Связывающие элементы к фно-альфа

Авторы патента:

C07K2317/24 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Изобретение относится к биотехнологии. Описан связывающий элемент, обладающий специфичностью связывания к ФНО-альфа, включающий:

(i) вариабельные последовательности CDR-H1, CDR-H2 и CDR-H3 тяжелой цепи, представленные в SEQ ID No: 6, 7 и 8; и (ii) вариабельные последовательности CDR-L1, CDR-L2 и CDR-L3 легкой цепи, представленные в SEQ ID No: 3, 4 и 5. Также представлена выделенная молекула нуклеиновой кислоты, включающая последовательность, кодирующую связывающий элемент. Представлен способ получений указанного связывающего элемента. Кроме того, представлен соответствующий вектор экспрессии и клетка-хозяин, композиции. Изобретение может использоваться в лечении воспалительных и других заболеваний, а также в диагностике. Представлен способ лечения заболевания, опосредованного ФНО-альфа и способ обнаружения присутствия ФНО-альфа в биологическом образце. 14 н. и 22 з.п. ф-лы, 4 ил., 4 табл., 9 пр.

 

Перекрестная ссылка на родственные заявки

[0001] По настоящей заявке испрашивается приоритет европейской заявки на патент EP 14 001 123, поданной 26 марта 2014 года в Европейское патентное ведомство. Содержание европейской заявки на патент EP 14 001 123 полностью включено в настоящую заявку посредством отсылки во всех отношениях, включая все таблицы, чертежи и пункты формулы, а также включая любой элемент или часть описания, формулы или чертежей, не содержащихся в настоящей заявке и указанных в Правиле 20.5 (a) PCT, в соответствии с Правилом 4.18 PCT.

Ссылка на список последовательностей

[002] Настоящая заявка включает список последовательностей.

Область техники, к которой относится изобретение

[003] Изобретение относится к связывающему элементу против ФНО-альфа, такому как гуманизированная связывающая молекула, в особенности моновалентному, высокоактивному и стабильному реагенту против ФНО-альфа, такому как фрагмент антитела, пригодный для терапевтического и диагностического применения. Связывающий элемент в некоторых вариантах осуществления является иммуноглобулином, его фрагментом или белковой связывающей молекулой с иммуноглобулиноподобными функциями, специфичными к ФНО-альфа. Изобретение также относится к молекуле нуклеиновой кислоты, кодирующей такой связывающий элемент, вектору, содержащему последовательность соответствующей молекулы нуклеиновой кислоты, клетке-хозяину, содержащей вектор или последовательность нуклеиновой кислоты соответствующей молекулы нуклеиновой кислоты, фармацевтической и диагностической композиции, содержащей связывающий элемент или молекулу нуклеиновой кислоты, а также их применению.

УРОВЕНЬ ТЕХНИКИ

[004] Следующее описание уровня техники представлено просто для помощи читателю в понимании изобретения и не должно описывать или составлять предшествующий уровень техники по отношению к настоящему изобретению.

[005] Фактор некроза опухоли (ФНО) альфа является мощным провоспалительным цитокином, который играет важную роль в иммунных ответах и при воспалительных нарушениях. Он был описан в качестве ключевого медиатора воспалительных, иммунологических и патофизиологических реакций. Секретируемый в основном моноцитами и активированными макрофагами, ФНО-альфа также продуцируют многие другие типы клеток, включая фибробласты, нейтрофилы, эозинофилы и эпителиальные клетки.

[006] Также называемый кахектином, ФНО-альфа существует в двух биологически активных формах: трансмембранной и растворимой формах. Растворимая форма ФНО-альфа отщепляется от трансмембранного ФНО-альфа (тмФНО-альфа) в результате протеолитического расщепления. Обе формы ФНО-альфа являются биологически активными тримерами, связывают рецепторы ФНО и проявляют различные биологические функции, обеспечивая защиту организма. Кроме того, трансмембранный и растворимый ФНО-альфа играют роль в патогенезе воспалительных и аутоиммунных заболеваний.

