Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение



Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
Однодоменные антитела, направленные против фактора некроза опухолей альфа, и их применение
C07K2317/22 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2704232:

АБЛИНКС Н.В. (BE)

Настоящее изобретение относится к иммунологии. Предложена полипептидная конструкция, способная специфически связывать фактор некроза опухолей альфа (TNF-альфа), содержащая два-четыре антагонистических однодоменных антитела, направленных против TNF-альфа, и одно однодоменное антитело, направленное против сывороточного белка. Кроме того, рассмотрена содержащая ее композиция и кодирующая нуклеиновая кислота. Данное изобретение может найти применение в терапии расстройств, связанных с воспалительными процессами или аутоиммунными заболеваниями. 3 н. и 9 з.п. ф-лы, 18 ил., 11 табл., 9 пр.

 

Область техники, к которой относится изобретение

Настоящее изобретение относится к полипептидам, содержащим одно или несколько однодоменных антител, направленных против фактора некроза опухолей альфа (TNF-альфа). Настоящее изобретение также относится к их применению в диагностике и терапии. Такие антитела могут иметь каркасную последовательность с высокой гомологией каркасным последовательностям человека. Описываются композиции, содержащие антитела к фактору некроза опухолей альфа (TNF-альфа), одни или в сочетании с другими лекарственными средствами.

Уровень техники

Полагают, что фактор некроза опухолей альфа (TNF-альфа) играет важную роль в различных расстройствах, например, в воспалительных расстройствах, таких как ревматоидный артрит, болезнь Крона, неспецифический язвенный колит и рассеянный склероз. Как TNF-альфа, так и рецепторы (CD120a, CD120b) исследованы весьма подробно. TNF-альфа в своей биологически активной форме является тримером, и желобок, образованный соседними субъединицами, важен для взаимодействия цитокин-рецептор. Некоторые стратегии противодействия действию цитокинов разработаны и в настоящее время применяются для лечения различных болезненных состояний.

Ингибитор TNF-альфа, обладающий достаточной специфичностью и селективностью в отношении TNF-альфа, может являться эффективным профилактическим или лечебным фармацевтическим соединением для предупреждения или лечения расстройств, в которые TNF-альфа вовлекается как причинный фактор. Описаны способы лечения токсического шока (ЕР 486526), регрессии опухолей, ингибирования цитотоксичности (US 6448380, US 6451983, US 6498237), аутоиммунной болезни, такой как RA и болезнь Крона (ЕР 663836, US 5672347, US 5656272), реакции "трансплантат против хозяина" (US 5672347), бактериального менингита (ЕР 585705) с помощью антител к TNF-альфа.

Пока ни одно из доступных в настоящее время лекарственных средств не является совершенно эффективным для лечения аутоиммунной болезни, и большинство имеют ограничения из-за сильной токсичности. Кроме того, процесс разработки новых химических форм (NCE) достаточной эффективности и селективности к таким последовательностям-мишеням является исключительно трудным и длительным. С другой стороны, лечебные средства на основе антител имеют существенные возможности как лекарственные средства, поскольку они имеют совершенную селективность в отношении своей мишени и низкую собственную токсичность. Кроме того, время разработки можно значительно уменьшить по сравнению с разработкой новых химических форм (NCE). Однако трудно создавать обычные антитела против мультимерных белков, в которых рецепторсвязывающий домен лиганда внедрен в желобок, как в случае TNF-альфа. Антитела на основе тяжелых цепей, описанные в изобретении, полученные из Camelidae (семейство верблюдовых), известны как обладающие склонностью к связыванию с полостью (WO 97/49805; Lauwereyes et al., EMBO J., 17, 5312, 1998). Поэтому такие антитела на основе тяжелых цепей по своему существу являются подходящими для связывания с рецепторсвязывающими доменами таких лигандов, как TNF. Кроме того, известно, что такие антитела устойчивы в течение длительных периодов времени, следовательно, повышается их срок хранения (Perez et al., Biochemistry, 40, 74, 2001). Кроме того, фрагменты таких антител на основе тяжелых цепей можно получать "в массе" в ферментерах с использованием дешевых, по сравнению с выращиванием культур клеток млекопитающих, экспрессирующих систем, таких как дрожжи и другие микроорганизмы (ЕР 0698097).

Применение антител, полученных из таких источников, как мышь, овца, коза, кролик и т.д., и их гуманизированных производных в качестве лечебного средства при состояниях, при которых требуется модуляция воспаления, проблематично по нескольким причинам. Традиционные антитела неустойчивы при комнатной температуре и должны охлаждаться при получении и хранении, что требует необходимого холодильного лабораторного оборудования, охлаждения при хранении и транспортировке, что вносит вклад в длительность и стоимость. Охлаждение иногда неосуществимо в развивающихся странах. Кроме того, изготовление или мелкомасштабное производство указанных антител дорогостоящее, поскольку системы клеток млекопитающих, необходимые для экспрессии интактных и активных антител, требуют высокого уровня финансовой поддержки в смысле времени и оборудования, а выходы весьма низкие. Кроме того, большой размер обычных антител может ограничивать их проникновение в ткани, например, в месте воспаления ткани. Кроме того, традиционные антитела обладают связывающей активностью, которая зависит от рН, и, следовательно, они не подходят для применения в средах, выходящих за пределы физиологического интервала рН, таких как, например, при лечении желудочного кровотечения, операции на желудке. Кроме того, традиционные антитела неустойчивы при низком или высоком рН, и, следовательно, они не подходят для перорального введения. Однако показано, что антитела верблюдовых устойчивы в жестких условиях, таких как экстремальный рН, денатурирующие реагенты и высокие температуры (Dumoulin et al., Protein Science, 11, 500, 2002), причем это делает их подходящими для доставки путем перорального введения. Кроме того, традиционные антитела обладают связывающей активностью, которая зависит от температуры, и, следовательно, они не подходят для применения в анализах или наборах, выполняемых при температурах вне интервалов биологически активных температур (например, 37±20°С).

Полипептидные лечебные средства и, в частности, лечебные средства на основе антител, имеют существенный потенциал как лекарственные средства, поскольку они имеют совершенную специфичность к своей мишени и низкую собственную токсичность. Однако специалистам известно, что антитела, которые получают для терапевтически пригодной мишени, необходимо дополнительно модифицировать для того, чтобы подготовить их для лечения людей, с тем, чтобы избежать нежелательной иммунной реакции отдельного человека на их введение. Способ модификации обычно называют "гуманизацией". Специалистам в данной области техники известно, что антитела, полученные в видах иных, чем человек, требуют гуманизации для того, чтобы придать антителам лечебную пригодность для людей (1) привика CDR: Protein Design Labs: US 6180370, US 5693761; Genetech: US 6054297; Celltech: 460167, EP 626390, US 5859205; (2) "облицовка" (veneering): Xoma: US 5869619, US 5766886, US 5821123). Существует потребность в способе получения антител, при котором не требуется существенной гуманизации или при котором полностью устраняется необходимость гуманизации. Существует потребность в новом классе антител, которые имеют определенные каркасные области или аминокислотные остатки, которые можно вводить субъекту-человеку при отсутствии потребности в существенной гуманизации или вовсе без необходимости гуманизации.

Другим важным недостатком обычных антител является то, что они представляют собой сложные большие молекулы и поэтому относительно неустойчивы, и они чувствительны к разложению протеазами. Это означает, что лекарственные средства на основе обычных антител нельзя вводить перорально, сублингвально, местно, назально, вагинально, ректально или ингаляцией, поскольку они не устойчивы к низкому рН в указанных участках, действию протеаз в указанных участках и в крови и/или из-за их большого размера. Их следует вводить инъекцией (внутривенно, подкожно и т.д.) для того, чтобы преодолеть некоторые из указанных проблем. Введение инъекцией требует обучения специалистов для того, чтобы использовать шприц и иглу для подкожных инъекций правильно и безопасно. Для этого также требуется стерильное оборудование, жидкая композиция лечебного полипептида, упаковка указанного полипептида во флаконы в стерильной и стабильной форме и подходящее место для введения иглы у субъекта. Кроме того, субъекты обычно испытывают физический и психический стресс перед и после получения инъекции. Поэтому существует потребность в способе для доставки лечебных полипептидов, при котором удается избежать инъекции, что не только экономит средства/время, но также может быть более удобным и более комфортным для субъекта.

Лечебные средства на основе однодоменных антител имеют существенный потенциал как лекарственные средства, поскольку они обладают совершенной специфичностью в отношении своей мишени и низкой собственной токсичностью. Однако дальнейшее улучшение присущей им и функциональной аффинности может привести ко многим преимуществам для пациента, таким как уменьшенная доза лечебного средства, более быстрое лечение и уменьшенное побочное действие.

Цели настоящего изобретения

Целью настоящего изобретения является обеспечение полипептидов, содержащих одно или несколько однодоменных антител, связывающихся с TNF-альфа, гомологи указанных антител, функциональные части гомологов указанных полипептидов. Такие полипептиды модифицируют биологическую активность TNF-альфа после связывания. Такие полипептиды могут вступать в связь с рецепторсвязывающим желобком TNF-альфа или могут не связываться в рецепторсвязывающем желобке. Такие полипептиды представляют собой однодоменные антитела.

Другой целью настоящего изобретения является обеспечение однодоменных антител, которые могут представлять собой любые известные в уровне технике или будущие однодоменные антитела. Примерами являются, но не ограничиваются перечисленным, антитела на основе тяжелых цепей, антитела, встречающиеся в природе, лишенные легких цепей, однодоменные антитела, полученные из обычных 4-цепочечных антител, сконструированные антитела и однодоменные конструкции иные, чем полученные из антител. Согласно одному аспекту изобретения, однодоменные антитела, используемые в данном случае, представляют собой встречающиеся в природе однодоменные антитела, известные как антитела на основе тяжелых цепей, лишенные легких цепей (WO 94/04678). Для ясности, вариабельный домен, полученный из антитела на основе тяжелой цепи, лишенного легкой цепи, будет называться VHH или нанотелом, для того, чтобы отличить его от обычного VH четырехцепочечных иммуноглобулинов. Молекулы таких VHH можно получить из антител, вырабатываемых видом Camelidae, например, верблюдом, ламой, дромедаром, альпакой и гуанако.

Другой целью изобретения является обеспечение способа введения полипептидов против TNF-альфа внутривенно, подкожно, перорально, сублингвально, местно, назально, вагинально, ректально или ингаляцией.

Еще одной целью изобретения является усиление аффинности связывания одновалентных однодоменных антител.

Раскрытие изобретения

Воплощением настоящего изобретения является полипептид против TNF-альфа, содержащий, по меньшей мере, одно однодоменное антитело против TNF-альфа.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, в котором однодоменное антитело соответствует последовательности, представленной любой из SEQ ID NO:1-16 и 79-84.

Еще одним воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, дополнительно содержащий, по меньшей мере, одно о дно доменное антитело, направленное против сывороточного белка.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, где указанный сывороточный белок представляет собой любой белок из числа сывороточного альбумина, сывороточных иммуноглобулинов, тироксинсвязывающего белка, транферрина или фибриногена.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, где однодоменное антитело против сывороточного белка соответствует последовательности, представленной любой из SEQ ID NO:26-29 и 85-97.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, соответствующей последовательности, представленной любой из SEQ ID NO:30-43.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, содержащий, по меньшей мере, одно однодоменное антитело, выбранное из группы, состоящей из однодоменного антитела против IFN-гамма, однодоменного антитела против рецептора TNF-альфа и однодоменного антитела против рецептора IFN-гамма.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, где число однодоменных антител, направленных против TNF-альфа, равно, по меньшей мере, двум.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, соответствующей последовательности, представленной любой из SEQ ID NO:73-76.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, где, по меньшей мере, одно однодоменное антитело представляет собой гуманизированные VHH Camelidae.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, где гуманизированное VHH Camelidae соответствует последовательности, представленной любой из SEQ ID NO:17-19 и 21-24.

Другим воплощением настоящего изобретения является композиция, содержащая полипептид против TNF-альфа, описанный выше, и, по меньшей мере, одно однодоменное антитело, выбранное из группы, состоящей из однодоменного антитела против IFN-гамма, однодоменного антитела против рецептора TNF-альфа и однодоменного антитела против рецептора IFN-гамма, для одновременного, раздельного или последовательного введения субъекту.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, где, по меньшей мере, одно однодоменное антитело против IFN-гамма соответствует последовательности, представленной любой из SEQ ID NO:44-72.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, где указанное однодоменное антитело представляет собой гомологичную последовательность, функциональную часть или функциональную часть гомологичной последовательности полноразмерного однодоменного антитела.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, где полипептид против TNF-альфа представляет собой гомологичную последовательность, функциональную часть или функциональную часть гомологичной последовательности полноразмерного полипептида против TNF-альфа.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, где, по меньшей мере, одно однодоменное антитело представляет собой VHH Camelidae.

Другим воплощением настоящего изобретения является нуклеиновая кислота, кодирующая полипептид против TNF-альфа, описанный выше.

Другим воплощением настоящего изобретения является способ идентификации средства, которое модулирует связывание полипептида против TNF-альфа, описанного выше, с фактором некроза опухолей альфа, включающий стадии:

(a) приведения в контакт полипептида против TNF-альфа, описанного выше, с мишенью, которая представляет собой фактор некроза опухолей альфа, в присутствии и в отсутствие кандидата в модуляторы в условиях, допускающих связывание между указанным полипептидом и мишенью, и

(b) измерения связывания между полипептидом и мишенью на стадии (а), где уменьшение связывания в присутствии указанного кандидата в модуляторы относительно связывания в отсутствие указанного кандидата в модуляторы идентифицирует указанного кандидата в модуляторы как средство, которое модулирует связывание полипептида против TNF-альфа, описанного выше, и фактора некроза опухолей альфа.

Другим воплощением настоящего изобретения является способ идентификации средства, которое модулирует расстройства, опосредуемые фактором некроза опухолей альфа, через связывание полипептида против TNF-альфа, описанного выше, с фактором некроза опухолей альфа, включающий:

(a) приведение в контакт полипептида против TNF-альфа, описанного выше, с мишенью, которая представляет собой фактор некроза опухолей альфа, в присутствии и в отсутствие кандидата в модуляторы в условиях, допускающих связывание между указанным полипептидом и мишенью, и

(b) измерение связывания между полипептидом и мишенью на стадии (а), где уменьшение связывания в присутствии указанного кандидата в модуляторы относительно связывания в отсутствие указанного кандидата в модуляторы идентифицирует указанный кандидат в модуляторы как средство, которое модулирует расстройства, опосредуемые фактором некроза опухолей альфа.

Другим воплощением настоящего изобретения является способ идентификации средства, которое модулирует связывание фактора некроза опухолей альфа с его рецептором через связывание полипептида против TNF-альфа, описанного выше, с фактором некроза опухолей альфа, включающий:

(а) приведение в контакт полипептида против TNF-альфа, описанного выше, с мишенью, которая представляет собой фактор некроза опухолей альфа, в присутствии и в отсутствие кандидата в модуляторы в условиях, допускающих связывание между указанным полипептидом и мишенью, и

(b) измерение связывания между полипептидом и мишенью на стадии (а), где уменьшение связывания в присутствии указанного кандидата в модуляторы относительно связывания в отсутствие указанного кандидата в модуляторы идентифицирует указанный кандидат в модуляторы как средство, которое модулирует связывание фактора некроза опухолей альфа с его рецептором.

Другим воплощением настоящего изобретения является набор для скрининга веществ, которые модулируют расстройства, опосредуемые фактором некроза опухолей альфа, содержащий полипептид против TNF-альфа, описанный выше, и фактор некроза опухолей альфа.

Другим воплощением настоящего изобретения является неизвестное средство, которое модулирует связывание полипептида против TNF-альфа, описанного выше, с фактором некроза опухолей альфа, идентифицированное способом, описанным выше.

Другим воплощением настоящего изобретения является неизвестное средство, которое модулирует расстройства, опосредуемые фактором некроза опухолей альфа, идентифицированное способами, описанными выше.

Другим воплощением настоящего изобретения является неизвестное средство, описанное выше, где указанные расстройства представляют собой одно или несколько расстройств из числа воспаления, ревматоидного артрита, болезни Крона, неспецифического язвенного колита, синдрома воспаленной толстой кишки и рассеянного склероза.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или нуклеиновая кислота, описанная выше, или композиция, описанная выше, или средство, описанное выше, для лечения и/или предупреждения, и/или облегчения расстройств, относящихся к воспалительным процессам.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, или нуклеиновой кислоты, описанной выше, или композиции, описанной выше, или средства, описанного выше, для получения лекарственного средства для лечения и/или предупреждения, и/или облегчения расстройств, относящихся к воспалительным процессам.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, для лечения и/или предупреждения, и/или облегчения расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, способным проходить через среду в желудке без инактивации вещества.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, или композиции, описанной выше, для получения лекарственного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, способным проходить через среду в желудке без инактивации вещества.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, для лечения и/или предупреждения, и/или облегчения расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым во влагалище или прямую кишку.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, или композиции, описанной выше, для получения лечебного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым во влагалище или прямую кишку.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, для лечения и/или предупреждения, и/или облегчения расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в нос, верхние дыхательные пути и/или легкие.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, или композиции, описанной выше, для получения лечебного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в нос, верхние дыхательные пути и/или легкие.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, для лечения и/или предупреждения, и/или облегчения расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в слизистую оболочку кишечника, где указанное расстройство повышает проницаемость слизистой оболочки кишечника.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, или композиции, описанной выше, для получения лечебного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в слизистую оболочку кишечника, где указанное расстройство повышает проницаемость слизистой оболочки кишечника.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, для лечения и/или предупреждения, и/или облегчения расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, способным эффективно проходить через ткани под языком.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, или композиции, описанной выше, для получения лечебного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, способным эффективно проходить через ткани под языком.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный выше, или композиция, описанная выше, для лечения и/или предупреждения, и/или облегчения расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, способным эффективно проходить через кожу.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, или композиции, описанной выше, для получения лечебного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, способным эффективно проходить через кожу.

Другим воплощением настоящего изобретения является способ, описанный выше, набор, описанный выше, нуклеиновая кислота или средство, описанные выше, применение нуклеиновой кислоты или средства, описанное выше, композиция, описанная выше, применение композиции, описанное выше, полипептид против TNF-альфа, описанный выше, применение полипептида против TNF-альфа, описанное выше, где указанные расстройства представляют собой любое расстройство из числа воспаления, ревматоидного артрита, болезни Крона, неспецифического язвенного колита, синдрома воспаленной толстой кишки, рассеянного склероза, болезни Аддисона, аутоиммунного гепатита, аутоиммунного паротита, диабета типа I, эпидидимита, гломерулонефрита, болезни Грейвса, синдрома Гийена-Барре, болезни Хасимото, гемолитической анемии, системной красной волчанки, мужского бесплодия, астенического бульбарного паралича, пузырчатки, псориаза, ревматической лихорадки, саркоидоза, склеродермы, синдрома Шегрена, спондилоартропатий, тиреоидита и васкулита.

Другим воплощением настоящего изобретения является композиция, содержащая нуклеиновую кислоту или средство, описанные выше, полипептид против TNF-альфа, описанный выше, или композицию, описанную выше, и подходящий фармацевтический наполнитель.

Другим воплощением настоящего изобретения является способ диагностики расстройства, характеризуемого дисфункцией фактора некроза опухолей альфа, включающий:

(a) приведение в контакт образца с полипептидом против TNF-альфа, описанным выше,

(b) детекцию связывания указанного полипептида с указанным образцом и

(c) сравнение связывания, обнаруженного на стадии (b), со стандартом, где различие в связывании относительно указанного образца является диагнозом расстройства, характеризуемого дисфункцией фактора некроза опухолей альфа.

Другим воплощением настоящего изобретения является набор для скрининга на расстройство, указанное выше, с использованием способа, описанного выше.

Другим воплощением настоящего изобретения является набор для скрининга на расстройство, указанное выше, содержащий изолированный полипептид против TNF-альфа, описанный выше.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, для очистки указанного фактора некроза опухолей альфа.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, описанного выше, для ингибирования взаимодействия между фактором некроза опухолей альфа и одним или несколькими рецепторами фактора некроза опухолей альфа.

Другим воплощением настоящего изобретения является способ получения полипептида против TNF-альфа, описанного выше, включающий стадии:

(a) получения двухцепочечной ДНК, кодирующей VHH Camelidae, направленное против фактора некроза опухолей альфа,

(b) клонирования и экспрессии ДНК, отобранной на стадии (а).

Другим воплощением настоящего изобретения является способ получения полипептида против TNF-альфа, описанного выше, включающий:

(a) культивирование клеток-хозяев, содержащих нуклеиновую кислоту, способную кодировать полипептид против TNF-альфа, описанный выше, в условиях, допускающих экспрессию полипептида, и

(b) извлечение полученного полипептида из культуры. Другим воплощением настоящего изобретения является способ, описанный выше, где указанные клетки-хозяева являются бактериальными или дрожжевыми.

Другим воплощением настоящего изобретения является набор для скрининга на любое расстройство из числа воспаления, ревматоидного артрита, болезни Крона, неспецифического язвенного колита, синдрома воспаленной толстой кишки и рассеянного склероза, содержащий полипептид против TNF-альфа, описанный выше.

Краткое описание фигур и таблиц

Фигура 1. Выравнивание VHH против человеческого TNF, описанных в примере 1.

Фигура 2. Серийные разведения при испытании методом ELISA VHH против человеческого TNF согласно примеру 1.

Фигура 3. Антагонистическое действие VHH согласно примеру 1 при определении в анализе на цитотоксичность с использованием линии человеческих клеток KYM.

Фигура 4. In vitro анализ связывания рецепторов VHH#12B дикого типа и мутанта A74S+Y76N+K83R+P84A.

Фигура 5. In vitro анализ связывания рецепторов VHH#12B дикого типа и мутанта 1Е+Q5LA74S+Y76N+K83R+Р84А.

Фигура 6. Связывание VHH#3E дикого типа и мутантных VHH в методе ELISA.

Фигура 7. In vitro анализ связывания VHH#3E дикого типа и мутантных VHH.

Фигура 8. Выравнивание антагонистических VHH против мышиного TNF, описанных в примере 3.

Фигура 9. Антагонистическое действие VHH согласно примеру 3 против мышиного TNF при определении в анализе на цитотоксичность с использованием мышиной клеточной линии L929.

Фигура 10. Вставка EcoRI - HindIII вектора pAX11 (на основе pUC119) для получения бивалентного или биспецифического VHH.

Фигура 11. PAGE (15%) с окрашиванием кумасси очищенных методом IMAC моно- (полоса 8), би- (полоса 1), три- (полосы 2, 3 и 5) и тетравалентного (полосы 4, 6 и 7) VHH против TNFa.

Фигура 12. Хроматограмма анализа методом гель-фильтрации на Superdex 75HR моно-, би- и тривалентного VHH.

