12. Способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, причем способ включает:

(а) подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидными связями Cys78-Cys88, по меньшей мере одной хроматографической стадии, где по меньшей мере одна хроматографическая стадия включает хроматографию гидрофобного взаимодействия (HIC); и

(b) отделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, который содержит уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом согласно (а);

где указанные одна или несколько фракций содержат менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88 на основе суммарного TNFR2:Fc, предпочтительно менее чем 2,1%, предпочтительно менее чем 2,%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6% и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, при определении с использованием способа по п.5.

13. Способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, где способ включает:

(а) подвергание образца, содержащего TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, по меньшей мере одной хроматографической стадии, где по меньшей мере одна хроматографическая стадия включает хроматографию гидрофобного взаимодействия (HIC); и

(b) отделение одной или нескольких фракций, содержащих TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96, которые содержат уменьшенное количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 по сравнению с образцом согласно (а);

где количество TNFR2:Fc с дисульфидной связью Cys78-Cys88 определяют с использованием способа по любому из пп.1-11.

14. Способ получения и очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, включающий:

(a) получение композиции, содержащей TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 в подходящей клетке-хозяине; и

(b) очистку полученной комбинации TNFR2:Fc с дисульфидными связями Cys74-Cys88/Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 с помощью способа очистки по любому из пп.12 или 13.

15. Композиция TNFR2:Fc для лечения заболевания, выбранного из анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита и ревматоидного артрита, где аминокислотная последовательность TNFR2:Fc имеет по меньшей мере 97% идентичности, предпочтительно по меньшей мере 98%, более предпочтительно по меньшей мере 99% идентичности; наиболее предпочтительно 100% идентичности с аминокислотной последовательностью SEQ ID NO: 3, содержащей менее чем 2,2% TNFR2:Fc с дисульфидной связью Cys78-Cys88 на основе суммарного TNFR2:Fc, предпочтительно менее чем 2,1%, предпочтительно менее чем 2%, предпочтительно менее чем 1,9%, предпочтительно менее чем 1,8%, более предпочтительно менее чем 1,7%, еще более предпочтительно менее чем 1,6% и наиболее предпочтительно 1,5% или менее TNFR2:Fc с дисульфидной связью Cys78-Cys88, как определено согласно способу по п.5.



 

Похожие патенты:

Изобретение относится к области биотехнологии. Предложен способ определения сапробности гидробионтов для оценки экологического состояния водоемов, характеризующийся тем, что отбирают пробы гидробионтов из водоема, определяют видовой состав организмов в пробе, получают очищенную ДНК этих организмов, получают последовательности генов с последующей трансляцией в последовательности маркерных белков, пополняют полученными первичными последовательностями генов и белков международные базы данных с последующей выборкой первичных последовательностей ДНК/РНК и белков гидробионтов водоемов.

Изобретение относится к области медицины, в частности к медицинской генетике и онкогематологии, и предназначено для количественного определения мутаций F317L и F359V/C киназного домена BCR-ABL у больных хроническим миелоидным лейкозом, резистентных к терапии ингибиторами тирозинкиназ.
Изобретение относится к области медицины, в частности к медицинской генетике и кардиологии, и предназначено для выявления предрасположенности пациента к атеросклерозу или наличия доклинических признаков этой патологии.

Изобретение относится к области медицины и молекулярной биологии. Предложен экспресс-тест на основе ПЦР для прогнозирования чувствительности образца опухоли головного мозга конкретного пациента к онколитическим вирусам.
Изобретение относится к медицине, а именно к кардиологии. Способ прогнозирования течения хронической сердечной недостаточности (ХСН) заключается в исследовании цельной крови, при этом в цельной крови исследуют полиморфизм генов AGT и АСЕ и при наличии генотипа ТТ полиморфного маркера Met235Thr и аллели D гена АСЕ прогнозируют неблагоприятное течение ХСН.

Изобретение относится к области профилактической медицины, а именно к способу определения атерогенной активности пищевых продуктов, предусматривающему использование клеточной модели моноцитов-макрофагов, выделенных из крови здорового человека, для введения в нее сыворотки крови, взятой у добровольцев, получавших исследуемый пищевой продукт в течение определенного времени, с последующим измерением накопления холестерина в моноцитах-макрофагах модели под действием сыворотки крови и определением ее способности статистически достоверно повышать содержание холестерина в культивируемых клетках.

Настоящее изобретение относится соединению формулы (I) или его мезомерным формам: где mCat+ или mAn- представляет собой органический или неорганический положительно/отрицательно заряженный противоион, и m представляет собой целое число, составляющее от 0 до 2; р представляет собой целое число, составляющее от 1 до 2; q представляет собой целое число, составляющее от 1 до 5; alk представляет собой углеродную цепочку, содержащую от 1 до 5 атомов углерода; Y представляет собой О или СН2; Z представляет собой ОН; n представляет собой 0 или 1; X представляет собой ОН или О-; Ra1 представляет собой SO3- или дополнительный С6-цикл, сконденсированный с соседним атомом углерода, где дополнительный цикл содержит SO3-; Ra2 представляет собой Н; Rc1 представляет собой С1-С6 алкил; Rc2 представляет собой С1-С6 алкил или группу С1-С6 алкилсульфоновой кислоты.

Изобретение относится к медицине и может быть использовано для расшифровки вспышек бактериальных инфекций и определения источника заражения. Для этого проводят отбор биологического материала, выделяют и идентификацируют штаммы бактерий двумя способами: классическим бактериологическим методом и методом масс-спектрометрии с максимально высоким коэффициентом Score (2,2 и выше) с получением протеинограмм - белковых спектров штаммов.