[007] Были идентифицированы два рецептора ФНО-альфа (ФНО-Р1 и -Р2), опосредующие плеотропные эффекты ФНО-альфа. Эти рецепторы экспрессируются на различных клетках, главным образом на моноцитах и макрофагах. Активация рецептора производит различные биологические эффекты, включая продукцию провоспалительных цитокинов, таких как IL-1, ФНО-альфа, IL-6, IL-8; продукцию хемокинов; активацию нейтрофилов; увеличение проницаемости слоя эндотелия; и экспрессию молекул адгезии. Таким образом, большое количество заболеваний связано с повышенными уровнями ФНО-альфа и, следовательно, ингибиторы ФНО-альфа нашли вполне достойное применение в лечении. Важным подклассом постоянно растущего числа ингибиторов ФНО-альфа являются биологические лекарственные средства. Ряд биологических ингибиторов ФНО-альфа получили одобрение контролирующих органов и доступны на рынке. Одной из групп таких биологических ингибиторов являются полноразмерные иммуноглобулины. Например, инфликсимаб (Ремикейд®), химерный IgG массой приблизительно 150 кДа, был одобрен для лечения болезни Крона, ревматоидного артрита, псориатического артрита, неспецифического язвенного колита, анкилозирующего спондилита, псориаза и болезни Бехчета. Адалимумаб (Хумира®), IgG1 массой приблизительно 150 кДа, одобрен при ревматоидном артрите, ювенильном ревматоидном артрите, болезни Крона, псориатическом артрите, псориазе, анкилозирующем спондилите, неспецифическом язвенном колите и болезни Бехчета. Наконец, голимумаб (Симпони®), человеческий IgG1 молекулярной массой приблизительно 150 кДа, одобрен при ревматоидном артрите, псориатическом артрите, анкилозирующем спондилите и неспецифическом язвенном колите.

[008] Впрочем, некоторые одобренные биологические ингибиторы ФНО-альфа отличаются от структуры полноразмерного иммуноглобулина. Например, этанерцепт (Энбрел®) является слитым белком из 2 внеклеточных доменов рецептора ФНО и Fc-фрагмента с молекулярной массой 150 кДа, который была одобрен для лечения ревматоидного артрита, ювенильного ревматоидного артрита, псориатического артрита, псориаза и анкилозирующего спондилита. Кроме того, цертолизумаба пегол (Симзия®), гуманизированный Fab-ПЭГ конъюгат массой приблизительно 90 кДа, одобрен и широко применяется при лечении болезни Крона и ревматоидного артрита.

[009] Несмотря на успехи в данной области, сохраняется потребность в биопрепаратах с оптимальной комбинацией биофизических свойств. Например, наружное лечение кожных заболеваний, то есть наружное применение ингибиторов ФНО-альфа на коже, может быть наиболее предпочтительным путем применения, поскольку можно избежать побочного действия системной терапии. Однако до настоящего времени такая терапия не была возможна, в том числе потому, что одобренные для применения в настоящее время иммунотерапевтические средства имеют слишком большой размер и, следовательно, не могут проходить через роговой слой кожи, и/или из-за издержек производства лекарственных средств.

[010] Точно установлена ключевая роль ФНО-альфа при псориазе и псориатическом артрите (см., например, CORDORO, KM and FLEDMAN SR. TNF-alpha inhibitors in dermatology. Skin Therapy Letter 2007, vol. 12, pp. 4-6). Псориаз является часто встречающимся заболеванием с распространенностью 2-3%. Тогда как более мягкие формы можно лечить наружно глюкокортикоидами и/или аналогами витамина D3, более тяжелые формы требуют системной терапии, включающей циклоспорин, метотрексат или, в конечном счете, биопрепараты (Prieto-Perez R. et al., Pharmacogenomics. 2013 Oct; 14(13):1623-1634). Применение терапии биологическими препаратами для системного лечения тяжелого псориаза, включающей использование моноклональных антител, воздействующих, например, на ФНО-альфа (адалимумаб, этанерцепт и инфликсимаб), по существу направлено на удовлетворение медицинской потребности пациентов, страдающих тяжелыми формами псориаза. Хотя эти препараты обладают высокой эффективностью, они связаны со многими потенциально тяжелыми и серьезными нежелательными явлениями. Таким образом, профиль отношения выгоды/риска этих лекарственных препаратов делает невозможным их применение у большинства больных псориазом, имеющих от легкой до умеренной формы псориаза. Побочное действие может быть, например, уменьшено при местном применении биологических препаратов, то есть наружном применении. Впрочем, из-за большого размера полноразмерные антитела не подходят для такого пути введения.