Фигура 13. Сравнение антагонистических характеристик моно-, би-, три- и тетравалентной формы VHH против человеческого TFN с используемьми клинически продуктами Remicade и Enbrel.

Фигура 14. Антагонистическое поведение моно- и бивалентных VHH, направленных против мышиного TNF-альфа.

Фигура 15. PAGE с окрашиванием кумасси слитого белка VHH-Fc, происходящего из человеческого IgG1, описанного в примере 4.

Фигура 16. Антагонистическая эффективность слитого белка VHH-Fc, полученного из VHH#3E, по сравнению с бивалентной формой VHH#3E при определении в биоанализе.

Фигура 17. ELISA образца сравнения и обработанного пепсином TNF3E при рН 2,2, рН 3,2 и рН 4,2 (100% представляет собой сигнал, измеренный при разведении 1/100).

Фигура 18. Схема эксперимента.

Таблица 1. Список аминокислотных последовательностей пептидов, направленных против TNF-альфа, являющихся аспектами настоящего изобретения,.

Таблица 2. Перечень реакций мутагенеза, мутагенных праймеров и матриц, используемых для мутагенеза VHH#12B.

Таблица 3. Перечень реакций мутагенеза, мутагенных праймеров и матриц, используемых для мутагенеза VHH#3E.

Таблица 4. Обзор гуманизированных VHH и VHH дикого типа.

Таблица 5. VHH против мышиного сывороточного альбумина/против TNF-альфа.

Таблица 6. Список аминокислотных последовательностей VHH, направленных против человеческого IFN-гамма.

Таблица 7. Последовательности двухвалентного (BIV 3Е, BIV#m3F), трехвалентного (TRI3E) или тетравалентного (TETRA3E) VHH, направленного против TNF-альфа.

Таблица 8. Частичные гомологии аминокислотных последовательностей VHH против мышиного сывороточного альбумина по изобретению.

Таблица 9. Частичные гомологии VHH против TNF-альфа по изобретению.

Таблица 10. Гомология, в процентах, между VHH против IFN-гамма по изобретению.

Таблица 11. Схема обработки.

Осуществление изобретения

Настоящее изобретение относится к полипептидам против фактора некроза опухолей альфа (TNF-альфа), содержащим одно или несколько однодоменных антител, направленных против TNF-альфа. Изобретение также относится к нуклеиновой кислоте, способной кодировать указанные полипептиды.

Однодоменные антитела представляют собой антитела, чьи гипервариабельные участки являются частью однодоменного полипептида. Примерами являются, но не ограничиваются перечисленным, антитела на основе тяжелых цепей, антитела, естественно лишенные легких цепей, однодоменные антитела, полученные из обычных 4-цепочечных антител, сконструированные антитела и однодоменные конструкции иные, чем полученные из антител. Однодоменные антитела могут быть известными в уровне техники или представлять собой будущие однодоменные антитела. Однодоменные антитела можно получить из любого вида, в том числе, но без ограничения, из мыши, человека, верблюда, ламы, козы, кролика, коровы. Согласно одному аспекту изобретения однодоменные антитела, используемые в данном случае, представляют собой встречающиеся в природе однодоменные антитела, известные как антитела на основе тяжелых цепей, лишенные легких цепей. Такие однодоменные антитела описываются, например, в WO 94/04678. Для ясности, такой вариабельный домен, полученный из антитела на основе тяжелой цепи, естественно лишенного легкой цепи, в данном случае известен как VHH или нанотело, для того, чтобы отличить его от обычного VH четырехцепочечных иммуноглобулинов. Молекулу такого VHH можно получить из антител, вырабатываемых видом Camelidae, например, верблюдом, дромедаром, ламой, альпакой и гуанако. Антитела на основе тяжелых цепей, естественно лишенные легкой цепи, могут продуцировать другие виды, кроме Camelidae; такие VHH входят в объем изобретения.

VHH по настоящему изобретению, как и известные специалистам, представляют собой вариабельные домены тяжелых цепей, полученные из иммуноглобулинов, естественно лишенных легких цепей, таких как антитела, полученные от Camelidae, описанные в WO 94/04678 (и называемые далее VHH-доменами или нанотелами). Молекулы VHH примерно в 10х меньше молекул IgG. Они представляют собой отдельные полипептиды и весьма устойчивы, выдерживая условия экстремального рН и температуры. Кроме того, они устойчивы к воздействию протеаз, что не свойственно обычным антителам. Кроме того, экспрессия VHH in vitro происходит с хорошим выходом правильно уложенных функциональных VHH. Кроме того, антитела, генерированные в Camelids, будут узнавать эпитопы иные, чем эпитопы, узнаваемые антителами, генерированными in vitro с использованием библиотек антител или путем иммунизации млекопитающих иных, чем Camelids (WO 97/49805). Как таковые, VHH против TNF-альфа могут взаимодействовать с TNF-альфа эффективнее, чем обычные антитела, посредством этого блокируя более эффективно его взаимодействие с рецептором TNF-альфа.

Согласно изобретению TNF-альфа получают от любого вида. Примерами видов, подходящих по изобретению, являются кролики, козы, мыши, крысы, коровы, телята, верблюды, ламы, обезьяны, ослы, морские свинки, куры, овцы, собаки, кошки, лошади и, предпочтительно, люди.

TNF-альфа также представляет собой фрагмент TNF-альфа, способный вызывать иммунную реакцию. TNF-альфа также представляет собой фрагмент TNF-альфа, способный связываться с однодоменным антителом, выработанным против полноразмерного TNF-альфа.

Термин "однодоменное антитело, направленное против TNF-альфа" обозначает однодоменное антитело, которое способно связываться с TNF-альфа с аффинностью лучше 10-6 М.

Воплощением настоящего изобретения является полипептид против TNF-альфа, где однодоменные антитела содержат VHH Camelidae, направленные против TNF-альфа.

Одно или несколько однодоменных антител полипептида против TNF-альфа, направленные против TNF-альфа, могут иметь одну и ту же последовательность. С другой стороны, они могут не все иметь одинаковую последовательность. В объеме изобретения полипептид против TNF-альфа содержит однодоменные антитела против TNF-альфа, которые не все имеют одну и ту же последовательность, но которые направлены против одной и той же мишени, одного или нескольких ее антигенов.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, где однодоменное антитело соответствует последовательности, представленной любой из SEQ ID NO:1-16 и 79-84, приведенных в табл.1. Указанные последовательности получены из антител на основе тяжелых цепей (VHH) Camelidae, направленных против TNF-альфа.

Настоящее изобретение также относится к полипептиду против TNF-альфа, где указанное однодоменное антитело представляет собой VHH, направленную против TNF-альфа, где VHH принадлежит к классу, имеющему последовательности, сходные с человеческими. Данный класс отличается тем, что VHH содержат аминокислоту из группы, состоящей из глицина, аланина, валина, лейцина, изолейцина, пролина, фенилаланина, тирозина, триптофана, метионина, серина, треонина, аспарагина или глутамина, в позиции 45, такую как, например, L45, и триптофан в позиции 103, согласно нумерации по Kabat. Новый класс однодоменных антител Camelidae, описанный в данном изобретении (табл.1, пример 1), представляют VHH#2B (SEQ ID NO:3) и VHH#12B (SEQ ID NO:14), содержащие гидрофобные остатки в FR2 в сочетании с гидрофобным остатком триптофаном в позиции 103.

Другой класс однодоменных антител Camelidae, сходных с человеческими, представленных последовательностями VHH#1A (SEQ ID NO:1), VHH#4B (SEQ ID NO:12), VHH#8-29 (SEQ ID NO:81), VHH#8-41 (SEQ ID NO:82), VHH#8-42 (SEQ ID NO:83) и VHH#8-44 (SEQ ID NO:84) (табл.1, пример 1), описан в WO 035694, которые содержат гидрофобные остатки FR2, типично обнаруживаемые в обычных антителах человеческого происхождения или из других видов, но такая потеря в гидрофильности компенсируется несущим заряд остатком аргинина в позиции 103, который заменяет консервативный триптофановый остаток, присутствующий в VH из двухцепочечных антител. Как таковые, пептиды, принадлежащие к указанным двум классам, показывают высокую гомологию аминокислотных последовательностей с каркасными участками VH человека, и указанные пептиды можно вводить людям непосредственно, не ожидая нежелательной иммунной реакции на них, и без бремени дальнейшей гуманизации. Изобретение также относится к нуклеиновым кислотам, способным кодировать указанные полипептиды.

Таким образом, в одном аспекте изобретение относится к прямому введению пациенту, нуждающемуся в этом, полипептида против TNF-альфа, где однодоменные антитела принадлежат к гуманизированному классу VHH и содержат последовательность, представленную любой последовательностью из числа SEQ ID NO:1, 3, 12, 14, 81, 82, 83 и 84.

Любая из VHH, используемая в изобретении, может представлять собой VHH из традиционного класса или классов однодоменных антител Camelidae, сходных с человеческими. Указанные антитела могут быть направлены против всего TNF-альфа или его фрагмента или фрагмента гомологичной ему последовательности. Такие полипептиды включают полноразмерные антитела Camelidae, а именно, области Fc и VHH, химерные варианты антител Camelidae на основе тяжелых цепей и человеческой Fc-области или VHH сами по себе или производные фрагменты.

VHH против сывороточного альбумина могут взаимодействовать более эффективно, чем обычные антитела, с сывороточным альбумином, известным как белок-переносчик. Как в белке-переносчике, некоторые эпитопы сывороточного альбумина могут быть недоступны за счет связанных белков, пептидов и химических соединений с небольшими молекулами. Так как известно, что VHH связываются в "необычными" или нетрадиционными эпитопами, такими как полости (WO 97/49805), аффинность таких VHH к альбумину в кровотоке может быть повышенной.

Настоящее изобретение также относится к открытию, что полипептид против TNF-альфа, описанный выше, также содержащий одно или несколько однодоменных антител, направленных против одного или нескольких сывороточных белков субъекта, неожиданно имеет существенно удлиненный полупериод существования в кровотоке указанного субъекта по сравнению с полупериодом существования однодоменных антител против TNF-альфа, когда они не являются частью указанной конструкции. Примеры таких полипептидов представлены в табл.5 последовательностями SEQ ID NO:30-43. Кроме того, обнаружено, что указанные полипептиды, оставаясь интактными в организме мышей, проявляют такие благоприятные свойства однодоменных антител, как высокая устойчивость, высокая устойчивость при экстремальных рН, высокая теплостойкость и высокая аффинность к мишени.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, также содержащий одно или несколько однодоменных антител, направленных против одного или нескольких сывороточных белков, причем указанный полипептид против TNF-альфа содержит последовательность, соответствующую любой последовательности, представленной SEQ ID NO:30-43 (табл.5).

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, где однодоменное антитело против сывороточного белка соответствует последовательности, представленной любой из SEQ ID NO:26-29 и 85-97, приведенных в табл.5.

Сывороточный белок может представлять собой любой подходящий белок, обнаруживаемый в сыворотке субъекта. В одном аспекте изобретения сывороточный белок представляет собой сывороточный альбумин, сывороточные иммуноглобулины, тироксинсвязывающий белок, трансферрин или фибриноген. В зависимости от назначения, такого как необходимый полупериод существования для эффективного лечения и/или компарментализация антигена-мишени, VHH-партнер может быть направлен на один или несколько из вышеуказанных сывороточных белков.

Другим аспектом изобретения является полипептид против TNF-альфа, описанный в данном описании, содержащий, по меньшей мере, один полипептид, выбранный из группы, состоящей из полипептида против IFN-гамма, полипептида против рецептора TNF-альфа и полипептида против рецептора IFN-гамма.

Воплощением настоящего изобретения является то, что однодоменное антитело, направленное против IFN-гамма, соответствует последовательности, представленной любой из SEQ ID NO:44-72, приведенных в табл.6.

Согласно аспекту изобретения однодоменное антитело направлено против рецептора TNF-альфа. Указанное однодоменное антитело может представлять собой VHH Camelidae.

Согласно аспекту изобретения однодоменное антитело направлено против рецептора IFN-гамма. Указанное однодоменное антитело может представлять собой VHH Camelidae.

Другим аспектом изобретения является способ лечения аутоиммунного заболевания или состояния из числа перечисленных в данном описании, включающий введение пациенту эффективного количества полипептида против TNF-альфа, дополнительно содержащего, по меньшей мере, один полипептид, выбранный из группы, состоящей из полипептида против IFN-гамма, полипептида против рецептора TNF-альфа и полипептида против рецептора IFN-гамма, причем такие полипептиды связаны друг с другом так, как описано ниже.

Такие мультиспецифические конструкции по сравнению с моноспецифическими конструкциями могут иметь улучшенную эффективность как противовоспалительное лечебное соединение.

Одним из аспектов изобретения является композиция, содержащая полипептид против TNF-альфа, раскрываемый в данном описании, и, по меньшей мере, один полипептид, выбранный из группы, состоящей из полипептида против IFN-гамма, полипептида против рецептора TNF-альфа и полипептида против рецептора IFN-гамма, для одновременного, раздельного или последовательного введения субъекту.

Одним из аспектов изобретения является способ лечения аутоиммунной болезни, включающий введение индивидууму эффективного количества полипептида против TNF-альфа и, по меньшей мере, одного полипептида, выбранного из группы, состоящей из полипептида против IFN-гамма, полипептида против рецептора TNF-альфа и полипептида против рецептора IFN-гамма, одновременно, раздельно или последовательно.

Другим аспектом изобретения является набор, содержащий полипептид против TNF-альфа и, по меньшей мере, один полипептид, выбранный из группы, состоящей из полипептида против IFN-гамма, полипептида против рецептора TNF-альфа и полипептида против рецептора IFN-гамма, для одновременного, раздельного или последовательного введения субъекту. Аспектом изобретения является то, что указанный набор можно использовать согласно изобретению. Аспектом изобретения является то, что указанный набор можно использовать для лечения болезней, перечисленных в данном описании.

Одновременное введение означает, что полипептиды вводят субъекту в одно и то же время, например, в виде смеси полипептидов или композиции, содержащей указанные полипептиды. Примерами являются, но не ограничиваются перечисленным, раствор, вводимый внутривенно, таблетка, жидкость, крем для местного применения и т.п., где каждый препарат содержит полипептиды, представляющие интерес.

Раздельное введение означает, что полипептиды вводят субъекту в одно и то же время или, по существу, в одно и то же время. Полипептиды присутствуют в наборе в виде отдельных несмешанных препаратов. Например, различные полипептиды могут присутствовать в наборе в виде отдельных таблеток. Субъект может принимать таблетки, проглатывая обе таблетки одновременно или одну таблетку непосредственно за другой.

Последовательное введение означает, что полипептиды вводят субъекту последовательно. Полипептиды присутствуют в наборе в виде отдельных несмешанных препаратов. Существует временной интервал между дозами. Например, один полипептид можно принять через 336, 312, 288, 264, 240, 216, 192, 168, 144, 120, 96, 72, 48, 24, 20, 16, 12, 8, 4, 2, 1 или 0,5 часов после другого полипептида.

При последовательном введении один полипептид можно вводить один или несколько раз и в разных дозах перед и/или после введения другого полипептида. Последовательное введение можно сочетать с одновременным или раздельным введением.

Применения в медицине полипептида против TNF-альфа, описанные ниже, также распространяются на композицию, содержащую полипептид против TNF-альфа, описанный в данном описании, и, по меньшей мере, один полипептид, выбранный из группы, состоящей из полипептида против IFN-гамма, полипептида против рецептора TNF-альфа и полипептида против рецептора IFN-гамма, для одновременного, раздельного или последовательного введения субъекту, как описано выше.

Согласно одному аспекту изобретения полипептид против IFN-гамма представляет собой однодоменное антитело против TNF-альфа, направленное против IFN-гамма. Указанное однодоменное антитело может представлять собой VHH Camelidae.

Воплощением настоящего изобретения является то, что однодоменное антитело, направленное против IFN-гамма, соответствует любой из SEQ ID NO:44-72, приведенных в табл.6.

Согласно одному аспекту изобретения полипептид против TNF-альфа представляет собой однодоменное антитело, направленное против рецептора TNF-альфа. Указанное однодоменное антитело может представлять собой VHH Camelidae.

Согласно одному аспекту изобретения полипептид против рецептора IFN-гамма представляет собой однодоменное антитело против TNF-альфа, направленное против рецептора IFN-гамма. Указанное однодоменное антитело может представлять собой VHH Camelidae.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный в данном описании, где число однодоменных антител, направленных против TNF-альфа, равно двум или большему числу. Такие поливалентные полипептиды против TNF-альфа имеют преимущество необычно высокой функциональной аффинности к мишени, демонстрируя значительно более высокие, чем ожидалось, ингибирующие свойства по сравнению с их моновалентными аналогами.

Поливалентные полипептиды против TNF-альфа имеют функциональную аффинность, которая на несколько порядков величины выше, чем у моновалентных аналогов. Обнаружено, что функциональная аффинность таких поливалентных полипептидов значительно выше, чем аффинность, известная из уровня техники для бивалентных и поливалентных антител. Неожиданно, полипептиды против TNF-альфа настоящего изобретения, непосредственно связанные друг с другом (SEQ ID NO:77 и 78) или через короткую линкерную последовательность, показывают высокую функциональную аффинность, теоретически ожидаемую для поливалентных обычных четырехцепочечных антител.

Обнаружено, что такую сильно возросшую функциональную активность можно выявить, предпочтительно, с помощью антигенов, состоящих из мультидоменных и мультимерных белков, или в прямых анализах связывания или в функциональных анализах, например, анализах на цитотоксичность.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, описанный в данном описании, где число однодоменных антител, направленных против TNF-альфа, равно двум или большему числу, причем указанный полипептид против TNF-альфа содержит последовательность, соответствующую любой из представленных SEQ ID NO 73-76.

Однодоменные антитела можно соединять с образованием любого из полипептидов, описанных в данном описании, содержащего несколько однодоменных антител, с использованием способов, известных в уровне технике, или любого будущего способа. Например, их можно объединить химическим сшиванием по реакционноспособным аминокислотным остаткам с помощью органического дериватизирующего агента, такого, какой описан в Blattler et al., Biochemistry, 24, 1517-1524; EP 294703. С другой стороны, однодоменные антитела можно объединить генетически на уровне ДНК, т.е., с образованием полинуклеотидной конструкции, кодирующей полную полипептидную конструкцию, содержащую одно или несколько однодоменных антител и одно или несколько однодоменных антител против сывороточного белка. Способ получения бивалентных или поливалентных полипептидных конструкций VHH описывается в заявке РСТ WO 96/34103. Одним из путей соединения нескольких однодоменных антител является генетический путь за счет соединения последовательностей, кодирующих однодоменные антитела, или непосредственно или через пептидный линкер. Например, С-конец первого однодоменного антитела можно соединить с N-концом следующего однодоменного антитела. Способ соединения можно продолжить для того, чтобы присоединить дополнительные однодоменные антитела для конструирования и получения три-, тетра- и т.д. функциональных конструкций.

Согласно одному аспекту настоящего изобретения однодоменные антитела соединяются друг с другом непосредственно без использования линкера. В отличие от соединения обычных громоздких антител, где для сохранения связывающей активности в двух субъединицах требуется линкерная последовательность, полипептиды изобретения могут быть соединены непосредственно (SEQ ID No.77 и 78), благодаря чему удается избежать возможных проблем линкерной последовательности, таких как антигенность при введении субъекту-человеку и нестабильность линкерной последовательности, ведущая к диссоциации субъединиц.

Согласно другому аспекту настоящего изобретения однодоменные антитела соединяются друг с другом через пептидную линкерную последовательность. Такая линкерная последовательность может являться последовательностью, встречающейся в природе, или последовательностью, которая в природе не встречается. Ожидается, что линкерная последовательность будет неиммуногенной для субъекта, которому вводят полипептид против TNF-альфа. Линкерная последовательность может обеспечить достаточную гибкость поливалентного полипептида против TNF-альфа, который в то же время остается устойчивым к протеолитическому разложению. Примером линкерных последовательностей, не являющимся ограничительным, является последовательность, которую можно получить из шарнирной области VHH, описанная в WO 96/34103.

Согласно другому аспекту изобретения поливалентные однодоменные антитела, содержащие более двух однодоменных антител, можно соединить друг с другом непосредственно или через линкерную последовательность. Такие конструкции трудно получать с обычными антителами, и из-за стерических препятствий объемных субъединиц функциональность будет теряться или существенно снижаться, а не существенно возрастать, как видно в случае VHH по изобретению при сравнении с моновалентной конструкцией (см. фигуру 12 для анализа методом гель-фильтрации таких поливалентных конструкций VHH).

Полипептидные конструкции, описанные в данном описании, могут быть получены специалистом в данной области техники согласно способам, известным в технике, или любым будущим способом. Например, VHH можно получить с использованием способов, известных в технике, таких как иммунизация верблюда и получение от него гибридом, или клонированием библиотеки однодоменных антител с использованием методов молекулярной биологии, известных в технике, и последующим отбором с использованием фагового дисплея.

Согласно одному аспекту изобретения, полипептид против TNF-альфа может представлять собой последовательность, гомологичную полноразмерному полипептиду против TNF-альфа. Согласно другому аспекту изобретения полипептид против TNF-альфа может представлять собой функциональную часть полноразмерного полипептида против TNF-альфа. Согласно другому аспекту изобретения полипептид против TNF-альфа может представлять собой последовательность, гомологичную полноразмерному полипептиду против TNF-альфа. Согласно другому аспекту изобретения полипептид против TNF-альфа может представлять собой функциональную часть последовательности, гомологичной полноразмерному полипептиду против TNF-альфа. Согласно аспекту изобретения полипептид против TNF-альфа может содержать последовательность полипептида против TNF-альфа.

Согласно аспекту изобретения однодоменное антитело, используемое для образования полипептида против TNF-альфа, может представлять собой полное однодоменное антитело (например, VHH) или гомологичную ему последовательность. Согласно другому аспекту изобретения однодоменное антитело, используемое для образования полипептидной конструкции, может представлять собой функциональную часть полного однодоменного антитела. Согласно другому аспекту изобретения однодоменное антитело, используемое для образования полипептидной конструкции, может представлять собой гомологичную последовательность полного однодоменного антитела. Согласно другому аспекту изобретения однодоменное антитело, используемое для образования полипептидной конструкции, может представлять собой функциональную часть последовательности, гомологичной полному однодоменному антителу.

В данном описании используемая гомологичная последовательность настоящего изобретения может содержать дополнения, делеции или замены одной или нескольких аминокислот, которые, по существу, не изменяют функциональных характеристик полипептидов изобретения. Число делеции или замен аминокислот составляет, предпочтительно, величину до 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69 или 70 аминокислот.

Гомологичная последовательность по настоящему изобретению может представлять собой полипептид, модифицированный путем добавления, делеции или замены аминокислот, причем указанная модификация существенно не изменяет функциональные характеристики по сравнению с немодифицированным полипептидом.