Изобретение относится к области фармакогенетики и персонализированной медицины. Предложен способ анализа полиморфных маркеров в генах SLCO1B1, АРОЕ и АВСВ1 для определения индивидуальной чувствительности к статинам, предусматривающий следующие стадии: амплификацию с помощью мультиплексной одноэтапной ПЦР, обеспечение биочипа, гибридизацию флуоресцентно меченного ПЦР-продукта на биочипе и регистрацию и интерпретацию результатов гибридизации.

Группа изобретений относится к определению того, является ли источником зарегистрированных газовых сигналов болотный газ или коммунальный газ при поиске утечек коммунального газа в подземных трубопроводах.

Изобретение относится к измерительной технике, а именно к устройствам для измерения коэффициента поглощения образца, и может быть использовано в ходе исследования оптических характеристик материалов и покрытий, в том числе отражательной и поглощательной способности, их зависимости от угла падения излучения, зоны облучения, фактуры поверхности и т.д.

Изобретение относится к области приборостроения, более конкретно к методам определения функции распределения частиц по размерам в нанометровом диапазоне. Интерферометрический метод определения функции распределения частиц по размерам основан на анализе изменений как амплитудных, так и фазовых соотношений интерферограмм, полученных до и после введения в рабочий объем интерферометра аэрозоля или взвеси частиц.

Изобретение относится к области медицины, а именно к лабораторной диагностике, основанной на генетическом методе выявления критериев, свидетельствующих о тяжести клинического течения гемофилии.

Группа изобретений относится к области биотехнологии. Предложен способ получения зоны характеризации аналитической пластины для проведения характеризации популяции микроорганизма в присутствии антимикробного агента методом MALDI, способ характеризации популяции микроорганизма (варианты), аналитическая пластина и средство для характеризации популяции микроорганизма, представляющее собой указанную пластину.
Изобретение относится к области медицины, в частности к медицинской генетике и кардиологии, и предназначено для выявления предрасположенности пациента к атеросклерозу или наличия доклинических признаков этой патологии.

Изобретение относится к области металлографического анализа. Устройство содержит анод и катод, причем по меньшей мере часть катода содержит материал, содержащий металл M', значение Δ которого, определяемое следующей формулой, составляет 10 или больше, причем устройство содержит электролитическую ячейку для вмещения раствора электролита, содержащего химический агент, который образует комплексное соединение, содержащее упомянутый металл M' и неводный растворитель,Δ = pKsp[M'x'Ay'] - pKsp [MxAy] = (-log10 Ksp[M'x'Ay']) - (-log10Ksp[MxAy]),в котором произведение растворимости металлического соединения M'x'Ay' определяется как Ksp[M'x'Ay'], а произведение растворимости экстрагируемого металлического соединения MxAy, которое содержится в металлическом материале, определяется как Ksp[MxAy], и в котором M и M' являются различными металлическими элементами, A является одиночным атомом или атомной группой, образующей соединение с M или M', и x, x', y и y' представляют собой доли в составе соединения, определяемые в соответствии с валентностями M, M' и A, а произведение растворимости Ksp является значением в водном растворе при 25°C.

Изобретение относится к аналитическому приборостроению и может быть использовано в устройствах для автоматического отбора и ввода проб жидкости, например, в газовый хроматограф.

Изобретение относится к газовой хроматографии и может быть использовано для концентрирования примесей методом твердофазной экстракции с последующей термодесорбцией в хроматографическую колонку для анализа примесей в нефтяной, газовой, нефтехимической отраслях промышленности, медицине, экологии и др.

Изобретение относится к области газохроматографического анализа ароматических углеводородов. Способ количественного газохроматографического анализа паров трет-бутилбензола в зараженном воздухе, согласно которому анализируют на газовом хроматографе с пламенно-ионизационным детектором пробы воздуха, зараженного парами трет-бутилбензола, отобранные на поглотительный раствор в поглотительном приборе со стеклянной пористой пластиной, отличается тем, что в качестве поглотительного раствора используют этиловый спирт.

Изобретение относится к области медицины и представляет собой способ диагностики первично-резистентной формы секретирующей экстракраниальной герминогенной опухоли у детей, включающий определение инициального значения уровня альфафетопротеина (АФП) у пациента с морфологически верифицированной герминогенной опухолью и уровня АФП на фоне индукционной полихимиотерапии, отличающийся тем, что второе значение уровня АФП определяют после двух циклов индукционной полихимиотерапии на 40-43 дни лечения и используют приведенную на фиг.

Изобретение относится к области медицины и может быть использовано в контрольно-аналитических лабораториях для стандартизации и контроля качества лекарственных средств.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая способ определения TNFR2:Fc с дисульфидной связью Cys78-Cys88 в образце, содержащем TNFR2:Fc с дисульфидными связями Cys74-Cys88Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88, способ очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88Cys78-Cys96, способ получения и очистки TNFR2:Fc с дисульфидными связями Cys74-Cys88Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88 и композиция TNFR2:Fc для лечения заболевания, выбранного из анкилозирующего спондилита, ювенильного ревматоидного артрита, псориаза, псориатического артрита и ревматоидного артрита. В одном из вариантов реализации способ получения и очистки TNFR2:Fc включает в себя стадию получения композиции, содержащей TNFR2:Fc с дисульфидными связями Cys74-Cys88Cys78-Cys96 и TNFR2:Fc с дисульфидной связью Cys78-Cys88. Изобретение расширяет арсенал способов определения и очистки TNFR2:Fc в образце. 5 н. и 10 з.п. ф-лы, 7 ил., 7 табл., 4 пр.

Наверх