[011] Гнойный гидраденит, также называемый инверсными угрями, является другим нарушением, связанным с ФНО-альфа. Указанное воспалительное хроническое заболевание характеризуется наличием скоплений абсцессов на участках кожи, содержащих апокринные железы, таких как подмышки, внутренняя сторона бедер, пах и ягодицы (SCHEINFELD, N. Hidradenitis suppurativa: A practical review of possible medical treatments based on over 350 hidradenitis patients. Dermatol Online Journal 2013, vol 19, p.1). Ингибиторы ФНО-альфа успешно применяли при лечении указанного редкого заболевания (Brunasso AM, Massone C. Treatment of hidradenitis suppurativa with tumour necrosis factor-alpha inhibitors: An update on infliximab. Acta Derm Venereol. 2011, vol. 91(1), pp.70; Sotiriou E. et al., Etanercept for the treatment of hidradenitis suppurativa, Acta Derm Venereol. 2009, vol. 89(1), pp. 82-3). Антитела, направленные против ФНО-альфа, также были эффективными при лечении гангренозной пиодермии, другого редкого кожного заболевания (Reddick CL et al. Successful treatment of superficial pyoderma gangrenosum associated with hidradenitis suppurativa with adalimumab. Dermatol Online J. 2010, vol. 16(8), pp.15). К настоящему времени ни одно биологическое лекарственное средство не было одобрено для лечения таких редких заболеваний, однако коммерчески доступные биопрепараты применяются по неутвержденным показаниям.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

[012] В первом аспекте изобретение относится к связывающему элементу к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент является гуманизированным и нейтрализует активность растворимого ФНО-альфа. В некоторых вариантах осуществления связывающий элемент является белковой связывающей молекулой с иммуноглобулиноподобными функциями, специфичной к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент является иммуноглобулином, специфичным к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент является фрагментом антитела, специфичным к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент является иммуноглобулином млекопитающего или его фрагментом. В некоторых вариантах осуществления связывающий элемент является гуманизированным иммуноглобулином или его фрагментом. В некоторых вариантах осуществления связывающий элемент является человеческим иммуноглобулином или его фрагментом.

[013] В одном варианте осуществления изобретение относится к моновалентному связывающему элементу, который ингибирует растворимый ФНО-альфа с активностью ниже 50 пикомоль (пМ), согласно определению при измерении полумаксимальной ингибирующей концентрации IC50 в отношении ингибирования биологического действия растворимого ФНО-альфа человека.

[014] Связывающий элемент, в частности фрагмент антитела, гуманизированный или нет, имеющий значение активности в пМ-диапазоне, является особым объектом, который сложно получить рутинным способом. Это особенно относится к фрагменту моновалентного антитела, который включает только одну вариабельную область легкой и тяжелой цепи и поэтому не обладает авидностью бивалентного антитела, которое включает две легких и две тяжелых цепи.

[015] Кроме того, при превращении полноразмерного антитела во фрагмент меньшего размера его активность обычно уменьшается. Это происходит не только из-за сопутствующего изменения валентности (например, фрагмент антитела может быть только моновалентным, тогда как полноразмерный иммуноглобулин является би- или поливалентным), но может быть также вызвано стерическими факторами.