Гомологичная последовательность по настоящему изобретению может представлять собой последовательность, которая существует в других видах Camelidae, таких как, например, верблюд, дромедар, лама, альпака, гуанако и т.д.

Когда в отношении гомологичной последовательности указана идентичность последовательностей, это обозначает последовательность, которая показывает высокую идентичность последовательностей (идентичность последовательностей свыше 70%, 75%, 80%, 90%, 95% или 98%) с исходной последовательностью и, предпочтительно, характеризуется свойствами, подобными свойствам исходной последовательности, а именно, аффинностью, причем указанную идентичность вычисляют с использованием известных способов.

С другой стороны, гомологичная последовательность также может представлять собой любую аминокислотную последовательность, полученную в результате допустимых замен в любом числе позиций исходной последовательности согласно формуле, приведенной ниже:

Ser заменяется Ser, Thr, Gly или Asn;

Arg заменяется одним из Arg, His, Gln, Lys и Glu;

Leu заменяется одним из Leu, He, Phe, Tyr, Met и Val;

Pro заменяется одним из Pro, Gly, Ala и Thr;

Thr заменяется одним из Thr, Pro, Ser, Ala, Gly, His и Gln;

Ala заменяется одним из Ala, Gly, Thr и Pro;

Val заменяется одним из Val, Met, Tyr, Phe, He и Leu;

Gly заменяется одним из Gly, Ala, Thr, Pro и Ser;

Ile заменяется одним из Ile, Met, Tyr, Phe, Val и Leu;

Phe заменяется одним из Phe, Trp, Met, Tyr, Ile, Val и Leu;

Tyr заменяется одним из Tyr, Trp, Met, Phe, Ile, Val и Leu;

His заменяется одним из His, Glu, Lys, Gln, Thr и Arg;

Gln заменяется одним из Gln, Glu, Lys, Asn, His, Thr и Arg;

Asn заменяется одним из Asn, Glu, Asp, Gln и Ser;

Lys заменяется одним из Lys, Glu, Gin, His и Arg;

Asp заменяется одним из Asp, Glu и Asn;

Glu заменяется одним из Glu, Asp, Lys, Asn, Gln, His и Arg;

Met заменяется одним из Met, Phe, He, Val, Leu и Tyr.

Гомологичная нуклеотидная последовательность по настоящему изобретению может относиться к нуклеотидной последовательности с числом нуклеотидов более 50, 100, 200, 300, 400, 500, 600, 800 или 1000, способной гибридизоваться с обратным комплементом нуклеотидной последовательности, способной кодировать исходную последовательность, в строгих условиях гибридизации (таких как условия, описанные в Sambrook et al., Molecular Cloning, Laboratory Manuel, Cold Spring, Harbor Laboratory press, New York).

Используемый в данном описании термин "функциональная часть" относится к последовательности однодоменного антитела, которая имеет достаточный размер, так что взаимодействие, представляющее интерес, сохраняется с аффинностью 1×10-6 М или лучшей.

С другой стороны, функциональная часть содержит частичную делецию полной аминокислотной последовательности и еще сохраняет сайт(ы) связывания и домен(ы) белка, необходимые для связывания и взаимодействия с мишенью.

В данном описании к функциональной части относится менее 100% полной последовательности (например, 90%, 80%, 70%, 60%, 50%, 40%, 30, 20%, 10%, 5%, 1% и т.д.), но она содержит 5 или большее число аминокислот или 15 или большее число нуклеотидов.

Мишени, упоминаемые в данном описании, такие как TNF-альфа, рецептор TNF-альфа, сывороточные белки (например, сывороточный альбумин, сывороточные иммуноглобулины, тироксинсвязывающий белок, трансферрин, фибриноген) и IFN-гамма и рецептор IFN-гамма, могут представлять собой фрагменты указанных мишеней. Таким образом, мишенью также является фрагмент указанной мишени, способный вызывать иммунную реакцию. Мишенью также является фрагмент указанной мишени, способный связываться с однодоменным антителом, выработанным против полноразмерной мишени.

Термином "фрагмент", используемым в данном описании, называется менее 100% последовательности (например, 99%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10% и т.д.), но он состоит из 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 или большего числа аминокислот. Фрагмент имеет достаточную длину, такую, что взаимодействие, представляющее интерес, сохраняется с аффинностью 1×10-6 М или лучшей.

Термин "фрагмент", используемый в данном описании, также относится к необязательным вставкам, делециям и заменам одной или нескольких аминокислот, которые существенно не изменяют способность мишени связываться с однодоменным антителом, выработанным против мишени дикого типа. Число вставок, делеций или замен аминокислот составляет, предпочтительно, величину до 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69 или 70 аминокислот.

Гомологичная последовательность настоящего изобретения может включать полипептид против TNF-альфа, который является гуманизированным. Гуманизация антител нового класса VHH может дополнительно уменьшить возможность нежелательной иммунной реакции у индивидуума-человека после введения.

Воплощение настоящего изобретения относится к способу получения модифицированных полипептидов, основанных на антителах ламы, путем определения аминокислотных остатков вариабельной области антитела (VHH), которые можно модифицировать, не уменьшая нативной аффинности области в отношении антигена, в то же время уменьшая ее иммуногенность в отношении гетерологичных видов; применению VHH, имеющему модификации по идентифицированным остаткам, полезными для введения гетерологичным видам; и к VHH, модифицированному таким образом.

Конкретнее, изобретение относится к получению модифицированных VHH, которые модифицируют для введения людям, самим получающимся VHH, и к применению таких "гуманизированных" VHH при лечении болезней у людей. Гуманизированной называют такую мутацию, в результате которой иммуногенность после введения пациентам-людям является очень низкой или отсутствует. Гуманизация полипептида, согласно настоящему изобретению, включает стадию замены одной или нескольких аминокислот Camelidae на их человеческие аналоги, обнаруженные в консенсусной последовательности человека, без утраты полипептидом его свойства, т.е., гуманизация, по существу, не влияет на антигенсвязывающую способность полученного полипептида. Такие способы известны специалистам в данной области техники.

Гуманизация однодоменных антител Camelidae требует введения и мутагенеза ограниченного количества аминокислот в одной цепи полипептида. В этом состоит отличие от гуманизации scFv, Fab, (Fab)2 и IgG, которая требует введения аминокислотных замен в двух цепях - легкой и тяжелой цепи - и сохранения апсимбля обеих цепей.

Для примера, но не для ограничения, гуманизируют полипептид VHH#12B, содержащий в FR2 остатки, похожие на остатки в человеческом FR2. Гуманизация требует мутагенеза остатков в FR1 в позиции 1 и 5, которые вводят с помощью праймера, используемого для репертуарного клонирования, и в природе в последовательности ламы не встречаются. Мутагенез таких остатков не приводит к потере связывающей и/или ингибирующей активности. Гуманизация также требует мутагенеза остатков в FR3 в позиции 74, 76, 83, 84, 93. Мутагенез таких остатков не приводит к существенной потере связывающей и/или ингибирующей активности (см. фигуру 4). Поэтому комбинирование мутаций FR1 и FR3 не влияет на связывающую и/или ингибирующую активность (фигура 5). Гуманизация также требует мутагенеза остатков в FR4 в позиции 108. Мутагенез Q108L приводит к меньшему уровню продуцирования в Escherichia coli. Позиция 108 открыта для растворителя в VHH Camelidae, в то время как в человеческих антителах эта позиция глубоко утоплена в зоне контакта VH-VL (Spinelli, 1996; Nieba, 1997). В изолированных VH позиция 108 открыта для растворителя. Введение неполярного гидрофобного Leu вместо полярного незаряженного Gln может оказать сильное влияние на естественную укладку/стабильность молекулы.

В качестве примера, не являющегося ограничительным, гуманизировали полипептид, представленный в VHH#3E, содержащий маркерные остатки Camelidae в позициях 37, 44, 45 и 47 с гидрофильными свойствами. Замена гидрофильных остатков на характерные для человека гидрофобные остатки в позициях 44 и 45 (E44G и R45L) не оказывает действия на связывание и/или ингибирование. Однако утрату связывающей и/или ингибирующей активности наблюдают, когда вводят F37V и F47W. Данные по моделированию подтвердили критичность остатка 37 для сохранения целостности конформации петли CDR3 и, следовательно, активности (см. фигуру 6) (вся нумерация по Kabat).

SEQ ID NO:3 и 14 показывают гомологию аминокислот с каркасными участками VH человека, превышающую 90%, и поэтому указанные VHH можно вводить пациентам непосредственно без опасения иммунной реакции на них и без дополнительного обременения гуманизацией. Поэтому один аспект настоящего изобретения относится к непосредственному введению пациенту, нуждающемуся в этом, полипептида, содержащего SEQ ID NO:3 и 14, гомологичной ему последовательности или функциональной части гомологичной ему последовательности.

Воплощением настоящего изобретения является способ гуманизации VHH, включающий стадии замены любого из указанных далее остатков - или одного из них, или сочетания:

FR1, позиция 1,5, 28 и 30,

маркерная аминокислота в позиции 44 и 45 в FR2,

остатки FR3 74, 75, 76, 83, 84, 93 и 94,

и позиции 103, 104, 108 и 111 в FR4;

нумерация по Kabat.

Воплощением настоящего изобретения является полипептид против TNF-альфа или нуклеиновая кислота, способная кодировать указанный полипептид, для применения при лечении, предупреждении и/или облегчении симптомов расстройств, относящихся к воспалительным процессам. TNF-альфа вовлекается в воспалительные процессы, и блокирование действия TNF-альфа может иметь противовоспалительное действие, которое весьма желательно при некоторых болезненных состояниях, таких как, например, болезнь Крона. Примеры в данном описании демонстрируют VHH по изобретению, которые связывают TNF-альфа и, кроме того, блокируют его связывание с рецептором TNF-альфа.

Полипептиды против TNF-альфа настоящего изобретения применимы при аутоиммунных болезнях, таких как болезнь Аддисона (надпочечник), аутоиммунные болезни уха (ухо), аутоиммунные болезни глаз (глаз), аутоиммунный гепатит (печень), аутоиммунный паротит (околоушные железы), болезнь Крона (кишечник), диабет типа I (поджелудочная железа), эпидидимит (эпидидимис), гломерулонефрит (почки), болезнь Грейвса (щитовидная железа), синдром Гийена-Барре (нервные клетки), болезнь Хасимото (щитовидная железа), гемолитическая анемия (красные кровяные клетки), системная красная волчанка (многие ткани), мужское бесплодие (сперма), рассеянный склероз (нервные клетки), астенический бульбарный паралич (нервно-мышечное соединение), пузырчатка (в основном, кожа), псориаз (кожа), ревматическая лихорадка (сердце и суставы), ревматоидный артрит (выстилка суставов), саркоидоз (многие ткани и органы), склеродерма (кожа и соединительные ткани), синдром Шегрена (экзокринные железы и другие ткани), спондилоартропатии (осевой скелет и другие ткани), тиреоидит (щитовидная железа), васкулит (кровеносные сосуды). В круглых скобках указана ткань, поражаемая болезнью. Данный перечень аутоиммунных болезней предназначен для примера, а не для ограничения.

Аутоиммунные состояния, при которых применимы полипептиды против TNF-альфа настоящего изобретения, включают, например, СПИД, атоническую аллергию, бронхиальную астму, экзему, проказу, шизофрению, наследственную депрессию, трансплантацию тканей и органов, синдром хронической усталости, болезнь Альцгеймера, болезнь Паркинсона, инфаркт миокарда, инсульт, аутизм, эпилепсию, феномен Артуса, анафилаксию и алкогольную и лекарственную аддикцию. При указанных выше аутоиммунных состояниях пораженная ткань является первичной мишенью, в других случаях она является вторичной мишенью. Такие состояния являются, частично или большей частью, аутоиммунными синдромами. Следовательно, при их лечении возможно применение таких же способов или аспектов таких же способов, какие раскрываются в данном описании, иногда в сочетании с другими способами.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа по настоящему изобретению или нуклеиновой кислоты, способной кодировать указанный полипептид, для получения лекарственного средства для лечения расстройства, относящегося к воспалительным процессам. Примерами расстройств являются ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз.

Полипептиды и нуклеиновые кислоты по настоящему изобретению можно вводить субъекту обычными путями, например, внутривенно. Однако особым свойством полипептидов против TNF-альфа по изобретению является то, что они проникают сквозь барьеры, такие как тканевые мембраны, и/или в опухоли и действуют там локально, и они достаточно стабильны для того, чтобы противостоять экстремальным окружающим условиям, как, например, в желудке. Поэтому другой аспект настоящего изобретения относится к доставке полипептидов против TNF-альфа.

Субъектом по изобретению может быть любое млекопитающее, восприимчивое к лечению лечебными полипептидами.

Пероральная доставка полипептидов против TNF-альфа приводит к снабжению такими молекулами в активной форме ободочной кишки в отдельных участках, пораженных расстройством. Такие участки могут быть сильно воспалены и содержат клетки, продуцирующие TNF-альфа. Полипептиды против TNF-альфа по изобретению, связывающиеся с TNF-альфа, могут нейтрализовать местно TNF-альфа, избегая распространения по всему организму, и таким образом ограничивается негативное побочное действие. Генетически модифицированные микроорганизмы, такие как Micrococcus lactis, способны секретировать антитела или их функциональные части. Такие модифицированные микроорганизмы можно использовать в качестве носителей для локального продуцирования и доставки антител или их функциональных частей в кишечник. Используя штамм, продуцирующий полипептид против TNF-альфа, можно лечить синдром воспаленной толстой кишки.

Другой аспект изобретения включает доставку полипептидов против TNF-альфа с использованием поверхностной экспрессии или секреции из неинвазивных бактерий, таких как грамположительные организмы, подобные Lactococcus spec., с использованием вектора, описанного в WO 00/23471.

Воплощением настоящего изобретения является полипептид против TNF-альфа, раскрываемый в данном описании, для применения при лечении, предупреждении и/или облегчении симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое может проходить через среду желудка без инактивации.

Примерами расстройств являются любые расстройства, вызывающие воспаление, в том числе ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз, и другие расстройства. Как известно специалистам в данной области техники, имея указанную полипептидную конструкцию, можно применить технологию составления композиций, высвобождающих максимальное количество полипептида в нужном месте (в желудке, в ободочной кишке и т.д.). Такой способ доставки важен для лечения, предупреждения и/или облегчения симптомов расстройств, мишени которых локализуются в кишечной системе.

Аспектом изобретения является способ лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое может проходить через среду желудка без инактивации, путем перорального введения субъекту полипептидов против TNF-альфа, раскрываемых в данном описании.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, раскрываемого в данном описании, для получения лекарственного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое может проходить через среду желудка без инактивации.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кишечную систему без инактивации указанного вещества путем перорального введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кровоток субъекта без инактивации вещества путем перорального введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, раскрываемый в данном описании, для применения при лечении, предупреждении и/или облегчении симптомов или расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым во влагалище и/или прямую кишку.

Примерами расстройств являются любые расстройства, вызывающие воспаление, в том числе ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз, и другие расстройства. В примере, не являющемся ограничительным, композиция по изобретению, содержащая полипептид против TNF-альфа, раскрываемый в данной заявке, находится в форме геля, крема, суппозитория, пленки или в форме тампона или вагинального кольца, которое постепенно высвобождает активный ингредиент со временем (такие композиции описаны в ЕР 707473, ЕР 684814, US 5629001).

Аспектом изобретения является способ лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым во влагалище и/или прямую кишку путем вагинального и/или ректального введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, раскрываемого в данном описании, для получения лекарственного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемого во влагалище и/или в прямую кишку.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, во влагалище и/или прямую кишку без инактивации указанного вещества путем введения во влагалище и/или прямую кишку субъекта полипептида против TNF-альфа, раскрываемого в данном описании.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кровоток субъекта без инактивации вещества путем введения во влагалище и/или прямую кишку субъекта полипептида против TNF-альфа, раскрываемого в данном описании.

Другим воплощением настоящего изобретения является полипептид против TNF-альфа, раскрываемый в данном описании, для применения при лечении, предупреждении и/или облегчении симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в нос, верхние дыхательные пути и/или легкие.

Примерами расстройств являются любые расстройства, вызывающие воспаление, в том числе ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз, и другие расстройства. В примере, не являющемся ограничительным, композиция по изобретению, содержащая полипептид против TNF-альфа, раскрываемый в данной заявке, находится в форме назального спрея (например, аэрозоля) или ингалятора. Так как полипептидная конструкция небольшая, она может достичь своей мишени более эффективно, чем молекулы лечебного IgG.

Аспектом изобретения является способ лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в верхние дыхательные пути и легкие путем введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании, посредством ингаляции через рот или нос.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, раскрываемого в данном описании, для получения лекарственного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в нос, верхние дыхательные пути и/или легкие без инактивации указанного полипептида.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в нос, верхние дыхательные пути и/или легкие без инактивации путем введения в нос, верхние дыхательные пути и/или легкие субъекта полипептида против TNF-альфа, раскрываемого в данном описании.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кровоток субъекта без инактивации путем введения в нос, верхние дыхательные пути и/или легкие субъекта полипептида против TNF-альфа, раскрываемого в данном описании.

Воплощением настоящего изобретения является полипептид против TNF-альфа, раскрываемый в данном описании, для применения при лечении, предупреждении и/или облегчении симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в слизистую оболочку кишечника, где указанное расстройство увеличивает проницаемость слизистой оболочки кишечника. В силу своего небольшого размера полипептид против TNF-альфа, раскрываемый в данном описании, может проходить через слизистую оболочку кишечника и более эффективно достигать кровотока субъекта, страдающего от расстройств, вызывающих увеличение проницаемости слизистой оболочки кишечника, например, болезни Крона.

Аспектом изобретения является способ лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в слизистую оболочку кишечника, где указанное расстройство увеличивает проницаемость слизистой оболочки кишечника, путем перорального введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Данный процесс даже можно усилить за счет другого аспекта настоящего изобретения - применения активных носителей-переносчиков. В данном аспекте изобретения VHH объединяют с носителем, что усиливает перенос через кишечную стенку в кровоток. В примере, не являющемся ограничительным, таким "носителем" является вторая VHH, которую объединяют с лечебной VHH. Такие слитые конструкции получают с использованием способов, известных в технике. VHH-"носитель" специфически связывается с рецептором на кишечной стенке, что вызывает активный перенос через стенку.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, раскрываемого в данном описании, для получения лекарственного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, доставляемым в слизистую оболочку кишечника, где указанное расстройство увеличивает проницаемость слизистой оболочки кишечника.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в слизистую оболочку кишечника без инактивации путем перорального введения субъекту полипептида против TNF-альфа по изобретению.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кровоток субъекта без инактивации путем перорального введения субъекту полипептида против TNF-альфа по изобретению.

Данный процесс даже можно усилить за счет другого аспекта настоящего изобретения - применения активных носителей-переносчиков. В данном аспекте изобретения полипептид против TNF-альфа, раскрываемый в данном описании, объединяют с носителем, что усиливает перенос через кишечную стенку в кровоток. В примере, не являющемся ограничительным, таким "носителем" является VHH, которое объединяют с указанным полипептидом. Такие слитые конструкции получают с использованием способов, известных в технике. VHH-"носитель" специфически связывается с рецептором на кишечной стенке, что вызывает активный перенос через стенку.

Воплощением настоящего изобретения является полипептид против TNF-альфа, раскрываемый в данном описании, для применения при лечении, предупреждении и/или облегчении симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое способно эффективно проходить через ткани под языком.

Примерами расстройств являются любые расстройства, вызывающие воспаление, в том числе, ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз, и другие расстройства. Композиция, содержащая указанную полипептидную конструкцию, раскрываемую в данном описании, например, таблетка, спрей, капля, помещается под язык и адсорбируется через мембраны слизистой оболочки капиллярной сетью под языком.

Аспектом изобретения является способ лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое способно эффективно проходить через ткани под языком, путем сублингвального введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, раскрываемого в данном описании, для получения лекарственного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое способно проходить через ткани под языком.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в ткани под языком без инактивации путем сублингвального введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кровоток субъекта без инактивации путем перорального введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Воплощением настоящего изобретения является полипептид против TNF-альфа, раскрываемый в данном описании, для применения при лечении, предупреждении и/или облегчении симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое способно эффективно проходить через кожу.

Примерами расстройств являются любые расстройства, вызывающие воспаление, в том числе, ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз, и другие расстройства. Композиция, содержащая указанную полипептидную конструкцию, например, крем, пленка, спрей, капля, пэтч, помещается на кожу и проходит через нее.

Аспектом изобретения является способ лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое способно эффективно проходить через кожу, путем местного введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Другим воплощением настоящего изобретения является применение полипептида против TNF-альфа, раскрываемого в данном описании, для получения лекарственного средства для лечения, предупреждения и/или облегчения симптомов расстройств, чувствительных к модуляции веществом, модулирующим TNF-альфа, которое способно проходить через кожу.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кожу без инактивации путем местного введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

Аспектом изобретения является способ доставки вещества, модулирующего TNF-альфа, в кровоток субъекта путем местного введения субъекту полипептида против TNF-альфа, раскрываемого в данном описании.

В другом воплощении настоящего изобретения полипептид против TNF-альфа также содержит носитель - однодоменное антитело (например, VHH), которое действует как активный переносчик указанного полипептида против TNF-альфа из просвета легкого в кровь.

Полипептид против TNF-альфа, дополнительно содержащий носитель, специфически связывается с рецептором, присутствующим на поверхности слизистой оболочки (бронхиальные эпителиальные клетки), что приводит к активному переносу полипептида из просвета легкого в кровь. Носитель - однодоменное антитело может быть слит с полипептидной конструкцией. Такие слитые конструкции можно получить с использованием способов, известных в технике и описанных в данном описании. "Носитель" - однодоменное антитело специфически связывается с рецептором на поверхности слизистой оболочки, что вызывает активный перенос через поверхность.

Другим аспектом настоящего изобретения является способ определения того, какие однодоменные антитела (например, VHH) активно переносятся в кровоток после назального введения. Подобным образом можно ввести назально фаговую библиотеку наивных или иммунных VHH, и через разное время после введения можно выделить кровь или органы для спасения фагов, которые были активно перенесены в кровоток. Не являющимся ограничительным примером рецептора для активного переноса из просвета легкого в кровоток является Fc-рецептор N (FcRn). Один аспект изобретения включает молекулы VHH, идентифицированные таким способом. Затем такую VHH можно использовать как носитель VHH для доставки лечебной VHH к соответствующей мишени в кровотоке после назального введения.

В одном аспекте изобретения полипептид против TNF-альфа, раскрываемый в данном описании, можно использовать для скрининга в отношении средств, модулирующих связывание полипептида с TNF-альфа. После идентификации в способе анализа, в котором измеряют связывание или замещение самого по себе указанного полипептида, средства должны подвергнуться функциональной проверке для определения того, могут ли они модулировать действие антигена in vivo. Примеры скрининг-анализов приводятся ниже, главным образом, в отношении SEQ ID NO:3, хотя может подойти любой полипептид против TNF-альфа, раскрываемый в данном описании.

В примере эксперимента по замещению фаги или клетки, экспрессирующие TNF-альфа или его фрагмент, инкубируют в буфере для связывания, например, с полипептидом, представленным SEQ ID NO:3, который помечен, в присутствии или в отсутствие возрастающих концентраций кандидата в модуляторы. Для подтверждения и калибровки способа анализа можно осуществить контрольные конкурентные реакции с использованием возрастающих концентраций указанного полипептида, который является немеченым. После инкубации клетки обильно промывают, и связанный меченый полипептид определяют способом, соответствующим данной метке (например, подсчетом сцинтилляций, по флуоресценции и т.д.). Снижение, по меньшей мере, на 10% количества меченого полипептида, связанного в присутствии кандидата в модуляторы, указывает на замещение связывания кандидатом в модуляторы. Считается, что кандидаты в модуляторы специфически связываются в данном и других способах анализа, описанных в данном описании, если они замещают 50% меченого полипептида (субнасыщающая доза полипептида) в концентрации 1 мкМ или менее.

С другой стороны, связывание или замещение связывания можно контролировать методом поверхностного плазменного резонанса (SPR). Анализы методом поверхностного плазмонного резонанса можно использовать как количественный способ оценки связывания между двумя молекулами за счет изменения массы вблизи иммобилизованного сенсора, вызванного связыванием или потерей связывания, например, полипептида, представленного SEQ ID NO:3, из водной фазы с TNF-альфа, иммобилизованным на мембране на сенсоре. Такое изменение массы измеряют как единицы резонанса в зависимости от времени после введения или удаления указанного полипептида или кандидата в модуляторы, и измерение проводят с использованием Biacore Biosensor (Biacore AB). TNF-альфа можно иммобилизовать, например, на сенсорном чипе (например, чипе для исследовательских целей СМ5; Biacore AB), в тонкой пленке липидной мембраны согласно способам, описанным в работах Salamon et al. (Salamon et al., 1996, Biophys. J., 71:283-294; Salamon et al., 2001, Biophys. J., 80:1557-1567; Salamon et al., 1999, Trends Biochem. Sci., 24:213-219, все включены в данное описание путем отсылки). Sarrio et al. показали, что SPR можно использовать для детекции связывания лиганда с аденозиновым рецептором GPCR А (1), иммобилизованным в липидном слое на чипе (работа Sarrio et al., 2000, Mol. Cell. Biol., 20:5164-5174, включена в данное описание путем отсылки). Условия связывания SEQ Ю NO:3 с TNF-альфа в анализе SPR могут быть точно отрегулированы специалистом в данной области техники с использованием в качестве отправной точки условий, описанных Sarrio et al..

Анализ методом SPR модуляторов связывания можно проводить двумя способами. Во-первых, полипептид, представленный SEQ ID NO:3, например, можно предварительно связать с иммобилизованным TNF-альфа с последующим инъецированием кандидата в модуляторы в концентрации в диапазоне от 0,1 нМ до 1 мкМ. Замещение связанного полипептида можно определить количественно, причем создается возможность детекции связывания модулятора. С другой стороны, мембраносвязанный TNF-альфа можно предварительно инкубировать с кандидатом в модуляторы и внести, например, полипептид, представленный SEQ ID NO:3. Различие в аффинности связывания между указанным полипептидом и TNF-альфа, предварительно инкубированным с модулятором, при сравнении с аффинностью связывания между указанным полипептидом и TNF-альфа в отсутствие модулятора будет демонстрировать связывание или замещение указанного полипептида в присутствии модулятора. При любом анализе уменьшение на 10% или более количества указанного полипептида, связанного в присутствии кандидата в модуляторы, относительно количества указанного полипептида, связанного в отсутствие кандидата в модуляторы, показывает, что кандидат в модуляторы ингибирует взаимодействие TNF-альфа и указанного полипептида.

В другом способе обнаружения ингибирования связывания, например, полипептида, представленного SEQ ID NO:3, с TNF-альфа используют резонансный перенос энергии флуоресценции (FRET). FRET представляет собой квантово-механическое явление, которое происходит между донором флуоресценции (D) и акцептором флуоресценции (А), находящихся в непосредственной близости друг к другу (как правило, разделение <100 Å), если спектр испускания D частично совпадает со спектром возбуждения А. Испытываемые молекулы, например, полипептид, представленный SEQ ID NO:3, и TNF-альфа метят комплементарной парой донорного и акцепторного флуорофоров. Хотя существует тесная связь за счет взаимодействия TNF-альфа:полипептид, флуоресценция, испускаемая после возбуждения донорного флуорофора, будет иметь длину волны, отличающуюся от длины волны, испускаемой в ответ на данную длину волны возбуждения, когда указанный полипептид и TNF-альфа не связаны, обеспечивая количественное определение связанных и несвязанных молекул путем измерения интенсивности испускания при каждой длине волны. Флуорофоры для доноров, которыми метят TNF-альфа, хорошо известны в технике. Особый интерес представляют варианты GFP A. victoria GFP, известный как Cyan FP (CFP, донор (D) и Yellow FP (YFP, акцептор (А). Например, вариант YFP можно получить в виде слитого белка с TNF-альфа. Векторы для экспрессии вариантов GFP в виде слитых конструкций (Clontech), а также меченные флуорофорами реагенты (Molecular Probes) хорошо известны в технике. Добавление кандидата в модуляторы к смеси полипептида с флуоресцентной меткой и YFP-TNF-альфа приведет к ингибированию переноса энергии, что доказывается, например, ослаблением флуоресценции YFP относительно образца без кандидата в модуляторы. В анализе с использованием FRET для детекции взаимодействия TNF-альфа:полипептид 10% и большее снижение интенсивности флуоресцентного излучения на длине волны акцептора в образцах, содержащих кандидата в модуляторы, относительно образцов без кандидата в модуляторы показывает, что кандидат в модуляторы ингибирует взаимодействие TNF-альфа:полипептид.

Образец, используемый в данном случае, может представлять собой любой биологический образец, содержащий TNF-альфа, такой как клинический (например, фракции клеток, цельная кровь, плазма, сыворотка, ткань, клетки и т.д.), полученный из клинического, сельскохозяйственного, судебного, исследовательского или другого возможного образца. Клинические образцы могут происходить от человека или животного. Анализируемые образцы могут быть как твердыми, так и жидкими по природе. Очевидно, когда используют твердые материалы, их сначала растворяют в подходящем растворителе.

В варианте FRET используют тушение флуоресценции для контроля за молекулярными взаимодействиями. Одна из молекул во взаимодействующей паре может быть помечена флуорофором, а другая - молекулой, которая тушит флуоресценцию флуорофора, когда приходит в тесный контакт с ним. Изменение во флуоресценции после возбуждения указывает на изменение в ассоциации пары молекула, помеченная флуорофором:тушитель. Как правило, усиление флуоресценции меченого TNF-альфа показывает, что полипептид против TNF-альфа, содержащий тушитель, замещен. Для анализов на основе тушения 10% или большее повышение интенсивности флуоресцентного излучения в образцах, содержащих кандидата в модуляторы, относительно образцов без кандидата в модуляторы показывает, что кандидат в модуляторы ингибирует взаимодействие ТМР-альфа:полипептид против TNF-альфа.

Кроме методов поверхностного плазмонного резонанса и FRET для количественного определения связывания используют измерение поляризации флуоресценции. Величина поляризации флуоресценции для молекулы с флуоресцентной меткой зависит от времени корреляции вращения или скорости вращения. Комплексы, такие как комплексы, образованные связыванием TNF-альфа с флуоресцентно меченным полипептидом против TNF-альфа, имеют более высокие величины поляризации, чем меченый полипептид вне комплекса. Включение кандидата в ингибиторы взаимодействия TNF-альфа:полипептид против TNF-альфа приводит к уменьшению поляризации флуоресценции относительно смеси без кандидата в ингибиторы, если кандидат в ингибиторы разрушает или ингибирует взаимодействие TNF-альфа с указанным полипептидом. Поляризация флуоресценции подойдет для идентификации небольших молекул, нарушающих образование комплексов TNF-альфа:полипептид против TNF-альфа. Уменьшение на 10% или более поляризации флуоресценции в образцах, содержащих кандидата в модуляторы, относительно поляризации флуоресценции в образцах, лишенных кандидата в модуляторы, показывает, что кандидат в модуляторы ингибирует взаимодействие TNF-альфа: полипептид против TNF-альфа.

В другом варианте регистрации взаимодействия TNF-альфа: полипептид против TNF-альфа используют биосенсорный анализ. В технике описаны биосенсоры ICS (Australian Membrane Biotechnology Research Institute; Comell B,, Braach-Maksvytis V., King L., Osman P., Rauguse В., Wiecworek L. and Pace R., "A biosensor that uses ion-channel switches", Nature, 1997, 387, 580). В этой технологии ассоциацию TNF-альфа и полипептида против TNF-альфа сопрягают с закрытием ионных каналов, сформированных грамицидином в бислоях суспендированных мембран, и, таким образом, с измеряемым изменением в полной проводимости (подобно импедансу) биосенсора. Такой подход имеет линейность на протяжении свыше шести порядков величины изменения полной проводимости и идеально подходит для крупномасштабного высокопроизводительного скрининга комбинаторных библиотек малых молекул. Изменение полной проводимости на 10% или более в образце, содержащем кандидата в модуляторы, относительно полной проводимости образца, лишенного кандидата в модуляторы, показывает, что кандидат в модуляторы ингибирует взаимодействие TNF-альфа и указанного полипептида. Важно отметить, что в анализах для проверки взаимодействия TNF-альфа с полипептидом против TNF-альфа возможно, что отсутствует необходимость прямого взаимодействия модулятора взаимодействия с доменом(ами) белков, которые физически взаимодействуют с указанным полипептидом. Также возможно, что модулятор будет взаимодействовать в месте, удаленном от сайта взаимодействия, и будет вызывать, например, конформационное изменение в TNF-альфа. Модуляторы (ингибиторы или агонисты), которые действуют таким образом, все же представляют интерес как средства, модулирующие связывание TNF-альфа с его рецептором.

Любой из описанных способов анализа связывания можно использовать для определения наличия вещества в образце, например, в образце ткани, которое связывается с TNF-альфа или которое действует на связывание, например, полипептида, представленного SEQ ID NO:3, с TNF-альфа. Для того чтобы это осуществить, TNF-альфа вводят во взаимодействие с указанным полипептидом в присутствии или в отсутствие образца и измеряют связывание полипептида подходящим для использования способом анализа связывания. Уменьшение на 10% или более связывания указанного полипептида показывает, что образец содержит вещество, которое модулирует связывание указанного полипептида с TNF-альфа. Конечно, описанный выше общий способ легко применить для скринига кандидатов в модуляторы, которые изменяют связывание между любым полипептидом против TNF-альфа по изобретению, гомологичной ему последовательностью, его функциональной частью или функциональной частью гомологичной ему последовательности и TNF-альфа или его фрагментом.

Воплощением настоящего изобретения является неизвестное средство, идентифицированное способом, описанным в данном описании.

Воплощением настоящего изобретения является неизвестное средство, идентифицированное способом, описанным в данном описании, для применения при лечении, предупреждении и/или облегчении симптомов расстройств, относящихся к воспалительным процессам.

Другим воплощением настоящего изобретения является применение неизвестного средства, идентифицированного способом, описанным в данном описании, для лечения, предупреждения и/или облегчения симптомов расстройств, относящихся к воспалительным процессам.

Примерами расстройств являются ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз.

Клетку, которая является пригодной по изобретению, выбирают, предпочтительно, из группы, состоящей из бактериальных клеток, таких как, например, Е. coli, дрожжевых клеток, например, S. cerevisiae, клеток насекомых или клеток млекопитающих.

Клетка, которая является пригодной по изобретению, может представлять собой любую клетку, в которую можно ввести нуклеотидную последовательность, кодирующую полипептид, содержащий анти-ТМР-альфа изобретения, гомологичную ей последовательность, ее функциональную часть или функциональную часть гомологичной ей последовательности по изобретению, так, что полипептид экспрессируется на естественных уровнях или выше естественных уровней, как определено в данном описании. Предпочтительно, полипептид изобретения, который экспрессируется в клетке, показывает нормальную или близкую к нормальной фармакологию, как определено в данном описании. Наиболее предпочтительно, полипептид изобретения, который экспрессируется в клетке, содержит нуклеотидную последовательность, способную кодировать любую аминокислотную последовательность из числа представленных в табл.1 или способную кодировать аминокислотную последовательность, которая, по меньшей мере, на 70% идентична аминокислотной последовательности, представленной в табл.1.

Согласно предпочтительному воплощению настоящего изобретения клетку выбирают из группы, состоящей из клеток COS7, клетки СНО, клетки LM (TK-), клетки NIH-3T3, клетки НЕК-293, клетки К-562 или клетки астроцитомы 1321N1, но также других трансфицируемых клеточных линий.

Вообще, "терапевтически эффективное количество", "терапевтически эффективная доза" и "эффективное количество" означают количество, необходимое для достижения нужного результата или результатов (модуляция связывания TNF-альфа; лечение или предупреждение воспаления). Специалист в данной области техники легко выяснит, что эффективность и, следовательно, "эффективное количество" могут изменяться для отдельных соединений, модулирующих связывание TNF-альфа, используемых в изобретении. Специалист в данной области техники легко оценит эффективность соединения.

Используемый в данном описании термин "соединение" относится к полипептиду против TNF-альфа настоящего изобретения, композиции или нуклеиновой кислоте, способной кодировать указанный полипептид, или средству, идентифицированному согласно способу скрининга, описанному в данном описании, или указанному полипептиду, содержащему одну или несколько дериватизированных аминокислот.

"Фармацевтически приемлемым" называют материал, который не является нежелательным биологически или по другим причинам, т.е., материал, который можно вводить индивидууму вместе с соединением без появления какого-либо нежелательного биологического действия или вредного взаимодействия с любым другим компонентом фармацевтической композиции, в которой он содержится.

Полипептиды против TNF-альфа, раскрываемые в данном описании, пригодны для лечения или предупреждения состояний у субъекта, заключающегося во введении фармацевтически эффективного количества соединения или композиции.

Полипептиды против TNF-альфа, раскрываемые в данном описании, пригодны для лечения или предупреждения состояний у субъекта, к числу которых относятся ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз, заключающегося во введении фармацевтически эффективного количества соединения или композиции, которые связывают TNF-альфа.

Полипептиды против TNF-альфа, раскрываемые в данном описании, пригодны для лечения или предупреждения состояний у субъекта, заключающегося во введении фармацевтически эффективного количества комбинации соединения с другим средством, таким как, например, аспирин.

Полипептиды против TNF-альфа, раскрываемые в данном описании, пригодны для лечения или предупреждения состояний у субъекта, к числу которых относятся ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз, заключающегося во введении фармацевтически эффективного количества комбинации соединения с другим средством, таким как, например, аспирин.

Настоящее изобретение не ограничивается введением композиций, содержащих одно соединение изобретения. В объем изобретения входит предоставление комбинированного лечения, когда пациенту, нуждающемуся в этом, вводят композицию, содержащую несколько соединений изобретения.

Состояния, опосредуемые TNF-альфа, включают ревматоидный артрит, болезнь Крона, неспецифический язвенный колит, синдром воспаленной толстой кишки и рассеянный склероз и другие состояния.

Соединение, пригодное в настоящем изобретении, можно включить в состав фармацевтических композиций и вводить хозяину-млекопитающему, такому как больной человек или домашнее животное, в разных формах, приспособленных для выбранного способа введения, т.е., перорально или парентерально, интраназально путем ингаляции, внутривенным, внутримышечным, местным или подкожным способом.

Соединение настоящего изобретения также можно вводить с использованием доставки способами генной терапии. См., например, патент США №5399346, включенный во всей полноте путем отсылки. С использованием доставки способом генной терапии первичные клетки, трансфицированные геном соединения настоящего изобретения, можно дополнительно трансфицировать тканеспецифическими промоторами для доставки в определенные органы, ткань, трансплантаты, опухоли или клетки.

Таким образом, соединения настоящего изобретения можно вводить системно, например, перорально, в сочетании с фармацевтически приемлемым наполнителем, таким как инертный разбавитель или усвояемый съедобный носитель. Их можно заключить в твердые или мягкие желатиновые капсулы, можно прессовать в таблетки или можно вводить непосредственно с пищевым продуктом из рациона пациента. Для перорального лечебного введения активное соединение можно объединить с одним или несколькими эксципиентами и использовать в форме таблеток, которые можно глотать, буккальных таблеток, лепешек, капсул, эликсиров, суспензий, сиропов, облаток и т.п. Такие композиции и препараты должны содержать, по меньшей мере, 0,1% активного соединения. Его процент в композициях и препаратах, конечно, может изменяться, и обычно может составлять от примерно 2 до примерно 60% мас. данной единичной дозированной формы. Количество активного соединения в таких терапевтически пригодных композициях таково, что можно будет получить эффективный уровень дозировки.

Таблетки, лепешки, пилюли, капсулы и т.п. также могут содержать следующие компоненты: связующие вещества, такие как трагакантовая смола, аравийская камедь, кукурузный крахмал или желатин; эксципиенты, такие как дикальцийфосфат; вещество, способствующее рассыпанию, такое как кукурузный крахмал, картофельный крахмал, альгиновая кислота и т.п.; смазывающее вещество, такое как стеарат магния; и подслащивающее вещество, такое как сахароза, фруктоза, лактоза или аспартам, или может быть добавлен корригент, такой как перечная мята, масло грушанки или вишневый ароматизатор. Когда единичная дозированная форма представляет собой капсулу, она может содержать, кроме веществ указанного выше типа, жидкий носитель, такой как растительное масло или полиэтиленгликоль. Различные другие вещества могут присутствовать как покрытия или для иной модификации физической формы твердой единичной дозированной формы. Например, на таблетки, пилюли или капсулы может быть нанесено покрытие из желатина, воска, шеллака или сахара и т.п.. Сироп или эликсир могут содержать активный компонент, сахарозу или фруктозу в качестве послащивающего вещества, метил- и пропилпарабены в качестве консервантов, краситель и корригент, такой как вишневый или апельсиновый ароматизатор. Конечно, любое вещество, используемое при получении любой единичной дозированной формы, должно быть фармацевтически приемлемым и, по существу, нетоксичным в используемых количествах. Кроме того, активное соединение можно включать в препараты и устройства с замедленным высвобождением.

Активное соединение также можно вводить внутривенно или интраперитонеально инфузией или инъекцией. Растворы активного соединения или его солей можно получить в воде, необязательно смешанной с нетоксичным поверхностно-активным веществом. Дисперсии также можно получить в глицерине, жидких полиэтиленгликолях, триацетине и их смесях и в маслах. В обычных условиях хранения и применения такие препараты содержат консервант для предотвращения размножения микроорганизмов.

Фармацевтические дозированные формы, подходящие для инъекции или инфузии, могут включать стерильные водные растворы или дисперсии или стерильные порошки, содержащие активный ингредиент (при необходимости инкапсулированный в липосомы), которые приспособлены для экстемпорального получения стерильных растворов или дисперсий для инъекций. Во всех случаях конечная дозированная форма должна быть стерильной, текучей и стабильной в условиях получения и хранения.

Жидкий носитель или наполнитель может представлять собой растворитель или жидкую дисперсионную среду, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и т.п.), растительные масла, нетоксичные глицериловые эфиры и их подходящие смеси. Надлежащую текучесть можно поддерживать, например, за счет образования липосом, сохраняя частицы требуемого размера в случае дисперсий или используя поверхностно-активные вещества. Предупреждения действия микроорганизмов можно добиться с помощью различных антибактериальных и противогрибковых средств, например, парабенов, хлорбутанола, фенола, сорбиновой кислоты, тимеросала и т.п. Во многих случаях будет предпочтительно включение веществ, поддерживающих изотоничность, например, Сахаров, буферных веществ или хлорида натрия. Пролонгированного поглощения композиций для инъекций можно добиться, используя в композициях вещества, замедляющие поглощение, например, моностеарат алюминия или желатин.

Стерильные растворы для инъекций получают, внося активное соединение в требуемом количестве в подходящий растворитель с различными другими ингредиентами, перечисленными выше, по необходимости, с последующей стерилизацией фильтрацией. В случае стерильных порошков для получения стерильных растворов для инъекций предпочтительными способами получения являются методы сушки в вакууме и лиофилизации, которые дают порошок активного ингредиента, содержащий любой дополнительный требуемый ингредиент, присутствующий в растворах, предварительно стерилизованных фильтрацией.

Для местного применения соединение настоящего изобретения можно применять в чистой форме, т.е., когда они представляют собой жидкости. Однако, как правило, желательно вводить их в кожу в виде композиций в сочетании с дерматологически приемлемым носителем, который может быть твердым веществом или жидкостью.

Пригодными твердыми носителями являются тонко измельченные твердые вещества, такие как тальк, глина, микрокристаллическая целлюлоза, диоксид кремния, диоксид алюминия и т.п. Пригодными жидкими носителями являются вода, спирты или гликоли или смеси вода-спирт/гликоль, в которых соединение настоящего изобретения может растворяться или диспергироваться на эффективных уровнях, необязательно, с помощью нетоксичных поверхностно-активных веществ. Можно добавлять адъюванты, такие как ароматизаторы и дополнительные антимикробные средства, для оптимизации свойств для данного применения. Полученные жидкие композиции можно наносить из абсорбирующих прокладок, использовать для пропитки бинтов и другого перевязочного материала или разбрызгивать на пораженные участки с использованием устройства типа насоса или распылителей аэрозолей.

С жидкими носителями также можно использовать загустители, такие как синтетические полимеры, жирные кислоты, соли и эфиры жирных кислот, жирные спирты, модифицированные целлюлозы или модифицированные минеральные вещества, для образования способных растекаться паст, гелей, мазей, мыл и т.п. для нанесения непосредственно на кожу потребителя.

Примеры пригодных дерматологических композиций, которые можно использовать для доставки соединения на кожу, известны в технике; см., например, Jacquet et al. (пат. США №4608392), Geria (пат. США №4992478), Smith et al. (пат. США №4559157) и Wortzman (пат. США №4820508).

Пригодные дозировки соединения можно определить, сравнивая их активность in vitro и активность in vivo на животных моделях. Способы экстраполяции эффективных дозировок для мышей и других животных на людей известны в технике; см., например, пат. США №493 8949.

Как правило, концентрация соединениями) в жидкой композиции, такой как лосьон, будет составлять примерно 0,1-25% мас., предпочтительно, примерно 0,5-10% c Концентрация в полутвердой или твердой композиции, такой как гель или порошок, будет составлять примерно 0,1-5% мас., предпочтительно, примерно 0,5-2,5% мас.