[016] В некоторых вариантах осуществления связывающий элемент согласно первому аспекту включает последовательность CDR, определенную SEQ ID No: 3-8. Связывающий элемент в некоторых вариантах осуществления включает две или более, предпочтительно все последовательности CDR из группы, состоящей из SEQ ID No: 3-8. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную SEQ ID No: 3. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 80% аминокислотной идентичностью с SEQ ID No: 3. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 90% аминокислотной идентичностью с SEQ ID No: 3. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную SEQ ID No: 4. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 85% аминокислотной идентичностью с SEQ ID No: 4. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную SEQ ID No: 5. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 80% аминокислотной идентичностью с SEQ ID No: 5. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 85% аминокислотной идентичностью с SEQ ID No: 5. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 93% аминокислотной идентичностью с SEQ ID No: 5. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную SEQ ID No: 6. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 80% аминокислотной идентичностью с SEQ ID No: 6. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 88% аминокислотной идентичностью с SEQ ID No: 6. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную SEQ ID No: 7. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 80% аминокислотной идентичностью с SEQ ID No: 7. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 94% аминокислотной идентичностью с SEQ ID No: 7. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 80% аминокислотной идентичностью с SEQ ID No: 8. В некоторых вариантах осуществления связывающий элемент включает последовательность CDR, определенную последовательностью, которая обладает по меньшей мере 92% аминокислотной идентичностью с SEQ ID No: 8. В некоторых вариантах осуществления связывающий элемент включает три или более последовательностей из группы, состоящей из SEQ ID No: 3-8.

[017] В некоторых вариантах осуществления связывающий элемент, раскрытый в настоящей заявке, включает каркасную последовательность вариабельной области легкой цепи, обладающую по меньшей мере 90% идентичностью с SEQ ID No: 1; и каркасную последовательность вариабельной области тяжелой цепи, обладающую по меньшей мере 90% идентичностью с SEQ ID No: 2. В некоторых вариантах осуществления связывающий элемент, раскрытый в настоящей заявке, включает каркасную последовательность вариабельной области легкой цепи, обладающую по меньшей мере 97% идентичностью с SEQ ID No: 1; и каркасную последовательность вариабельной области тяжелой цепи, обладающую по меньшей мере 90% идентичностью с SEQ ID No: 2. В некоторых вариантах осуществления связывающий элемент, раскрытый в настоящей заявке, включает каркасную последовательность вариабельной области легкой цепи, обладающую по меньшей мере 90% идентичностью с SEQ ID No: 1; и каркасную последовательность вариабельной области тяжелой цепи, обладающую по меньшей мере 96% идентичностью с SEQ ID No: 2.

[018] В предпочтительном варианте осуществления связывающий элемент является одноцепочечным вариабельным фрагментом (scFv), который включает последовательность SEQ ID No: 9. Связывающий элемент может быть одноцепочечным вариабельным фрагментом (scFv), который по существу состоит из последовательности SEQ ID No: 9. В некоторых вариантах осуществления связывающий элемент состоит из последовательности SEQ ID No: 9.

[019] Связывающие элементы по изобретению являются очень стабильными, то есть они остаются мономерными и функционально активными в течение длительных периодов времени. Это, в частности, относится к фрагменту антитела, а более конкретно к scFv, как раскрыто в настоящей заявке. Параметры стабильности являются критически важными факторами для получения эффективного лекарственного средства. Чем более стабильным является лекарственное средство, тем более продолжительным является полупериод хранения. Нестабильные антитела имеют тенденцию к димеризации или олигомеризации и даже преципитации, что уменьшает, таким образом, длительность хранения и, наконец, приводит к тому, что они становятся менее пригодными для фармацевтического применения, например, вследствие увеличенной иммуногенности. Соответствующий связывающий элемент также остается мономерным при высоких концентрациях, что обеспечивает преимущество меньших объемов при введении.