Количество соединения или его активной соли или производного, необходимое для применения при лечении, будет изменяться не только в зависимости от определенной выбранной соли, но также в зависимости от способа введения, природы состояния, от которого лечат, и возраста и состояния пациента и будет, в конечном счете, определяться врачом больницы или клиницистом. Дозировка соединения также изменяется в зависимости от мишени - клетки, опухоли, ткани, трансплантата или органа.

Нужную дозу можно удобно предоставить в однократной дозе или в виде разделенных доз, вводимых через соответствующие интервалы, например, в виде двух, трех, четырех или большего числа субдоз в сутки. Саму субдозу также можно разделить, например, на ряд отдельных введений через произвольные интервалы, как, например, несколько ингаляций из инсуффлятора или внесение нескольких капель в глаза.

Схема введения может включать длительное ежедневное лечение. Под "длительным" понимается длительность, по меньшей мере, в две недели, и предпочтительно, в несколько недель, месяцев или лет. Необходимые изменения при такой схеме приема лекарственного средства может определить специалист в данной области техники с использованием одного лишь рутинного экспериментирования с учетом приведенных в данном описании сведений. См. Remington’s Pharmaceutical Sciences (Martin E.W., ed.4). Mack Publishing Co., Easton, PA. Дозировка также может быть отрегулирована лечащим врачом в случае любого осложнения.

Изобретение относится к средству, являющемуся модулятором взаимодействий TNF-альфа/рецептор TNF-альфа.

Кандидат в такие средства может представлять собой синтетическое средство или смесь средств или может представлять собой природный продукт (например, растительный экстракт или культуральный супернатант). Кандидат в средство по изобретению включает небольшие молекулы, которые можно синтезировать, природный экстракт, пептиды, белки углеводы, липиды и т.д.

Кандидата в средства-модуляторы можно отобрать из больших библиотек синтетических или природных средств. В настоящее время используются многочисленные способы для случайного и направленного синтеза средств на основе сахаридов, пептидов и нуклеиновых кислот.Библиотеки синтетических веществ коммерчески доступны от ряда компаний, в том числе Maybridge Chemical Co. (Trevillet, Cornwall, UK), Comgenex (Princeton, NJ), Brandon Associates (Merrimack, NH) и Microsource (New Milford, CT). Библиотеки редких химических соединений доступны от Aldrich (Milwaukee, WI). Комбинаторные библиотеки доступны, и их можно получить. С другой стороны, библиотеки природных средств в форме бактериальных, грибковых, растительных и животных экстрактов доступны от, например, Pan Laboratories (Bothell, WA) или MycoSearch (NC), или их можно легко получить способами, хорошо известными в технике. Кроме того, природные и полученные синтетически библиотеки и средства легко модифицируются обычными химическими, физическими и биохимическими способами.

Пригодные средства можно найти во многих классах химических соединений. Пригодные средства могут представлять собой органические вещества или органические вещества с небольшими молекулами. Органические вещества с небольшими молекулами имеют молекулярную массу от свыше 50 до менее примерно 2500 дальтон, предпочтительно - менее примерно 750, предпочтительнее - менее примерно 350 дальтон. Примерами таких классов являются гетероциклические соединения, пептиды, сахариды, стероиды и т.п. Такие вещества можно модифицировать для усиления эффективности, стабильности, фармацевтической совместимости и т.п. Структурную идентификацию вещества можно использовать для идентификации, генерации или отбора других веществ. Например, когда идентифицируют пептиды, их можно модифицировать разными способами для улучшения их стабильности, например, используя неприродную аминокислоту, такую как D-аминокислота, в частности, D-аланин, образуя функциональные группы по амино- или карбоксильному концу, например, в случае аминогруппы ацилированием или алкилированием, и в случае карбоксильной группы этерификацией или амидированием, или подобными способами.

Для первичного скрининга пригодная концентрация кандидата в средство согласно изобретению составляет от примерно 10 мМ до примерно 100 мМ или более (т.е., 1 мМ, 10 мМ, 100 мМ, 1 М и т.д.). Концентрация первичного скрининга будет использоваться как верхний предел в ряду девяти других концентраций, где другие концентрации задают, уменьшая концентрацию первичного скрининга с полулогарифмическими интервалами (например, еще для 9 концентраций) для вторичных отборов или для получения кривых зависимости от концентрации.

Набор для высокоэффективного скрининга

Набор для высокоэффективного скрининга по изобретению содержит все необходимые средства и среды для осуществления детекции средства, которое модулирует взаимодействия TNF-альфа/рецептор TNF-альфа путем взаимодействия с TNF-альфа в присутствии полипептида, предпочтительно, в концентрации в интервале от 1 мкМ до 1 мМ.

Набор содержит следующее. Рекомбинантные клетки, содержащие и экспрессирующие нуклеотидную последовательность, кодирующую TNF-альфа, которые выращивают, согласно набору, на твердом носителе, таком как титровальный микропланшет, предпочтительнее - 96-луночный титровальный микропланшет, согласно способам, хорошо известным специалистам в данной области техники, в особенности так, как описано в WO 00/02045. С другой стороны, придается TNF-альфа в очищенной форме, который специалист в данной области техники иммобилизует, например, на 96-луночном титровальном микропланшете. В качестве альтернативы, в наборе придается TNF-альфа, иммобилизованный, например, на 96-луночном титровальном микропланшете. TNF-альфа может представлять собой целый TNF-альфа или его фрагмент.

Средства-модуляторы по изобретению в концентрациях от примерно 1 мкМ до 1 мМ или более добавляют в определенные лунки в присутствии полипептида против TNF-альфа в соответствующей концентрации, гомологичной ему последовательности, его функциональной части или функциональной части гомологичной ему последовательности, причем указанная концентрация указанного полипептида находится, предпочтительно, в интервале от 1 мкМ до 1 мМ. Наборы могут содержать один или несколько полипептидов против TNF-альфа (например, один или несколько полипептидов, представленных любой из SEQ ID NO:1-15, или другие полипептиды против TNF-альфа, гомологичные им последовательности, их функциональные части или функциональные части гомологичных им последовательностей).

Анализы связывания выполняют согласно способам, уже раскрытым в данном описании, и результаты сравнивают с базовым уровнем, например, связыванием TNF-альфа с полипептидом против TNF-альфа, гомологичной ему последовательностью, его функциональной частью или функциональной частью гомологичной ему последовательности, но в отсутствие добавляемого модулятора. Лунки, в которых обнаруживают, по меньшей мере, 2-кратное, предпочтительно - 5-кратное, предпочтительнее - 10-кратное и наиболее предпочтительно - 100-кратное или большее возрастание или убывание связывания полипептида против TNF-альфа (например) по сравнению с уровнем активности в отсутствие модулятора, отбирают для дальнейшего анализа.

Другие наборы, пригодные согласно изобретению

Изобретение относится к наборам, пригодным для скрининга модуляторов связывания TNF-альфа/рецептор TNF-альфа, а также к наборам для диагностики расстройств, характеризующихся дисфункцией TNF-альфа. Изобретение также относится к наборам, пригодным для скрининга модуляторов расстройств, а также к наборам для их диагностики, причем указанные расстройства характеризуются одним или несколькими процессами с участием TNF-альфа. Наборы, пригодные по изобретению, могут включать изолированный TNF-альфа. С другой стороны, или, кроме того, набор может содержать клетки, трансформированные для экспрессии TNF-альфа. В другом воплощении набор по изобретению может содержать полинуклеотид, кодирующий TNF-альфа. В еще одном воплощении набор по изобретению может содержать праймеры, пригодные для амплификации TNF-альфа. Наборы, пригодные по изобретению, могут содержать изолированный полипептид против TNF-альфа, его гомолог или его функциональную часть. Набор по изобретению может содержать клетки, трансформированные для экспрессии указанного полипептида. Наборы могут содержать несколько полипептидов. В другом воплощении набор по изобретению может содержать полинуклеотид, кодирующий TNF-альфа. В еще одном воплощении набор по изобретению может содержать специфические праймеры, пригодные для амплификации макромолекулы, такой как, например, TNF-альфа. Все наборы по изобретению будут содержать указанные компоненты или комбинации компонентов и упаковочные материалы для них. Наборы также будут содержать инструкции по применению.

Примеры

Изобретение иллюстрируется приведенными далее примерами, не являющимися ограничительными.

Пример 1. Пример антител Camelidae против человеческого фактора некроза опухолей альфа

1) Иммунизация и конструирование библиотек

Ламу (Lama glama) иммунизируют человеческим TNF-альфа. Для иммунизации получают композицию цитокина в виде эмульсии с соответствующим безвредным для животного адъювантом (Specoll, CEDI Diagnostics B.V.). Смесь с антигеном вводят инъекциями внутримышечно в два места на шее. Животное получает 6 инъекций эмульсии, содержащей 100 мкг TNF-альфа, с интервалами в неделю. В разные моменты времени во время иммунизации у животного берут 10-мл образцы крови, и получают сыворотку. Появление антигенспецифического гуморального иммунного ответа проверяют с использованием образцов сыворотки методом ELISA с TNF (данные не приводятся). Через пять дней после последней иммунизации берут образец крови в 150 мл. Из этого образца фракционируют обычные антитела и антитела на основе тяжелых цепей (HcAbs) (Lauwereys et al., 1998) и используют в ELISA, который подтверждает, что HcAbs ответственны за антигенспецифический гуморальный иммунный ответ (данные не приводятся). Лимфоциты периферической крови (PBL) как генетический источник иммуноглобулинов ламы на основе тяжелых цепей (HcAbs) выделяют из 150-мл образца с использованием градиента плотности в Ficoll-Paque (Amersham Biosciences), и получают 5×108 PBL. Ожидается, что максимальное разнообразие антител равно числу В-лимфоцитов в образце, которое составляет примерно 10% от числа PBL (5×107). Фракция антител на основе тяжелых цепей у ламы составляет до 20% от числа В-лимфоцитов. Поэтому максимальное разнообразие HcAbs в 150-мл образце крови принимают как 107 разных молекул. Из полученных клеток выделяют полную РНК (примерно 400 мкг) с использованием экстракции кислым тиоцианатом гуанидиния (Chomczynski and Sacchi, 1987).

На 100 мкг тотальной РНК получают кДНК с использованием обратной транскриптазы M-MLV (Gibco BRL), олиго-dT-праймера или случайных гексануклеотидных праймеров (Amersham Biosciences), как описано ранее (de Haard et al., 1999). Очищают кДНК экстракцией фенолом/хлороформом в сочетании с осаждением этанолом и затем используют в качестве матрицы для специфической амплификации репертуара VHH.

Репертуар VHH амплифицируют с использованием в качестве матрицы кДНК, синтезированной с олиго-dT в качестве затравки, с одним вырожденным праймером ABL013 (5’-GAGGTBCARCTGCAGGASTCYGG-3’) к каркасному участку 1 (FR1), вводящим сайт рестрикции PstI (выделен жирным шрифтом), в сочетании с олиго-dT-праймером, как описано в ЕР 01205100.9. Такая амплификация дает два фрагмента в 1650 п.о. и 1300 п.о., причем последний представляет собой продукт, образованный из генов HcAb с делегированным СН1. Более короткий продукт ПНР очищают в геле и затем расщепляют PstI и BstEII. Сайт BstEII часто встречается в FR4 ДНК-фрагментов, кодирующих VHH, происходящий из тяжелой цепи.

В качестве альтернативы, репертуар VHH амплифицируют с использованием шарнирного участка с использованием двух IgG-специфических олигонуклеотидных праймеров. В одной ПЦР короткий (5’-AACAGTTAAGCTTCCGCTTGCGGCCGCGGAGCTGGGGTCTTCGCTGTGGTGCG-3’)

или длинный (5’-AACAGTTAAGCTTCCGCTTGCGGCCGCTGGTTGTGGTTTTGGTGTCTTGGGTT-3’) к шарнирному праймер участку, известный как специфический для HcAb, комбинируют с FR1-праймером ABL013 (см. выше). Сайты рестрикции PstI и NotI (подчеркнуты и выделены жирным шрифтом) вводят в FR1- и шарнирный праймеры, соответственно, для возможности клонирования. Затем фрагменты ДНК для очистки и детекции лигируют в расщепленный PstI-BstEII или PstI-NotI фагомидный вектор рАХ004, который идентичен pHEN1 (Hoogenboom et al., 1991), но кодирует карбоксиконцевой (His)6- и c-myc-tag для очистки и детекции, соответственно. Смесь для лигирования обессоливают на фильтре Microcon (YM-50, Millipore) и вводят электропорацией в клетки Е. coli TG1 для получения библиотеки, содержащей 1,8×107 клонов. Трансформированные клетки выращивают в течение ночи при 37°С на отдельной чашке 20×20 см с LB, содержащей 100 мкг/мл ампициллина и 2% глюкозы. Колонии снимают с чашек с использованием среды 2xTY и хранят при -80°С в 20% глицерине.

Как качественный контроль, процент клонов, содержащих вставку, проверяют на 24 клонах для каждой библиотеки методом ПЦР с использованием комбинации праймеров на основе векторов. Такой анализ показывает, что 95% клонов содержат вставку, кодирующую VHH. Вариабельность проверяют Hinf I-фингерпринт-анализом амплифицированного фрагмента VHH указанных 24 клонов, который показывает, что все клоны действительно разные (данные не приводятся).

2) Отбор антагонистических VHH против TNF

Из обеих библиотек получают фаги. Для того, чтобы сохранить поликлональный фаговый репертуар, библиотеки выращивают до логарифмической фазы (OD600=0,5) при 37°С в 2xTY, содержащей 100 мкг/мл ампициллина и 2% глюкозы, и затем суперинфицируют хелперным фагом М13К07 в течение 30 минут при 37°С. Инфицированные клетки осаждают в течение 5 минут при 4000 об/мин и ресуспендируют в 2xTY, содержащей 100 мкг/мл ампициллина и 25 мкг/мл канамицина. Бактериофаги размножают выращиванием в течение ночи при 37°С и 250 об/мин. Ночные культуры центрифугируют в течение 15 минут при 4500 об/мин, и фаги осаждают добавлением 1/5 объема [20% полиэтиленгликоль 6000, 1,5 М NaCl] в течение 30 минут на льду. Получают осадок фагов центрифугированием в течение 15 минут при 4000×g при 4°С. После ресуспендирования фагов в PBS клеточный дебрис осаждают центрифугированием в течение 1 минуты при максимальной скорости (15000×g) в микроцентрифужных пробирках. Супернатант, содержащий частицы фагов, переносят в новую пробирку, и снова осаждают фаги, как описано выше. Фаги растворяют в PBS и отделяют от остального клеточного дебриса так, как описано выше. Титр фагов определяют инфицированием клетками TG1 в логарифмической фазе с последующим высевом на селективную среду.

Библиотеку отбирают с использованием биотинилированного in vitro TNF-альфа. Биотинилирование осуществляют так, как описано в Magni et al. (Anal, Biochem., 2001, 298, 181-188). Включение биотина в TNF оценивают анализом методом SDS-PAGE и детекцией с помощью конъюгата экстравидин-щелочная фосфатаза (Sigma). Функциональность модифицированного белка оценивают по его способности связываться с нанесенным на твердую фазу рекомбинантом рецептором р75.

VHH отбирают путем захватывания биотинилированного TNF-альфа (10-400 нг на лунку в течение 2 часов при комнатной температуре) на титровальных микропланшетах, сенсибилизированных стрептавидином (сенсибилизированных 100 мкл раствора стрептавидина, 10 мкг/мл, в течение 16 часов при +4°С). Антагонистические VHH получают элюированием избытком рецептора или внеклеточного лигандсвязывающего домена или клетками, экспрессирующими рецептор. После 2-часовой инкубации фагов с захваченным цитокином неспецифические фаги отмывают, в то время как антагонистические VHH специфического фагового дисплея элюируют в течение 30 минут рецептором (внеклеточный домен CD 120b или р75; 10 мкМ) или клетками, представляющими рецептор (>105 клеток KYM на лунку). Высокая степень обогащения, т.е., где соотношение числа фагов, элюированных рецепторов, и фагов, элюированных сывороточным альбумином (50 мкг на лунку), превышает фактор 20, предполагает успешную селекцию специфических клонов TNF-альфа. В качестве альтернативы, вместо элюирования рецептором применяют стандартную процедуру, при которой низкий рН вызывает денатурацию VHH и/или антигена (0,1 М глициновый буфер, рН 2,5). Клетки Е. coli в логарифмической фазе роста инфицируют элюированными и нейтрализованными фагами и высевают на селективную среду.

Отдельные клоны собирают и выращивают в титровальном микропланшете для получения VHH в культуральном супернатанте. Скриниг ELISA с помощью TNF-альфа, захваченного на сенсибилизированных экстравидином планшетах, показывает примерно 50% положительных клонов. По показаниям Hinf 1-фингерпринт-анализа отбирают 13 клонов, которые выращивают и индуцируют в объеме 50 мл. Последовательности указанных клонов показаны в табл.1.

Пять клонов, обозначенных VHH#1A, #2B, #3G, #7B и #12В, с разными последовательностями (фигура 1) характеризуют подробнее. VHH#3E, #3G и #7В представляют собой фрагменты однодоменных антител, содержащие типичный гидрофильный остаток в позиции 45 (аргинин) и замену фенилаланина на триптофан в позиции 47 в ER2, причем посредством этого придаются выгодные характеристики в смысле растворимости. VHH#1A содержит гидрофобные остатки FR2, типично обнаруживаемые в двухцепочечных антителах человеческого происхождения или от других видов, но такая потеря гидрофильности компенсируется заряженным аргининовым остатком в позиции 130, который заменяет консервативный триптофановый остаток, присутствующий в VH из двухцепочечных антител (РСТ/ЕР 02/07804). Новый класс гуманизированных однодоменных антител Camilidae, описанный в данном изобретении, представлен VHH#2B и VHH#12B, которые содержат гидрофобные остатки в FR2 в сочетании с гидрофобным остатком триптофана в позиции 103. Большие количества фрагментов антител экспрессируют путем культивирования в объеме 50 мл и очищают IMAC с использованием смолы TALON (Clontech). После диализа против PBS для удаления элюента имидазола определяют количество VHH no OD280; из каждого клона получают приблизительно 300 мкг VHH.

Полученный материал используют для определения чувствительности детекции (биотинилированного) TNF в ELISA. Для такой цели сенсибилизированный стрептавидином (10 мкг/мл) титровальный микропланшет используют для захватывания биотинилированного TNF (1 мкг/мл). VHH разводят в 0,2% растворе казеин/PBS и инкубируют в течение 2 часов при комнатной температуре. Связанные VHH детектируют с mAB 9T10 против MYC (0,5 мкг/мл) и антимышиным конъюгатом с АР (1000-кратное разведение, Sigma). Результаты показаны на фигуре 2.

3) Определение антагонистического действия способом анализа цитотоксичности с клеточной линией KYM

Вызванные TNF-альфа цитостаз/цитотоксичность определяют колориметрическим анализом с МТТ, как описывают Vandenabeele с сотрудниками (Vandenabeele P., Declercq W., Vercammen D., Van de Crain M., Grooten J., Loetscher H., Brockhaus M., Lesslauer W., Fiers W. (1992), Functional characterisation of the human tumor necrosis factor receptor p75 in a transfected rat/mouse Т cell hybridoma. J. Exp. Med., 176, 1015-1024). МТТ (бромид 3-(4,5-диметилтиазол-2-ил)-2,5-дифенилтетразолия) представляет собой бледно-желтый субстрат, который расщепляется живыми клетками с образованием темно-синего продукта формазона. Такой процесс требует активных митохондрий, и даже только что погибшие клетки не расщепляют значительные количества МТТ. Клетки KYM (Sekiguchi M., Shiroko Y., Suzuki Т., Imada M., Miyahara M., Fujii G. (1985), Characterization of a human rhabdomyosarcoma cell strain in tissue culture. Biomed. Pharmacother., 39, 372-380) высевают в 96-луночные титровальные микропланшеты и культивируют в присутствии или в отсутствие TNF-альфа (0,216 нг/мл или приблизительно 5 пМ тримера). Кроме TNF во время культивирования включают переменные количества антител (VHH или Remicade). Для анализа в культуральную среду добавляют МТТ в конечной концентрации 500 мкг/мл, и планшеты инкубируют при 37°С для достижения расщепления МТТ митохондриальными ферментами. Образовавшийся продукт формазан, который выглядит как черные пушистые кристаллы на дне лунки, растворяют, добавляя кислый изопропанол (40 нМ НС1 в изопропаноле) или ДМСО. Измеряют поглощение при 570 нм.

Анализ с МТТ (фигура 3) показывает, что VHH#1A, содержащий аргинин в позиции 103 в сочетании с гидрофобными остатками в FR2, сходными с остатками, характерными для человека, оказывает умеренное антагонистическое действие (IC50~100 нМ). VHH#7B с характерными гидрофильными остатками в FR2 не предотвращает связывание TNF-α с его лигандом, несмотря на чувствительную детекцию цитокина им в ELISA (кривая не приводится). Напротив, VHH#3E и #3G с гидрофильными маркерными остатками FR2 являются очень сильными антагонистическими VHH (IC50 20 нМ). VHH#3E и #3G имеют высокую степень гомологии и являются клонально родственными (Harmsen et al, Mol. Immunol., 37, 579-590), но VHH#3E является более эффективным, вероятно, в силу того факта, что он имеет более высокую аффинность, чем VHH#3G (фигура 2). Моноклональные (химерные) антитела Remicade являются очень эффективными (IC50 80 пМ), но полученные из них фрагменты Fab теряют большую часть их эффективности (IC50 3 нМ - в 30 раз меньше, чем у интактных mAB). Это четко указывает на влияние авидности на взаимодействие между антителами и цитокином: mAB с двумя сайгами связывания взаимодействует более эффективно с тримерными молекулами TNF через кооперативное связывание. Фрагменты VHH являются строго одновалентными, и поэтому предполагается, что увеличение авидности путем генетического слияния генов VHH может повысить их антагонистическую эффективность (см. пример 4).

Такие эксперименты показывают, что новый класс VHH, сходных с человеческими, имеет хорошие связывание и функциональные характеристики, что делает возможным их применение для лечебных целей.

Пример 2. Гуманизация VH#12B и VHH#3Е путем сайт-направленного мутагенеза

1) Гомология между VHH#3E/VHH#12B и V-областью тяжелой цепи зародышевой линии человека DP-47

Выравнивание VHH#12B и последовательности VH3 зародышевой линии человека (DP-47) показывает высокую степень гомологии:

- 4 аминокислотные замены в FR1 в позиции 1, 5, 28 и 30;

- 5 аминокислотных замен в FR3 в позиции 74, 76, 83, 84 и 93;

- 1 аминокислотная замена в FR4 в позиции 108;

что представлено в следующем выравнивании последовательностей:

DP-47 EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYAMS WVRQAPGKGLEWVS AISGSGGSTYY VHH#12B QVQLQESGGGLVQPGGSLRLSCAASGFEFE NHWMY WVRQAPGKGLEWVS TVNTNGLITRY

DP-47 ADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK ----- ---- VHH#12B ADSVKG RFTISRDNAKYTLYLQMNSLKSEDTAVYYCTK VLPPYSDDSRTNAD WGQGTQVTVSS

Поэтому специфический ингибитор цитокина TNF-альфа с высокой гомологией гену зародышевой линии человека DP-47 представляет собой идеального кандидата для последующей гуманизации и оценки влияния мутагенеза на ингибирующую способность в ELISA.

Выравнивание VHH#3E и VH3 зародышевой линии человека (DP-47) показывает наличие двух гидрофильных аминокислотных остатков в FR2 VHH#3E при сравнении с гидрофобными остатками в DP-47.

DP-47 EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYAMS----- WVRQAPGKGLEWVS AISGSGGSTYY VHH#3E QVQLQESGGGLVQPGGSLRLSCAASGRTFS DHSGYTYTIG WFRQAPGKEREFVA RIYWSSGNTYY

DP-47 ADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK ----- ---- VHH#3E ADSVKG RFAISRDIAKNTVDLTMNNLEPEDTAVYYCAA RDGIPTSRSVESYNY WGQGTQVTVSS

Оценка влияния замены гидрофильных остатков гидрофобными, присутствующими в VH человека, важна, так как большинство последовательностей VHH Camelidae содержит гидрофильные остатки.

2) Мутагенез VHH#12B

VHH#12B мутагенизируют, используя способ сайт-направленного мутагенеза не на основе ПЦР, описанный Chen и Ruffner и коммерциализованный Stratagene (сайт-направленный мутагенез Quickchange). Плазмидную ДНК используют в качестве матрицы в сочетании с 2 мутагенными прайм ерами, вводящими нужную(ые) мутацию(и). Каждый из 2 праймеров комплементарен противоположным цепям матричной плазмидной ДНК. В полимеразной реакции с использованием ДНК-полимеразы Pfu каждая цепь наращивается с праймерной последовательности в процессе циклической программы с использованием ограниченного числа циклов. Получают смесь цепей дикого типа и мутантных цепей. Расщепление DpnI приводит к отбору мутированной синтезированной in vitro цепи ДНК, так как только матричная цепь чувствительна к расщеплению. ДНК осаждают и трансформируют в Е. coli и анализируют на требуемую мутацию путем анализа последовательности. Полученные мутантные VHH и мутагенные праймеры перечислены в табл.2.

Плазмиду получают из мутантных клонов и трансформируют в электрокомпетентные клетки WK6. Одну колонию используют для получения ночной культуры в LB, содержащей 2% глюкозы и 100 мкг/мл ампициллина. Ночную культуру разводят в 100 раз в 300 мл среды ТВ, содержащей 100 мкг/мл ампициллина, и инкубируют при 37°С до OD600 нм = 2, когда добавляют 1 мМ IPTG и 5 мМ MgSO4 (конечные концентрации), и культуру инкубируют дополнительно в течение 3 часов при 37°С.

Культуры центрифугируют в течение 20 минут при 4°С. Осадок выдерживают в холодильнике в течение ночи или в течение 1 часа при -20°С. Затем осадок оттаивают при комнатной температуре в течение 40 минут, ресуспендируют в 20 мл PBS/1 мМ ЭДТА/1 М NaCl и встряхивают на льду в течение 1 часа. Периплазматическую фракцию выделяют центрифугированием в течение 20 минут при 4°С при 4500 об/мин. Супернатант, содержащий VHH, наносят на TALON (ClonTech) и очищают до гомогенного состояния. Выход VHH определяют с использованием рассчитанного коэффициента экстинкции. Все мутантные VHH экспрессируются сравнимо с диким типом. Мутантов анализируют на их ингибирующую способность способом анализа связывания рецепторов in vitro.

Титровальный микропланшет сенсибилизируют в течение ночи при 4°С Enbrel (Wyeth) при 2 мкг/мл в PBS. Планшет промывают пять раз смесью PBS-Твин и блокируют в течение 1 часа при комнатной температуре PBS, содержащим 1% казеина. Планшет промывают пять раз смесью PBS-Твин. Предварительно инкубируют человеческий TNF-альфа (80 мкг/мл) с серийными разведениями мутантного VHH#12B или VHH#12B дикого типа в течение 1 часа при комнатной температуре (RT) в лунках титровального микропланшета. Планшет промывают пять раз смесью PBS-Твин. Связанный человеческий TNF-α детектируют с использованием конъюгата экстравидин-АР (разведение 1/1000) и пара-нитрофенилфосфата (pNPP). Сигналы измеряют через 30 минут при 405 нм. Результаты представлены на фигуре 4 и 5. IC50 возрастает в 3 раза с 66 нМ (дикий тип) до 200 нМ (мутант Q1E+Q5L+A74S+Y76N+K83R+P84A). Мутация позиции Т93А приводит к утрате ингибирования (данные не приводятся). Позициями, которые еще нуждаются в гуманизации, являются Е28, Е30 и Q108. Однако Е28 и Е30 являются частью канонической структуры H1 и, таким образом, частью CDR1 согласно системе нумерации по Chothia.

Аминокислотные последовательности мутантных VHH представлены в табл.4 SEQ ID NO:17-19.

3) Мутагенез VHH#3E

VHH#3E мутируют с использованием способа сайт-направленного мутагенеза не на основе ПЦР, описанного выше. Полученные мутантные VHH и мутагенные праймеры приводятся в табл.3.

Все мутантные VHH экспрессируются сравнимо с диким типом. Очищенные мутантные VHH анализируют на связывание в ELISA и ингибирующую способность способом анализа связывания рецепторов, идентичным способу, описанному выше.

Результаты ELISA показаны на фигуре 6, результаты анализа связывания рецептора приводятся на фигуре 7.

Аминокислотные последовательности мутантных VHH представлены в табл.4 SEQ ID NO:21-24.

Пример 3. Выделение антагонистической VHH против мышиного TNF-альфа

1) Отбор VHH против мышиного TNF-алъфа

Для того, чтобы выполнить эффективные исследования на мышиных моделях IBD или болезни Крона, отбирают специфические VHH для мышиного TNF. Поэтому ламу иммунизируют мышиным TNF-альфа так, как описано в примере 1. РНК экстрагируют из образцов PBL, взятых через 4 и 10 дней после последней иммунизации, а также из биопсии, взятой из лимфатического узла через 4 дня. Полную РНК превращают в кДНК, синтезированную либо с помощью случайных праймеров, либо с помощью олиго-dT в качестве затравки, и используют в качестве матрицы для амплификации VHH, кодирующей генные сегменты, с использованием праймеров, происходящих из Ig, или сочетания олиго-сГГ-праймера и одного Ig-праймера (см. пример 1). С Ig-праймерами получают библиотеку, содержащую 8,5×107 клонов из первого образца PBL, и библиотеку с 7×106 клонами в случае второго образца PBL, и 5,8×108 клонов в случае лимфатического узла. С использованием сочетания олиго-dT-праймера и Ig праймера получают библиотеку из первого образца PBL, содержащую 1,2×108 клонов, библиотеку из второго образца PBL в 5,7×107 клонов, и библиотека, полученная из лимфатического узла, содержит 2×108 клонов. Библиотеки объединяют в зависимости от используемого сочетания праймеров, и две полученные библиотеки выращивают для размножения фагов, как описано ранее. Отбор осуществляют на биотинилированном мышином TNF-альфа, захваченном на стрептавидиновом покрытии, связанные фаги элюируют с помощью конкуренции с человеческим рецептором р75, который, как известно, взаимодействует перекрестно с мышиным TNF-альфа. Два разных специфических к мышиному TNF-альфа VHH (VHH#m3F и VHH#m9E) отбирают из библиотеки, полученной амплификацией с праймерами, происходящими из Ig, в то время как из библиотеки, сконструированной методом ПЦР с олиго-dT-праймером и Ig праймером, извлекают две близкородственные VHH (фигура 8).

2) Определение антагонистической эффективности в способе анализа цитотоксичности с клеточной линией L929 (фигура 9)

Применяют тот же тип анализа, какой описан в примере 1, но с мышиной клеточной линией L929. VHH#m3F и VHH#m4B (фигура 9) оказались в 10 раз более эффективными, чем другие два VHH.

Пример 4. Усиление антагонистической эффективности путем повышения авидности с использованием поливалентных антител Camelidae

1) Антагонистическая эффективность двух-, трех- и четырехвалентных VHH против человеческого и мышиного TNF-алъфа

Конструируют вектор рАХ11 для получения в Е. coli (фигура 10), который делает возможным клонирование бивалентной или биспецифической VHH. Карбоксиконцевое VHH клонируют сначала при помощи PstI и BstI, в то время как на второй стадии другую VHH встраивают по Sfil и NotI, которые не расщепляют в пределах первого генного фрагмента. Процедура позволяет избежать введения новых сайтов путем амплификации и, таким образом, опасности введения ошибок ПЦР.

С данным вектором получают двухвалентное производное антагонистического VHH#3E против человеческого TNF-альфа. Плазмидный вектор, кодирующий двухвалентное VHH, используют для получения трех- и четырехвалентного производного, что осуществляют частичным расщеплением плазмиды BstII, которое имеет место в обоих сегментах гена VHH. Линеаризованный вектор очищают в геле, затем дефосфорилируют и используют как акцептор для клонирования фрагмента BstI приблизительно в 350 п.о., который получают полным расщеплением той же плазмиды. Лигирование само по себе фрагмента BstI перед добавлением к вектору усиливает инсерцию мультимерной VHH, кодирующей сегменты гена. После трансформации в Е. coli TG1 полученные клоны подвергают скринингу методом ПЦР с праймерами M13Rev и M13Fwd; так как BstEII расщепляет асимметрично (выступ 5 нуклеотидов), получают только правильно ориентированные вставки, что подтверждается расщеплением плазмид одним PstI (350 п.о.) или двойным расщеплением EcoRI и HindIII (1000 п.о. для двухвалентного (BIV 3Е, SEQ ID NO:73), 1350 п.о. для трехвалентного (TRI 3Е, SEQ ID NO:74) и 1700 п.о. для четырехвалентного (TETRA 3Е, SEQ ID NO:75), данные не приводятся). Последовательности представлены в табл.7.

Клоны выращивают и индуцируют в объеме 50 мл, получают периплазматические фракции и используют для очистки методом IMAC на смоле TALON. Анализ очищенных продуктов PAGE с окрашиванием кумасси показывает хорошие уровни продуцирования (от 2 до 10 мг на литр клеточной культуры) интактного поливалентного VHH (см. фигуру 11). Молекулярное состояние очищенного IMAC VHH определяют гель-фильтрацией на колонке с Superdex 75HR, и, как ожидалось, молекулы с более высокой авидностью сходят с колонки раньше (см. фигуру 12).

Антагонистическую эффективность анализируют способом анализа на основе клеток с использованием клеток КУМ. Клетки высевают в титровальные микропланшеты и культивируют в присутствии или в отсутствие TNF-альфа (1,29 нг/мл или приблизит. 25 мМ тримера). Анализы (фигура 13) показывают, что одновалентные молекулы, используемые в данном исследовании, обладают самыми худшими анатагонистическими характеристиками, что отражают величины их IC50: Fab, полученный из химерного антитела Remicade, имеет IC50 2 нМ, и для VHH#3E IC50 составляет 12 нМ (см. также фигуру 3). Оказалось, что авидность используемых молекул оказывает существенное влияние на антагонистическую эффективность, как наблюдается в случае двухвалентной молекулы IgG Remicade, которая боле чем в 40 раз эффективнее (IC50 50 пМ), чем Fab. TNF-альфа является гримерной молекулой, которая взаимодействует с димерным рецептором, и поэтому можно ожидать, что авидность IgG допускает взаимное связывание с двумя эпитопами на цитокине и поддерживает образование больших комплексов, как описано ранее (Santora et al., Anal. Biochem., 299, 119-129). Неожиданно повышение авидности VHH от мономера к димеру оказывает еще большее влияние, чем наблюдаемое с Remicade, так как IC50 димера (30 пМ) в 400 раз меньше, чем мономера. Повышение авидности также ведет к еще более лучшему антагонистическому поведению: тримерное VHH имеет IC50 20 пМ, а четырехвалентная форма - 6 пМ. Все формы VHH с более высокой авидностью более эффективны, чем Remicade, в то время как четырехвалентная форма даже лучше Enbrel, состоящего из внеклеточного домена рецептора р75, слитого с Fc IgG, и поэтому имеет двухвалентный тип связывания.

Такое же неожиданное влияние авидности на антагонистическое поведение наблюдают с VHH, полученным против мышиного TNF (фигура 14). Анализ на цитотоксичность того же типа выполняют с использованием МТТ в качестве субстрата и мышиного TNF-альфа (65 пг/мл или 1,3 пМ), но с мышиной клеточной линией L929, которая экспрессирует мышиный специфический рецептор. Идентифицируют три разные антагонистические (одновалентные) VHH, обозначенные 9Е и 3F, из которых первые две имеют IC50 25 нМ, а последняя 2 нМ (см. также пример 3). Превращение 3F в двухвалентную форму (BIV#m3F, SEQ ID NO:76) дает 1000-кратное улучшение IC50 (2 пМ), посредством чего еще раз демонстрируется, что повышенная авидность антител ведет к неожиданному улучшению антагонистических характеристик.

2) Сравнение со слитым белком vhh-fc

VHH#3E, направленное против человеческого TNF, клонируют с помощью PstI и BstII в вектор, происходящий из pCDNA3, причем посредством этого получают генетическое слияние с Fc-фрагментом человеческого IgG с делегированным СН1. После подтверждения секвенированием плазмидную конструкцию трансфицируют в клеточную линию миеломы NSO. Полученную клеточную линию выращивают, и слитый белок VHH-Fc секретируется в культуральный супернатант. Продукт очищают с помощью смолы (VHH против Fc человека) и анализируют в геле, окрашенном кумасси (фигура 15). В присутствии DTT гибрид виден как белок в 45 кДа, в отсутствие DTT можно наблюдать димерные молекулы с молекулярной массой 90 кДа. Такой димерный продукт является результатом соединения двух цепей двумя дисульфидными мостиками, которые образуются из цистеиновых остатков, расположенных в шарнирной области.

Гибрид VHH-Fc испытывали способом биологического анализа с линией человеческих клеток KYM, и он оказался в 5 раз менее эффективным, чем двухвалентное VHH, несмотря на тот факт, что обе молекулы имеют одинаковую авидность, и что они обе происходят от VHH#3E (фигура 16). Вероятно, такое несоответствие может вызываться пространственным затруднением за счет объемного хвоста Fc.

Пример 5. Расчет гомологии между однодоменными антителами против мишеней по изобретению

Степень гомологии аминокислотных последовательностей между однодоменными антителами против мишеней по изобретению вычисляют с использованием Bioedit Sequence Alignment Editor. Расчеты показывают долю идентичных остатков во всех последовательностях, выровненных с помощью ClustalW (Thompson J.D., Higgins D.G. and Gibson T.J. (1994), CLUSTAL W: improving the sesitivity of progressive multiple sequence alignment through sequence weighing, position specific gap penalties and weight matrix choice. Nucleic Acids Research, submitted, June 1994). Табл.8 показывает парциальную гомологию между VHH изобретения против сывороточного альбумина. Табл. 9 показывает парциальную гомологию между VHH изобретения против TNF-альфа. Табл. 10 показывает гомологию, в процентах, между VHH изобретения против IFN-гамма.

Пример 6. Экспрессия фрагмента VHH-CDR3 VHH#3Е

Участок CDR3 VHH#3E амплифицируют с использованием смыслового праймера, расположенного в каркасной области 4 (прямой: CCCCTGGCCCCAGTAGTTATACG), и антисмыслового праймера, расположенного в каркасной области 3 (обратный: TGTGCAGCAAGAGACGG). Для того, чтобы клонировать фрагмент CDR-3 в рАХ10, проводят второй раунд ПЦР-амплификации с праймерами, указанными далее, вводящими требуемые сайты рестрикции.

Обратный праймер Sfil:

GTCCTCGCAACTGCGGCCCAGCCGGCCTGTGCAGCAAGAGACGG

Прямой праймер Noti:

GTCCTCGCAACTGCGCGGCCGCCCCCTGGCCCCAGTAGTTATACG

Реакции ПЦР выполняют в реакционной смеси объемом 50 мл с использованием 50 пмоль каждого праймера. Условиями реакции для первой ПЦР являются: 11 мин при 94°С, затем 30/60/120 секунд при 94/55/72°С - 30 циклов и 5 мин при 72°С. Все реакции осуществляют с 2,5 мМ MgCl2, 200 мМ dNTP и 1,25 Е ДНК-полимеразы AmpliTaq God (Roche Diagnostics, Brussels, Belgium).

После расщепления Sfi1 и Not1 продукт ПЦР клонируют в рАХ10.

Пример 7. Испытание на стабильность фрагментов антител, специфических к человеческому TNFα

Белки для перорального введения подвергают денатурации при кислотном рН желудка, а также разложению пепсином. Выбираются условия исследования устойчивости VHH#3E к пепсину, как предполагается, имитирующие среду желудка. VHH#3E - VHH, специфическое к человеческому TNFα, получают в Е. coli в виде рекомбинантного белка и очищают до гомогенного состояния IMAC и гель-хроматографией. Коцентрацию белка после очистки определяют спектрофотометрически с использованием вычисленного коэффициента молярной экстинкции при 280 нм. Разведенные растворы, 100 мкг/мл, получают в буфере Mcllvaine (J. Biol. Chem., 49, 1921, 183) при рН 2, рН 3 и 4, соответственно. Затем такие растворы инкубируют в течение 15 минут при 37°С перед добавлением пепсина слизистой оболочки желудка свиньи в соотношении 1/30, мас./мас. Через 60 минут после добавления протеазы берут образец и сразу же разводят в 100 раз в PBS, рН 7,4, содержащем 0,1% казеина, для инактивации пепсина. Получают семь дополнительных 3-кратных разведении из этого образца для оценки наличия функциональных фрагментов антител методом ELISA. Идентичные разведения, полученные из аликвоты, отобранной перед добавлением протеазы, служат в качестве образцов сравнения. В анализе ELISA биотинилированный TNFα захватывается стенками титровального микропланшета, сенсибилизированными нейтравидином. Как для образцов, обработанных пепсином, так и для образцов для сравнения получают одинаковые серийные разведения образцов, и добавляют в лунки по 100 мкл таких разведении. После инкубации в течение 1 часа планшеты промывают. Для детекции связывания VHH с захваченным TNFα используют поликлональную кроличью антисыворотку против VHH (R42) и конъюгат антикроличьего IgG и щелочной фосфатазы. После промывания планшеты проявляют пара-нитрофенилфосфатом. Результаты на графике на фигуре 17 показывают схожие кривые для всех образцов, подвергнутых воздействию условий гидролиза, так же, как и образцов сравнения. Это показывает, что VHH#3E, по существу, сохраняет свою функциональную активность при всех выбранных условиях.

Пример 8. Пероральное введение мышам специфических VHH против человеческого TNFα

Получают раствор антител, содержащий VHH#3E, специфическое против человеческого TNFα (100 мкг/мл, 100-кратное разведение в PBS). Трех мышей сначала лишают питьевой воды в течение 12 часов, а затем дают возможность свободного доступа к раствору антител в течение следующих двух часов. Затем мышей умерщвляют, и иссекают их желудки. Сразу же содержимое желудков собирают, промывая желудок 500 мкл PBS, содержащего 1% BSA. Затем полученный промывкой материал используют для получения серийных трехкратных разведении, начиная с разведения 1/5 неразведенного материала. Переносят по 100 мкл таких образцов в отдельные лунки титровального микропланшета, сенсибилизированного человеческим TNFα. После инкубации в течение 1 часа и последующей обильной промывки проверяют наличие иммуннореактивного материала с поликлональной кроличьей антисывороткой против VHH (R42) с последующей инкубацией с конъюгатом антикроличьего IgG и щелочной фосфатазы. ELISA проявляют пара-нитрофенилфосфатом. Сигналы ELISA, полученные через 10 минут, четко показывают наличие функционального VHH#3E в материалах промывки желудков указанных мышей. Сравнением со стандартной кривой определяют, что концентрация функциональных фрагментов антител в промывочной жидкости составляет 1,5, 12,6 и 8,6 мкг/мл для трех подопытных мышей.

Пример 9. Эффективность на животной модели IBD

1) Животная модель хронического колита

Эффективность двухвалентных конструкций VHH, применяемых через разные пути введения, оценивают на модели хронического колита, вызванного DSS (декстраннатрийсульфат) у мышей BALB/c. Данная модель изначально описана Okayasu et al. [Okayasu et al., Gastroenterology, 1990; 98:694-702] и модифицирована Kojouharoffet al. [Kojouharoff et al., Clin. Exp. ImmunoL, 1997; 107:353-8]. Животных получают в Charles River Laboratories, Germany, в возрасте 11 недель и держат в клетках до достижения массы тела 21-22 г. Хронический колит индуцируют у животных четырьмя циклами обработки DSS. Каждый цикл состоит из периода обработки DSS (7 дней), где DSS дают с питьевой водой в концентрации 5% (мас./об.), и периода восстановления (12 дней), когда DSS в питьевой воде не присутствует. восстановительный период продлевают с 12 до 21 дня для обеспечения статуса воспаления, представляющего хроническое, а не острое воспаление во время обработки. После последнего периода восстановления мышей произвольно распределяют в группы по 8 мышей и начинают обработку VHH-конструкциями. Период обработки составляет 2 недели. Через неделю после окончания обработки животных умерщвляют, кишечник иссекают и проводят гистологическое исследование. Схема эксперимента показана на фигуре 18.

2) Схема обработки VHH

Во время обработки VHH мышей (8 животных на группу) обрабатывают ежедневно в течение 14 дней подряд двухвалентным VHH#3F (VHH#m3F-VHH#m3F; SEQ ID NO:76) внутрижелудочным или внутривенным введением 100 мкг двухвалентного VHH 3F. Дополнительную группу животных обрабатывают ректально двухвалентным VHH#3F через день в течение 14 дней. Во всех обработанных группах дозу VHH#3F 100 мкг вносят при концентрации 1 мг/мл в забуференном растворе. Группа отрицательного контроля получает 100 мкл PBS в условиях, в других отношениях идентичных. Схема обработки приводится в табл.11.

3) Результаты

После умерщвления всех мышей определяют массу тела и иссекают толстую кишку. Определяют длину иссеченной части, и оценивают гистологию с помощью красителя гематоксилин-эозин (НЕ) (стандартные условия). По сравнению с отрицательным контролем (обработка PBS) группы, обработанные двухвалентным нанотелом 3F, показывают сохранившуюся длину толстой кишки, а также улучшенный гистологический показатель [Kojouharoffet al., Clin. Exp. Immunol., 1997; 107:353-8], тем самым демонстрируя эффективность лечения.