[020] В случае некоторых терапевтических показаний фрагмент антитела обеспечивает преимущества по сравнению с полноразмерным иммуноглобулином, которые могут быть отнесены к его меньшему размеру и отсутствию константной Fc-области иммуноглобулина. Например, scFv способен к более эффективному проникновению через ткани благодаря своему небольшому размеру. Кроме того, он демонстрирует менее продолжительное удержание в системном кровотоке, поскольку он не способен к связыванию с Fc-рецепторами, такими как FcRn, что, в конечном счете, приводит к более высокому почечному клиренсу. Такие свойства хорошего проникновения в ткани, с последующим равномерным распределением в ткани и быстрым выведением малых фрагментов антител, таких как scFv, из системного кровотока особенно предпочтительны как в случае хронических местных/наружных, так и в случае острых системных заболеваний. Однако подобная практическая применимость была существенно ограничена в прошлом из-за низкой стабильности и низкой биологической активности scFv.

[021] Связывающий элемент по изобретению проявляет очень высокую ингибирующую активность в отношении ФНО-альфа человека. Биологически очень активный связывающий элемент особенно полезен, поскольку он позволяет, например, производить введение малых количеств лекарственного средства пациенту, что уменьшает, таким образом, общие затраты на лечение. Кроме того, предоставляется возможной более полная нейтрализация молекулярной мишени заболевания.

[022] Кроме того, различные, новые пути применения в моделях на животных, а также в терапии человека можно предположить при применении связывающих элементов с наиболее высокой активностью. Например, в случае применяемых наружно лекарственных средств (например, на коже), хотя эффективность доставки может быть ограничена из-за барьерной функции рогового слоя и/или других биологических структур, эффективность лечения компенсируется высокой активностью в ином случае ограниченного количества молекул лекарственного средства, которое проходит через такие физиологические барьеры.

[023] Часто высокое количество менее сильнодействующего лекарственного средства, которое требуется вводить для достижения таких же фармакодинамических эффектов, как и в случае с более сильнодействующим лекарственным средством, переходит в намного более высокие объемы при внутривенном или подкожном применении. Такие более высокие вводимые объемы неблагоприятны для терапевтического применения у животных и людей по двум причинам: во-первых, непрактичность лечения пациентов большим объемом лекарственного средства и, во-вторых, биопрепараты, такие как молекула антитела, являются дорогостоящими в пересчете на единицу массы.

[024] Меньшие количества лекарственного средства, требуемые для лечения, транслируются в более низкие издержки производства лекарственного средства. В частности, фрагменты антитела предполагают низкие издержки производства, поскольку применение, например, систем бактериальных или дрожжевых культур, как правило, приводит к более низким затратам по сравнению с системами экспрессии в клетках млекопитающих, обычно используемых для получения молекулы полноразмерного иммуноглобулина. Комбинация меньших количеств лекарственного средства, которые требуется вводить, и менее затратных процессов производства открывает возможность более рентабельных лекарственных средств на каждого пациента. Таким образом, большее количество пациентов может извлечь выгоду из такого лекарственного средства.

[025] Во втором аспекте изобретение относится к молекуле нуклеиновой кислоты. Молекула нуклеиновой кислоты кодирует связывающий элемент согласно первому аспекту. Молекула нуклеиновой кислоты обычно содержит последовательность, кодирующую связывающий элемент согласно первому аспекту. В некоторых вариантах осуществления молекула нуклеиновой кислоты по существу состоит из последовательности, кодирующей связывающий элемент согласно первому аспекту. В некоторых вариантах осуществления молекула нуклеиновой кислоты состоит из последовательности, кодирующей связывающий элемент согласно первому аспекту. Последовательность, кодирующая связывающий элемент, в некоторых вариантах осуществления функционально связана с регуляторной областью, такой как промотор. Последовательность, кодирующая связывающий элемент, в некоторых вариантах осуществления включена в кассету экспрессии. В некоторых вариантах осуществления молекула нуклеиновой кислоты является выделенной молекулой нуклеиновой кислоты. В некоторых вариантах осуществления молекула нуклеиновой кислоты включена в вектор.

[026] В третьем аспекте изобретение относится к вектору. Вектор содержит последовательность, которая кодирует связывающий элемент согласно первому аспекту. Вектор может содержать последовательность согласно второму аспекту.