Таблица 1
Список аминокислотных последовательностей пептидов аспектов настоящего изобретения, направленных против TNF-альфа
Название SEQ ID NO Последовательность
VHH#1A 1 QVQLQESGGGLVQPGGSLRLSCATSGFDFSVSWMYWVRQAPGKG LEWVSEWTNGLITKYVDSVKGRFTISRDNAKNTLYLQMDSLIPED TALYYCARSPSGSFRGOGTOVTVSS
VHH#7B 2 QVQLQESGGGLVQPGGSLRLSCAASGSIFRVNAMGWYRQVPGNQ REFVAIITSGDNLNYADAVKGRFTISTDNVKKTVYLQMNVLKPED TAVYYCNAILQTSRWSIPSNYWGQGTQVTVSS
VHH#2B 3 QVQLQESGGGLVQPGGSLRLSCATSGFTFSDYWMYWVRQAPGK GLEWVSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKS EDTAVYYCTKVVPPYSDDSRTNADWGQGTQVTVSS
VHH#3E 4 QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQA PGKEREFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNN LEPEDTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
VHH#3G 5 QVQLQDSGGGLVQAGGSLRLSCAVSGRTFSAHSVYTMGWFRQAP GKEREFVARIYWSSANTYYADSVKGRFTISRDNAKNTVDLLMNSL KPEDTAVYYCAARDGIPTSRTVGSYNYWGQGTQVTVSS
VHH#10A 6 QVQLQESGGGLVQPGGSLRLSCAASGSIFRVNAMGWYRQVPGNQ REFVAIITSSDTNDTTNYADAVKGRFTISTDNVKKTVYLQMNVLK PEDTAVYYCNAVLQTSRWSEPSNYWGQGTQVTVSS
VHH#2G 7 QVQLQDSGGGLVQAGGSLRLSCTTSGRTISVYAMGWFRQAPGKE REFVASISGSGAITPYADSVKGRFTISRDNAKNTVYLQMNSLNPED TAVYYCAASRYARYRDVHAYDYWGQGTQVTVSS
VHH#1F 8 QVQLQDSGGGLVQAGGSLRLSCAASTRTFSRYWGWFRQAPGKE REFVATISWNGEHTYYADSVKGRYTISRDNAKNTVYLQMGSLKPE DTAVYYCAARSFWGYNVEQRDFGSWGQGTPVTVSS
VHH#9C 9 QVQLQESGGGLVQPGGSLRLSCAASGSIFRVNAMGWYRQVPGNQ REFVAIITNDTTNYADAVKGRFTISTDNVKKTVYLQMNVLKPEDT AVYYCNTVLQTSRWNIPTNYWGQGTQVTVSS
VHH#11E 10 QVQLQESGGGLVQPGGSLRLSCAASGSIFRVNAMGWYRQVPGNQ REFVAIISGDTTNYADAVKGRFTISTDNVKKTVYLQMNVLESEDT AVYYCNAVLQTSRWSIPSNYWGQGTQVTVSS
VHH#10C 11 QVQLQDSGGGLVQPGGSLRLACVASGSIFSIDVMGWYRQAPGQQ RELVATITNSWTTNYADSVKGRJFTISRDNAKNWYLQMNSLKLED TAVYYCNARRWYQPEAWGQGTQVTVSS
VHH#4B 12 QVQLQDSGGGLVQPGGSLRLSCAASGFTFSTHWMYWVRQAPGK GLEWVSTINTNGLITDYIHSVKGRFTISRDNAKNTLYLQMNSLKSE DTAVYYCALNQAGLSRGQGTQVTVSS
VHH#10D 13 QVQLQESGGGLVQAGGSLRLSCAASRRTFSGYAMGWFRQAPGKE REFVAWSGTGTIAYYADSVKGRFTISRDNAENTVYLQMNSLKPE DTGLYYCAVGPSSSRWYYRGASLVDYWGKGTLVTVSS
VHH#12B 14 QVQLQESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGK GLEWVSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKS EDTAVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS
VHH#m9A 79 EVQLVESGGGLVQAGGSLRLSCAASGGTLSSYITGWFRQAPGKER EFVGAVSWSSSTIVYADSVEGRFTISRDNHQNTVYLQMDSLKPED TAVYYCAARPYQKYNWASASYNVWGQGTQVTVSS
VHH#m9E 15 EVQLVESGGGLVQAGGSLRLSCAASGGTLSSYITGWFRQAPGKER EFVGAVSWSSSTIVYADSVEGRFTISRDNHQNTVYLQMDSLKPED TAVYYCAARPYQKYNWASASYNVWGQGTQVTVSS
VHH#m3F 16 QVQLQDSGGGLVQAGGSLRLSCAASGGTFSSIIMAWFRQAPGKER EFVGAVSWSGGTTVYADSVLGRFEISRDSARKSVYLQMNSLKPED TAVYYCAARPYQKYNWASASYNVWGQGTQVTVSS
VHH#m4B 80 QVQLQDSGGGLVQAGGSLRLSCGVSGLSFSGYTMGWFRQAPGKE REFAAAIGWNSGTTEYRNSVKGRFTISRDNAKNTVYLQMNSLKPE DTAVYYCAASPKYMTAYERSYDFWGQGTQVTVSS
VHH#8-29 81 QVQLVESGGGLVQPGGSLRLSCAASGFAFGDSWMYWVRQAPGK GLEWVSEINTNGLITKYKDSVTGRFTISRDNAKNTLHLEMNRLKPE DTALYYCARDPSGKLRGPGTQVTVSS
VHH#8-41 82 QVQLVESGGGLVQPGGPLRLSCAASGFAFGDSWMYWVRQAPGK GLEWVSEINTNGLITKYKDSVTGRFTISRDNAKNTLHLEMNRLKPE DTALYYCARDPSGKLRGPGTQVTVSS
VHH#8-42 83 QVQLVESGGGLVQPGGSLRLSCAASGFAFGDSWMYWVRQAPGK GLEWVSEINTNGLITKYKDSVTGRFTISRDNAKNTLHLEMNRLKPE DTALYYCARDPSGKLRGPGTQVTVSS
VHH#8-44 84 QVQLVESGGGLVQPGGSLRLSCAASGFTFSDHWMYWVRQAPGK GLEWVSTINTNGLITNYIHSVKGRFTISRDNAKNTLYLQMNSLKSE DTAVYYCALNQAGLSRGQGTQVTVSS

Таблица 2
Перечень реакций мутагенеза, мутагенных праймеров и матриц, используемых для мутагенеза VHH#12B
Мутация Матрица Последовательность праймера
A74S+Y76N+K83R+P84A Дикий тип 5’-AGA GAC ААС ТСС AAG AAC ACG CTG TAT CTG САА ATG AAC AGC CTG AGA GCT GAG GAC ACG-3’ Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Q1E+Q5L+A7 4S+Y76N+K8 3R+P84A A74S+Y76N+K83R+P84A 5’-C ATG GCT GAG GTG CAG CTG CTC GAG TCT GG-3’ Met Ala Glu Val Gln Leu Leu Glu Ser
Q1E+Q5L+A7 4S+Y76N+K8 3R+P84A+T93A Q1E+Q5L+A7 4S+Y76N+K8 3R+P84A 5’-G GAC ACG GCC GTC TAT TAC TGT GCA AAA GTACTTC-3’ Asp Thr Ala Val Tyr Tyr Cys Ala Lys Val Leu

Таблица 3
Перечень реакций мутагенеза, мутагенных праймеров и матриц, используемых для мутагенеза VYY#3E
Мутация Матрица Последовательность праймера
F37V Дикий тип 5’-АСС ТАТ АСС АТТ GGC TGG GTC CGC CAG GCT-3’ Thr Tyr Thr Ile Gly Trp Val Arg Gln Ala
E44G Дикий тип 5’-CGC CAG GCT CCA GGG AAG GGG CGT GAG TTT-3’ Arg Gln Ala Pro Gly Lys Gly Arg Glu Phe
R45L Дикий тип 5’-A GGG AAG GAG CTT GAG TTT GTA GCG CGT AT-3’ Gly Lys Glu Leu Glu Phe Val Ala Arg
F47W Дикий тип 5’-A GGG AAG GAG CGT GAG TGG GTA GCG CGT AT-3’ Gly Lys Glu Arg Glu Trp Val Ala Arg

Таблица 4
Обзор гуманизированных VHH и VHH дикого типа против TNF-альфа
SEQED Название Последовательность
17 VHH#12B A74S+Y76N+K83R+P84 A QVQLQESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGKGLEWVSTVNTNGLITRYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS
18 VHH#12B Q1E+Q5L+A74S+Y76N+K83R+P84A EVQLLESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGK GLEWVSTVNTNGLITRYADSVKGRFTISRDNSKNTLYLQMNSLR AEDTAVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS
19 VHH#12B Q1E+Q5L+A74S+Y76N+K83R+P84 A+T93A EVQLLESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGK GLEWVSTVNTNGLITRYADSVKGRFTISRDNSKNTLYLQMNSLR AEDTAVYYCAKVLPPYSDDSRTNADWGQGTQVTVSS
20 VHH#12BL Дикий тип QVQLQESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPG KGLEWVSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSL KSEDTAVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS
21 VHH#3E F37V QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWVRQ APGKEREFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTM NNLEPEDTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
22 VHH#3E E44G QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQ APGKGREFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTM NNLEPEDTAVYYCAARDGIPTSRSVESYNYWG QGTQVTVSS
23 VHH#3E R45L QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQ APGKELEFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTM NNLEPEDTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
24 VHH#3E F47W QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQ APGKEREWVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTM NNLEPEDTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
25 VHH#3E Дикий тип QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQ APGKEREFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTM NNLEPEDTAVYYCAARDGEPTSRSVESYNYWGQGTQVTVSS

Таблица 5
VHH против мышиного сывороточного альбумина и против мышиного сывороточного альбумина+против TNF-альфа
Название SEQID Последовательность
Против мышиного сывороточного альбумина
MSA21 26 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGK GVEWVSGISSLGDSTLYADSVKGRFTISRDNAKNTLYLQMNSLK PEDTAVYYCTIGGSLNPGGQGTQVTVSS
MSA24 27 QVQLQESGGGLVQPGNSLRLSCAASGFTFRNFGMSWVRQAPGK EPEWVSSISGSGSNTIYADSVKDRFTISRDNAKSTLYLQMNSLKP EDTAVYYCTIGGSLSRSSQGTQVTVSS
MSA210 28 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVIGRGSPSSOGTQVTVSS
MSA212 29 QVQLQESGGGLVQPGGSLRLTCTASGFTFRSFGMSWVRQAPGK GLEWVSAISADGSDKRYADSVKGRFTISRDNGKKMLTLDMNSL KPEDTAVYYCVIGRGSPASOGTQVTVSS
MSAcl6 85 AVQLVESGGGLVQAGDSLRLSCVVSGTTFSSAAMGWFRQAPGK EREFVGAIKWSGTSTYYTDSVKGRFTISRDNVKNTVYLQMNNLK PEDTGVYTCAADRDRYRDRMGPMTTTDFRFWGQGTQVTVSS
MSAcl12 86 QVKLEESGGGLVQTGGSLRLSCAASGRTFSSFAMGWFRQAPGRE REFVASIGSSGITTNYADSVKGRFTISRDNAKNTVYLQMNSLKPE DTGLCYCAVNRYGIPYRSGTQYQNWGQGTQVTVSS
MSAcl10 87 EVQLEESGGGLVQPGGSLRLSCAASGLTFNDYAMGWYRQAPGK ERDMVATISIGGRTYYADSVKGRFTISRDNAKNTVYLQMNSLKP EDTAIYYCVAHRQTVVRGPYLLWGQGTQVTVSS
MSAcl14 88 QVQLVESGGKLVQAGGSLRLSCAASGRTFSNYAMGWFRQAPGK EREFVAGSGRSNSYNYYSDSVKGRFTISRDNAKNTVYLQMNSLK PEDTAVYYCAASTNLWPRDRNLYAYWGQGTQVTVSS
MSAcl16 89 EVQLVESGGGLVQAGDSLRLSCAASGRSLGIYRMGWFRQVPGK EREFVAAISWSGGTTRYLDSVKGRFTISRDSTKNAVYLQMNSLK PEDTAVYYCAVDSSGRLYWTLSTSYDYWGQGTQVTVSS
MSAc119 90 QVQLVEFGGGLVQAGDSLRLSCAASGRSLGIYKMAWFRQVPGK EREFVAAISWSGGTTRYIDSVKGRFTLSRDNTKNMVYLQMNSLK PDDTAVYYCAVDSSGRLYWTLSTSYDYWGQGTQVTVSS
MSAc15 91 EVQLVESGGGLVQAGGSLSLSCAASGRTFSPYTMGWFRQAPGK EREFLAGVTWSGSSTFYGDSVKGRFTASRDSAKNTVTLEMNSLN PEDTAVYYCAAAYGGGLYRDPRSYDYWGRGTQVTVSS
MScl11 92 AVQLVESGGGLVQAGGSLRLSCAASGFTLDAWPIAWFRQAPGK EREGVSCIRDGTTYYADSVKGRFTISSDNANNTVYLQTNSLKPED TAVYYCAAPSGPATGSSHTFGIYWNLRDDYDNWGQGTQVTVSS
MSAcl15 93 EVQLVESGGGLVQAGGSLRLSCAASGFTFDHYTIGWFRQVPGKE REGVSCISSSDGSTYYADSVKGRFTISSDNAKNTVYLQMNTLEPD DTAVYYCAAGGLLLRVEELQASDYDYWGQGIQVTVSS
MSAc18 94 AVQLVDSGGGLVQPGGSLRLSCTASGFTLDYYAIGWFRQAPGKE REGVACISNSDGSTYYGDSVKGRFTISRDNAKTTVYLQMNSLKP EDTAVYYCATADRHYSASHHPFADFAFNSWGOGTQVTVSS
MSAcl7 95 EVQLVESGGGLVQAGGSLRLSCAAYGLTFWRAAMAWFRRAPG KERELWARNWGDGSTRYADSVKGRFTISRDNAKNTVYLQMNS LKPEDTAVYYCAAVRTYGSATYDIWGQGTQVTVSS
MSAcl20 96 EVQLVESGGGLVQDGGSLRLSCIFSGRTFANYAMGWFRQAPGK EREFVAAINRNGGTTNYADALKGRFTISRDNTKNTAFLQMNSLK PDDTAVYYCAAREWPFSTIPSGWRYWGQGTQVTVSS
MSAcl4 97 DVQLVESGGGWVQPGGSLRLSCAASGPTASSHAIGWFRQAPGK EREFVVGINRGGVTRDYADSVKGRFAVSRDNVKNTVYLQMNRL KPEDSAIYICAARPEYSFTAMSKGDMDYWGKGTLVTVSS
Против мышиного сывороточного альбумина/против TNF-альфа
MSA21/V НН#3Е 30 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGK GVEWVSGISSLGDSTLYADSVKGRFTISRDNAKNTLYLQMNSLK PEDTAVYYCTIGGSLNPGGOGTOVTVSSEPKTPKPOPAAAOVOL QESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGK EREFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLE PEDTAVYYCAARDGEPTSRSVESYNYWGQGTQVTVSS
MSA24/V НН#3Е 31 QVQLQESGGGLVQPGNSLRLSCAASGFTFRNFGMSWVRQAPGK EPEWVSSISGSGSNTIYADSVKDRFTISRDNAKSTLYLQMNSLKP EDTAVYYCTIGGSLSRSSOGTOVTVSSEPKTPKPOPAAAOVOLOE SGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKER EFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLEPE DTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
MSA210/ VHH#3E 32 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVTGRGSPSSOGTOVTVSSEPKTPKPOPAAAOVOLO ESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKE REFVARJYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLEP EDTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
MSA212/ VHH#3E 33 QVQLQESGGGLVQPGGSLRLTCTASGFTFRSFGMSWVRQAPGK GLEWVSAISADGSDKRYADSVKGRFTISRDNGKKMLTLDMNSL KPEDTAVYYCVIGRGSPASOGTOVTVSSEPKTPKPOPAAAOVOL QESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGK EREFVARTYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLE PEDTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
MSA21/ MSA21/V НН#ЗЕ 34 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGK GVEWVSGISSLGDSTLYADSVKGRJFTISRDNAKNTLYLQMNSLK PEDTAVYYCTIGGSLNPGGQGTQVTVSSEPKTPKPQPAAAQVQL QESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGKGVEW VSGISSLGDSTLYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTA VYYCTIGGSLNPGGQGTQVTVSSEPKTPKPQPAAAQVQLQESGG GLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKEREFV ARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLEPEDTA VYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
MSA210/ VHH#1A 35 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVIGRGSPSSOGTOVTVSSEPKTPKPOPAAAOVOLO ESGGGLVQPGGSLRLSCATSGFDFSVSWMYWVRQAPGKGLEW VSEINTNGLITKYVDSVKGRFTISRDNAKNTLYLQMDSLIPEDTA LYYCARSPSGSFRGQGTQVTVSS
MSA210/ VHH#7B 36 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVIGRGSPSSQGTOVTVSSEPKTPKPOPAAAOVOLO ESGGGLVQPGGSLRLSCAASGSIFRVNAMGWYRQVPGNQREFV AIITSGDNLNYADAVKGRFTISTDNVKKTVYLQMNVLKPEDTAV YYCNAILQTSRWSIPSNYWGQGTQVTVSS
MSA210/ VHH#2B 37 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVIGRGSPSSQGTQVTVSSEPKTPKPQPAAAQVQLQ ESGGGLVQPGGSLRLSCATSGFTFSDYWMYWVRQAPGKGLEW VSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKSEDT AVYYCTKWPPYSDDSRTNADWGQGTQVTVSS
MSA210/ VHH#3E 38 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVIGRGSPSSQGTQVTVSSEPKTPKPQPAAAQVQLQ ESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKE REFVARTYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLEP EDTAVYYCAARDGIPTSRSVESYNYWGQGTQVTVSS
MSA210/ VHH#3G 39 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVIGRGSPSSQGTQVTVSSEPKTPKPQPAAAQVQLQ DSGGGLVQAGGSLRLSCAVSGRTFSAHSVYTMGWFRQAPGKER EFVARIYWSSANTYYADSVKGRFTISRDNAKNTVDLLMNSLKPE DTAVYYCAARDGIPTSRTVGSYNYWGQGTQVTVSS
MSA21/V HH#12B 40 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGK GVEWVSGISSLGDSTLYADSVKGRFTISRDNAKNTLYLQMNSLK PEDTAVYYCTIGGSLNPGGQGTQVTVSSEPKTPKPQPAAAQVQL QESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGKGLE WVSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKSED TAVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS
MSA24/ VHH#12В 41 QVQLQESGGGLVQPGNSLRLSCAASGFTFRNFGMSWVRQAPGK EPEWVSSISGSGSNTIYADSVKDRFTISRDNAKSTLYLQMNSLKP RDTAVYYCTIGGSLSRSSOGTOVTVSSEPKTPKPOPAAAOVOLOE SGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGKGLEWV STVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKSEDTA VYYCTKVLPPYSDDSRTNADWGQGTQVTVSS
MSA210/ VHH#12В 42 QVQLQESGGGLVQPGGSLRLTCTASGFTFSSFGMSWVRQAPGK GLEWVSAISSDSGTKNYADSVKGRFTISRDNAKKMLFLQMNSLR PEDTAVYYCVIGRGSPSSOGTOVTVSSEPKTPKPOPAAAOVOLO ESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGKGLEW VSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKSEDT AVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS
MSA212/ VHH#12В 43 QVQLQESGGGLVQPGGSLRLTCTASGFTFRSFGMSWVRQAPGK GLEWVSAISADGSDKRYADSVKGRFTISRDNGKKMLTLDMNSL KPEDTAVYYCVIGRGSPASOGTOVTVSSEPKTPKPOPAAAOVQL QESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGKGLE WVSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKSED TAVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS

Таблица 6
Список аминокислотных последовательностей VHH, направленных против человеческого IFN-гамма
Семейство послед. Название Seq. Id Последовательность
1 MP3D2SRA 44 QVQLQDSGGGTVQAGGSLRLSCAASGRTFSDYAVG WFRQAPGKEREFVARILWTGASRSYANSVDGRFTVS TDNAKNTVYLQMNSLKPEDTAIYYCAALPSNIITTDY LRVYYWGQGTQVTVSS
1 MP3A3SR 45 QVQLQDSGGGTVQAGGSLRLSCAASGRTFSNYAVG WFRQAPGKEREFVARIKWSGGSRSYANSVDGRFTVS TDNAKNTVYLQMNSLKPEDTAIYYCA?LPSNIITTDY LRVYYWGQGTQVTVSS
2 MP3C5SR 46 QVQLQESGGGLVQAGGSLRLSCAAAGISGSVFSRTP MGWYRQAPGKQRELVAGILTSGATSYAESVKGRFTI SRDNAKNTVYLQMNSLSPEDTAEYYCNTYPTWVLS WGQGTQVTVSS
2 MP3C1SR 47 QVQLQDSGGGLVQAGGSLRLSCAAAGISGSVFSRTP MGWYRQAPGKQRELVAGILSSGATVYAESVKGRFTI SRDNAKNTVYLQMNSLSPEDTAEYYCNTYPTWVLS WGQGTQVTVSS
2 MP3G8SR 48 QVQLQESGGGLVQAGGSLRLSCAAAGISGSVFSRTP MGWYRQAPGKQRELVAGILSSGATAYAESVKGRFTI SRDNAKNTVYLQMNSLSPEDTAEYYCNTYPTWVLS WGOGTOVTVSS
3 MP3D2BR 49 QVQLQESGGGLVQPGESLRLSCAASRGIFRFNAGGW YRQAPGKQRELVAFIGVDNTTRYIDSVKGRFTISRDN AKTTVYLQMNSLQPEDTAVYYCNKVPYIDWGQGTQVTVSS
4 MP3H6SRA 50 QVQLQESGGGLVQAGGSLRLSCAASGRTFSTYNMG WFRQAPGKEREFVAGISWNGGSIYYTSSVEGRFTISR DNAENTVYLQMNSLKPEDTGVYYCASKGRPYGVPS PRQGDYDYWGQGTQVTVS S
4 MP3B4SRA 51 QVQLQESGGGLVQAGGSLRLSCAASGRTFSTYNMG WFRQAPGKEREFVAGISWNGGSIYYTSSVEGRFTISR DNAENTVYLQMNSLKPEDTGVYYCASKGRPYGVPS PRQGDYDYWGQGTQVTVSS
4 MP4E4BR 52 QVQLQESGGGLVQAGGSLRLSCAASGRTFSIYNMG WFRQAPGKEREFVAAISWNGGSIYYTSSVEGRFTISR DNAINTVYLQMNSLKPEDTGVYYCASKGRPYGVPSP RQGEYDYWGQGTQVTVSS
4 MP4H8SR 53 QVQLQESGGGLVQAGGSLRLSCAASGRTFNIYNMG WFRQAPGKERDFVAAISWNGGSIYYTSSVEGRFTISR DNAENTVYLQMNSLKPEDTGVYYCASKGRPYGVPS PRQGDYDYWGQGTQVTVSS
5 MP2F6SR 54 QVKLEESGGGLVQAGGSLRLSCAASGRTFNNYNMG WFRQAPGKEREFVAAISWNGGSTYYDDSVKGRFTIS RDNANNLVYLQMNSLNFEDTAVYYCACAANPYGEP QYRENRYDFWGQGTQVTVSS
5 MP3D1BR 55 QVQLQESGGGLVQAGGSLRLSCAASGRTFDNYNMG WFRQAPGKEREFVAAISWNGGSTYYDDSVKGRFTIS RDNFQKLVYLQMNSLKLEDTAVYYCACAANPYGIP QYRENRYDFWGQGTQVTVSS
6 MP2B5BR 56 QVQLVESGGRLVQAGGSLRLSCIASGRTISDYAAGW FRQAPGKEREFLASVTWGFGSTSYADSVKGRFTISRD KAKDTVYLQMNTLEPDDTSVYYCASSPRYCAGYRC YVTASEFDSWGQGTQVTVSS
6 MP2C1BR 57 QVKLEESGGRLVQAGGSLRLSCIASGRTISDYAAGW FRQAPGKEREFLASVSWGFGSTYYADSVKGRFTISRD TAKDTVYLQMNTLEPDDTSVYYCASSPRYCAGYRC YATASEFDSWGQGTQVTVSS
6 MP4A12SR 58 QVQLQESGGRLVQAGGSLRLSCIASGRTISDYAAGW FRQAPGKEREFLASVTWGFGSTYYADSVKGRFTISR DKAKDTVYLQMNTLEPDDTSAYYCASSPRYCAGYR CYVTASEFDSWGPGTQVTVSS
7 MP3F4SRA 59 QVQLQDSGGGLVQAGDSLRLSCAASGRSFSSYGMG WFRQAPGKEHEFVAGIWRSGVSLYYTDSVKGRFTIS RDDAKMTVSLQMNSLKPEDTAVYYCAAEATFPTWS RGRFADYDYRGQGTQVTVSS
7 MP3D3BR 60 QVQLQESGGGLVQAGDSLRLSCTASGRSFSSYGMG WFRQAPGKDHEFVAGIWRSGVSLYYADSVKGRFTIS RDDAKMTVSLQMNGLKPEDTAVYYCAAEATFPTW NRGTFADYDYRGQGTQ VTVSS
7 MP3E5BR 61 QVQLQESGGGLVQAGDSLRLSCAASGRSFSSYGMG WFRQAPGKEHEFVAGIWRSGVSLYYADSVKGRFTIS RDDAKMTVSLQMNGLKPEDTAVYYCAAEATFPTW NRGSFADYDYRGQGTQVTVSS
7 MP3C7SRA 62 QVQLQESGGGLVQAGDSLRLSCAASGRSFSSYGMG WFRQAPGKEHEFVAGIWRSGVSLYYADSVKGRFTIS RDDAKMTVSLQMNSLKPEDTAVYYCAAEATFPTWN RGRFADYDYSGOGTOVTVSS
8 MP2F1BR 63 AVQLVESGGGLVQTGDSLRLSCVASGGTFSRYAMG WFRQAPGKEREFVARIGYSGRSISYATSVEGRFAISR DNAKNTVYLQMNSLKPEDTAVYYCASLVSGTLYQA DYWGQGTQVTVSS
8 MP2C5BR 64 QVQLVESGGGLVQTGDSLRLSCVASGGTFSRYAMG WFRQPPGKERDFVARIGYSGQSISYATSVEGRFAISR DNAKNTVYLQMNSLKPEDTAVYYCASLVSGTLYKP NYWGOGTOVTVSS
9 MP2C10BR 65 QVKLEESGGGLVQAGGSLRLSCAASGLTYTVGWFR QAPGKEREFVAAISWSGGSALYADSVKGRFTISRDN AKNTVYLQMGSLEPEDTAYYSCAAPGTRYYGSNQV NYNYWGQGTQVTVS S
9 MP2G5SR 66 QVKLEESGGGLVQAGDSLRLSCAASGLTYTVGWFR QAPGKEREFVAAIDWSGGSALYADSVKGRFTISRDN TKNTVYLQMGSLEPEDTAVYWCAAPGTRYHGRNQV NYNYWGQGTQVTVSS
10 MP3B1SRA 67 QVQLQESGGGLVQPGGSLRLSCAASGFTSSNYAMSW VRQAPGKGLEWVSSINSRTGSITYADSVKGRFTITLD NAKNTLYLQMNSLKPEDTAVYYCASRVDDRVSRGQ GTQVTVSS
11 MP2F10SR 68 QVQLVESGGGLVQAGGSLRLSCAASGRTISSFRMGW FRRAPGEEREFVAFVRSNGTSTYYADSVEGRFTITRD NAKNTVYLRMDSLKPEDTAVYYCAAATRDYGGSFD YWGQGTQVTVSS
11 MP3A7SRA 69 QVQLQDSGGGLVQAGGSLRLSCAASGRTFSSFRMG WFRRAPGEEREFVAFVRSNGTSTYYADSVEGRFTITR DNAKNTVYLRMDSLKPEDTAVYYCAAATRDYGGSF DYWGQGTQVIVSS
12 MP4C10SR 70 QVQLQESGGGLVQPGGSLRLSCAASGFTVSNYAMS WVRQPPGKGIEWVSSINNRNDHITYADSVKGRFTIAR DNANNILYLQMNSLKPEDTAVYYCASRVDDRVSRG QGTQVTVSS
13 MP4D5BR 71 QVQLQDSGGGLVQPGGSLRLSCAASGRTFSSYGMA WFRQAPGKERELWAINRSGGATSYATSVRGRFTISR DNAKNTMYLQMNSLNPEDTAVYYCAARDPTRTYSS YFEYTYWGQGTQVTVSS
14 MP3F1SRA 72 QVQLQESGGGLVQAGGSLTLSCVASGRTISDYAVGW FRQAPGKEREFVASISWGGGFTAFADSMKGRFTISRD NAKNTVYLQTHTLEPDDTSVYYCASSRRYCTGYRCY ATASEFDSWGQGTQVTVSS

Таблица 7
Последовательности двухвалентного (BIV 3Е, BIV#m3F), трехвалентного (TRI3E) или четырехвалентного (ТЕТКА 3Е) VHH, направленных против TNF-альфа
Название SEQ ID Последовательность
С линкерной последовательностью (подчеркнута)
BIV 3Е 73 QVQLQDSGGGLVQAGGSLRLSCAASGGTFSSIIMAWFRQAPGKEREFVGA VSWSGGTTVYADSVLGRFEISRDSARKSVYLQMNSLKPEDTAVYYCAARP YQKYNWASASYNVWGQGTQVTVSSEPKTPKPOPAAAQVQLQDSGGGLV
QAGGSLRLSCAASGGTFSSIIMAWFRQAPGKEREFVGAVSWSGGTTVYAD SVLGRFEISRDSARKSVYLQMNSLKPEDTAVYYCAARPYQKYNWASASY NVWGQGTQVTVSS
TRI 3Е 74 QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKER EFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLEPEDTAVYY CAARDGIPTSRSVESYNYWGOGTOVTVSSEPKTPKPOPAAAOVOLOESGG GLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKEREFVARIYWSS GNTYYADSVKGRFAISRDIAKNTVDLTMNNLEPEDTAVYYCAARDGIPTS RSVESYNYWGOGTOVTVSSEPKTPKPOPAAAOVOLOESGGGLVOPGGSL RLSCAASGRTFSDHSGYTYTIGWFRQAPGKEREFVARIYWSSGNTYYADS VKGRFAISRDIAKNTVDLTMNNLEPEDTAVYYCAARDGEPTSRSVESYNY WGOGTOVTVSS
TETRA 3Е 75 QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKER EFVARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLEPEDTAVYY CAARDGIPTSRSVESYNYWGOGTOVTVSSEPKTPKPOPAAAOVOLOESGG GLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPGKEREFVARIYWSS GNTYYADSVKGRFAISRDIAKNTVDLTMNNLEPEDTAVYYCAARDGEPTS RSVESYNYWGOGTOVTVSSEPKTPKPOPAAAOVOLOESGGGLVOPGGSL RLSCAASGRTFSDHSGYTYTIGWFRQAPGKEREFVARIYWSSGNTYYADS VKGRFAISRDIAKNTVDLTMNNLEPEDTAVYYCAARDGBPTSRSVESYNY WGOGTOVTVSSEPKTPKPOPAAAOVOLOESGGGLVOPGGSLRLSCAASG RTFSDHSGYTYTIGWFRQAPGKEREFVARIYWSSGNTYYADSVKGRFAISR DIAKNTVDLTMNNLEPEDTAVYYCAARDGEPTSRSVESYNYWGQGTQVT VSS
ВР/#m3F 76 QVQLQDSGGGLVQAGGSLRLSCAASGGTFSSIIMAWFRQAPGKEREFVGA VSWSGGTTVYADSVLGRFEISRDSARKSVYLQMNSLKPEDTAVYYCAARP YOKYNWASASYNVWGOGTOVTVSSEPKTPKPOPAAAOVOLODSGGGLV QAGGSLRLSCAASGGTFSSIIMAWFRQAPGKEREFVGAVSWSGGTTVYAD SVLGRFEISRDSARKSVYLQMNSLKPEDTAVYYCAARPYQKYNWASASY NVWGQGTQVTVSS
Без линкерной последовательности
ВР/#3Edir 77 QVQLQDSGGGLVQAGGSLRLSCAASGGTFSSIIMAWFRQAPGKEREFVGA VSWSGGTTVYADSVLGRFEISRDSARKSVYLQMNSLKPEDTAVYYCAARP YQKYNWASASYNVWGQGTQVTVSSQVQLQDSGGGLVQAGGSLRLSCAA SGGTFSSIIMAWFRQAPGKEREFVGAVSWSGGTTVYADSVLGRFEISRDSA RKSVYLQMNSLKPEDTAVYYCAARPYQKYNWASASYNVWGQGTQVTVS S
BIV#1 2Bdir 78 QVQLQESGGGLVQPGGSLRLSCAASGFEFENHWMYWVRQAPGKGLEWV STVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKSEDTAVYYCTK VLPPYSDDSRTNADWGQGTQVTVSSQVQLQESGGGLVQPGGSLRLSCAA SGFEFENHWMYWVRQAPGKGLEWVSTVNTNGLITRYADSVKGRFTISRDNAKYTLYLQMNSLKSEDTAVYYCTKVLPPYSDDSRTNADWGQGTQVTVSS

Таблица 8
Парциальная гомология между аминокислотными последовательностями VHH против мышиного сывороточного альбумина по изобретению
SEQ MSA21 MSA24 MSA210 MSA212
MSA21 1.000 0.834 0.800 0.782
MSA24 - 1.000 0.782 0.791
MSA210 - - 1.000 0.903
MSA212 - - - 1.000

Таблица 11
Схема обработки
Группа Животные Описание Схема приема
1 8 отрицательный контроль 1, внутрибрюшинно ежедневно 100 мкл PBS, внутрибрюшинно+
2 8 отрицательный контроль 2, ректально через день 100 мкл PBS ректально в течение 2 недель
3 8 отрицательный контроль 3, внутрижелудочно ежедневно 100 мкл PBS внутрижелудочно в течение 14 дней подряд
4 8 положительный контроль 1, дексаметазон 5 мкг внутрибрюшинно в течение 7 дней подряд
5 8 положительный контроль 2, L. lactis, экспрессирующие IL10 применяют перорально один раз в день в течение 14 дней подряд
6 8 двухвалентное VHH 3F, внутрижелудочно ежедневно 100 мкг двухвалентного VHH 3F2 внутрижелудочно в течение 14 дней подряд
7 8 двухвалентное VHH 3F, внутрибрюшинно ежедневно 100 мкг двухвалентного VHH 3F внутрибрюшинно в течение 14 дней подряд
8 8 двухвалентное VHH 3F, ректально 100 мкг двухвалентного VHH 3F ректально в 100 мкл PBS через день в течение двух недель

1. Полипептидная конструкция, способная специфически связывать TNF-альфа, для лечения, профилактики или облегчения протекания расстройств, которые чувствительны к модуляции веществом, модулирующим TNF-альфа, и связаны с воспалительными процессами или аутоиммунными заболеваниями, содержащая

два-четыре антагонистических однодоменных антитела, направленных против TNF-альфа, полученных способом, включающим стадию отбора на основании определения антагонистического эффекта с использованием анализа цитотоксичности и по крайней мере IC50 ~ 100 нМ, и

одно однодоменное антитело, направленное против сывороточного белка,

в которой указанные два-четыре однодоменных антитела анти-TNF не имеют одинаковую последовательность или все однодоменные антитела анти-TNF имеют одинаковую последовательность.

2. Полипептидная конструкция по п.1, в которой по меньшей мере одно однодоменное антитело представляет собой антитело VHH Camelidae.

3. Полипептидная конструкция по п.1, в которой по меньшей мере одно однодоменное антитело представляет собой гуманизированное антитело VHH Camelidae.

4. Полипептидная конструкция по п.2, в которой по меньшей мере одно однодоменное антитело представляет собой гуманизированное антитело VHH Camelidae.

5. Полипептидная конструкция по п.1, в которой указанный сывороточный белок представляет собой любой белок из числа сывороточного альбумина, сывороточных иммуноглобулинов, тироксинсвязывающего белка, транферрина или фибриногена или фрагмента любого из них.

6. Полипептидная конструкция по п.2, в которой указанный сывороточный белок представляет собой любой белок из числа сывороточного альбумина, сывороточных иммуноглобулинов, тироксинсвязывающего белка, транферрина или фибриногена или фрагмента любого из них.

7. Полипептидная конструкция по п.3, в которой указанный сывороточный белок представляет собой любой белок из числа сывороточного альбумина, сывороточных иммуноглобулинов, тироксинсвязывающего белка, транферрина или фибриногена или фрагмента любого из них.

8. Полипептидная конструкция по п.4, в которой указанный сывороточный белок представляет собой любой белок из числа сывороточного альбумина, сывороточных иммуноглобулинов, тироксинсвязывающего белка, транферрина или фибриногена или фрагмента любого из них.

9. Полипептидная конструкция по любому из пп.1-8, в которой указанный сывороточный белок представляет собой сывороточный альбумин.

10. Композиция, содержащая полипептидную конструкцию по любому из пп.1-9 и фармацевтически приемлемый носитель, для лечения, профилактики или облегчения протекания расстройств, которые чувствительны к модуляции веществом, модулирующим TNF-альфа, и связаны с воспалительными процессами и аутоиммунными заболеваниями.

11. Нуклеиновая кислота, кодирующая полипептидную конструкцию, которая способна связывать TNF-альфа, согласно любому из пп.1-9, где полипептидная конструкция, которая способна связывать TNF-альфа, имеет последовательность, выбранную из любой из последовательностей SEQ ID NO: 30-43.

12. Полипептидная конструкция по п.1, в которой

(I) однодоменные антитела, направленные против TNF-альфа, содержат аминокислотные последовательности, выбранные из (a) последовательностей SEQ ID NO: 1-5 и 14 и (b) последовательности, которая более чем на 85% идентична любой последовательности из SEQ ID NO: 1-5 и 14; и/или

(II) однодоменное антитело, направленное против сывороточного белка, содержит последовательность, выбранную из SEQ ID NO: 26-29 и 85-97.



 

Похожие патенты:

Изобретение относится к иммунологии. Предложено неконкурентное в отношении нейрегулина (NRG) аллостерическое антитело против человеческого HER3 и его фрагмент, а также кодирующая нуклеиновая кислота, вектор, клетка-хозяин, фармацевтическая композиция и способ лечения рака.

Настоящее изобретение относится к иммунологии. Предложено антитело, селективно связывающееся с кадгерином-17 человека, его антигенсвязывающий фрагмент (Fab) и вариабельные домены указанного антитела.

Изобретение относится к области биохимии, в частности к антителу, которое специфически связывается с PD-1 (белок 1 программируемой клеточной гибели). Также раскрыта выделенная клеточная линия и клетка-хозяин, продуцирующие указанное антитело; нуклеиновая кислота, кодирующая указанное антитело; экспрессионный вектор; фармацевтическая композиция и набор, содержащие указанное антитело.

Настоящее изобретение относится к иммунологии. Предложено антитело, способное связываться с белком бета-клото человека, и его антигенсвязывающий фрагмент.

Изобретение относится к иммунологии и биотехнологии. Предложено рекомбинантное антитело против С5, содержащее вариант Fc нативного полипептида Fc IgG1 дикого типа, где указанный вариант включает 428L/434S/259I, а нумерация приведена согласно индексу EU.

Изобретение относится к области биохимии. Описана группа изобретений, включающая в себя выделенное антитело или его функциональный фрагмент, которое связывается с сиалированным антигеном Льюисаa, выделенный полинуклеотид, кодирующий тяжелую цепь вышеуказанного антитела или его функционального фрагмента, выделенный полинуклеотид, кодирующий легкую цепь вышеуказанного антитела или его функционального фрагмента, конъюгат, который связывается с сиалированным антигеном Льюисаа, содержащий вышеуказанное антитело или его функциональный фрагмент, фармацевтическую композицию для лечения заболевания, способ лечения или профилактики заболевания, где указанным заболеванием является злокачественное или опухолевое образование с клетками, экспрессирующими сиалированный антиген Льюисаа, и способ обнаружения опухоли у пациента, включающий введение вышеуказанного конъюгата.

Изобретение относится к области биохимии, в частности к композиции для лечения рака, где рак включает солидную опухоль, которая сверхэкспрессирует FGFR2IIIb. Также раскрыты афукозилированное антитело к FGFR2IIIb, клетка-хозяин, для экспрессии указанного антитела.

Изобретение относится к биотехнологии. Описана иммуносвязывающая молекула, содержащая: CDR1, CDR2 и CDR3 легкой цепи от донорной иммуносвязывающей молекулы зайцеобразного и CDR1, CDR2 и CDR3 тяжелой цепи от донорной иммуносвязывающей молекулы зайцеобразного; каркас вариабельной области легкой цепи человека и каркас вариабельной области тяжелой цепи человека, который по меньшей мере на 85% идентичен последовательности SEQ ID NO: 4 и содержит треонин (T) в положении 24 (нумерация AHo).

Настоящая группа изобретений относится к области биотехнологии. Предложено гуманизированное анти-CD79b антитело.

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий объект, способные к специфическому связыванию с участком бета-цепи семейства TRBV9 Т-клеточного рецептора человека.

Изобретение относится к иммунологии. Предложено неконкурентное в отношении нейрегулина (NRG) аллостерическое антитело против человеческого HER3 и его фрагмент, а также кодирующая нуклеиновая кислота, вектор, клетка-хозяин, фармацевтическая композиция и способ лечения рака.
Изобретение относится к органическому синтезу, а именно к получению D-изоглутамил-D или L-триптофана в форме мононатриевой соли. Способ включает стадии синтеза оксазолидинона карбобензокси-D-глутаминовой кислоты, его конденсации с метиловым эфиром триптофана, удаления карбобензокси защиты с раскрытием оксалидинонового кольца с помощью каталитического гидрогенолиза и щелочного омыления метилового эфира с получением мононатриевой соли дипептида, отличается тем, что на стадии синтеза оксазолидинона карбобензокси-D-глутаминовой кислоты используют промывку водным раствором солянокислого гидроксиламина, а стадию удаления карбобензокси защиты с одновременным раскрытием оксалидинонового кольца проводят путем каталитического гидрогенолиза над палладиевым катализатором при использовании муравьиной кислоты в качестве донора водорода и анилина, взятого в количестве от 2 до 4 эквивалентов по отношению к количеству защищенного дипептида.

Настоящее изобретение относится к иммунологии. Предложено антитело, селективно связывающееся с кадгерином-17 человека, его антигенсвязывающий фрагмент (Fab) и вариабельные домены указанного антитела.

Изобретение относится к области медицинской биотехнологии. Описан препарат α1-антитрипсина, стимулирующий образование ретикулоцитов, где указанный препарат α1-антитрипсина содержит пептидные фрагменты в качестве компонентов, отличающийся тем, что указанные пептидные фрагменты являются фрагментами предшественника α1-антитрипсина, где указанный предшественник α1-антитрипсина имеет 418 аминокислотных остатков.

Изобретение относится к области биотехнологии, конкретно к получению антибактериальных рекомбинантных белков, и может быть использовано в медицине в качестве антибактериальной композиции, проявляющей активность в отношении грамотрицательных бактерий Pseudomonas aeruginosa.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая способ лечения злокачественных новообразований, содержащих опухолевые стволовые клетки (ОСК), где указанный способ включает введение пациенту эффективного количества антитела или его антиген-связывающего фрагмента, специфически связывающегося с О-ацетилированным GD2 ганглиозидом, фармацевтическую композицию для лечения злокачественных новообразований, способ in vitro диагностики злокачественного новообразования, применение О-ацетилированного GD2 ганглиозида в качестве биомаркера злокачественного новообразования, способ прогнозирования ответа пациента, имеющего злокачественное новообразование.

Изобретение относится к области биотехнологии, конкретно к получению Fc-связывающих полипептидов с улучшенной щелочной стабильностью, содержащих мутант Fc-связывающего домена белка A Staphylococcus (SpA), выбранного из группы, состоящей из SEQ ID NO: 8-20, 23-28 и 30-48.

Настоящее изобретение относится к иммунологии. Предложено антитело, способное связываться с белком бета-клото человека, и его антигенсвязывающий фрагмент.

Группа изобретений относится к улучшенному способу биохимического извлечения конъюгата на основе IL-15/IL-15Rα в мономерной форме и фармацевтической композиции, включающей эффективное количество композиции, содержащей мономерные конъюгаты IL-15/IL-15Rα.

Изобретение относится к иммунологии и биотехнологии. Предложено рекомбинантное антитело против С5, содержащее вариант Fc нативного полипептида Fc IgG1 дикого типа, где указанный вариант включает 428L/434S/259I, а нумерация приведена согласно индексу EU.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая линкерное звено, содержащее центральную сердцевину, связывающие ветви и, необязательно, соединяющую ветвь (варианты).

Настоящее изобретение относится к иммунологии. Предложена полипептидная конструкция, способная специфически связывать фактор некроза опухолей альфа, содержащая два-четыре антагонистических однодоменных антитела, направленных против TNF-альфа, и одно однодоменное антитело, направленное против сывороточного белка. Кроме того, рассмотрена содержащая ее композиция и кодирующая нуклеиновая кислота. Данное изобретение может найти применение в терапии расстройств, связанных с воспалительными процессами или аутоиммунными заболеваниями. 3 н. и 9 з.п. ф-лы, 18 ил., 11 табл., 9 пр.

Наверх