[027] В четвертом аспекте изобретение относится к клетке-хозяину. Клетка-хозяин содержит молекулу нуклеиновой кислоты согласно второму аспекту. В некоторых вариантах осуществления клетка-хозяин содержит вектор согласно третьему аспекту.

[028] В пятом аспекте изобретение относится к композициям. Соответствующая композиция может содержать связывающий элемент согласно первому аспекту, молекулу нуклеиновой кислоты согласно второму аспекту, вектор согласно третьему аспекту или клетку-хозяина согласно четвертому аспекту. Такая композиция также включает подходящий носитель, разбавитель или эксципиент. Такая композиция может быть получена в форме для косметического, диагностического и фармацевтического применения.

[029] В шестом аспекте изобретение относится к способу лечения заболевания, опосредованного ФНО-альфа. Способ включает введение связывающего элемента согласно первому аспекту пациенту. Способ обычно включает введение пациенту, фармацевтической композиции согласно пятому аспекту. Как правило, эффективное количество связывающего элемента вводят в течение некоторого периода времени. Эффективное количество связывающего элемента можно, таким образом, вводить пациенту периодически. Эффективное количество связывающего элемента можно, таким образом, вводить пациенту во множестве доз. В случае, когда вводят множество доз, схема дозирования может быть постоянной в течение терапии. В некоторых вариантах осуществления схема дозирования может быть изменена, например, с увеличением или уменьшением дозы, во время терапии. В некоторых вариантах осуществления эффективное количество связывающего элемента вводят в форме разовой дозы. В некоторых вариантах осуществления эффективное количество связывающего элемента вводят пациенту только один раз.

[030] В некоторых вариантах осуществления способ согласно шестому аспекту включает отмену введения связывающего элемента согласно первому аспекту. В таких вариантах осуществления способ согласно шестому аспекту может включать контакт биологического образца со связывающим элементом согласно первому аспекту. Биологический образец может быть образцом физиологической жидкости. Биологический образец может быть также биоптатом. Контакт биологического образца со связывающим элементом проводят в условиях, обеспечивающих специфичное связывание связывающего элемента с ФНО-альфа. Способ может также включать обнаружение, образовался ли комплекс между связывающим элементом и ФНО-альфа. В некоторых вариантах осуществления способ может включать измерение количества комплекса, образованного между связывающим элементом и ФНО-альфа. Способ может включать определение количества комплекса, образованного между связывающим элементом и ФНО-альфа.

[031] В некоторых вариантах осуществления количество комплекса, образованного между связывающим элементом и ФНО-альфа, сравнивают с пороговым значением. Способ согласно шестому аспекту может включать отмену введения связывающего элемента, а также фармацевтической композиции, соответственно, если было обнаружено, что количество комплекса между связывающим элементом и ФНО-альфа ниже порогового значения. В некоторых вариантах осуществления способ согласно шестому аспекту включает контроль количества комплекса, образованного между связывающим элементом и ФНО-альфа.

[032] Способ согласно шестому аспекту может включать продолжение введения связывающего элемента, а также фармацевтической композиции, соответственно, если было обнаружено, что количество комплекса между связывающим элементом и ФНО-альфа равно или превышает пороговое значение.

[033] Связывающий элемент, как описано в настоящей заявке, может, например, использоваться в качестве лекарственного средства. Соответствующий связывающий элемент может быть предназначен, например, для применения в лечении заболевания, опосредованного ФНО-альфа. В некоторых вариантах осуществления связывающий элемент, как описано в настоящей заявке, используется в диагностике. Связывающий элемент, как описано в настоящей заявке, может также использоваться в косметике. В некоторых вариантах осуществления связывающий элемент, как описано в настоящей заявке, используется в целях обнаружения. Связывающий элемент, как описано в настоящей заявке, может, например, использоваться в анализе связывания.

[034] Таким образом, в некоторых вариантах осуществления связывающий элемент предназначен для медицинского применения. Иными словами, связывающий элемент может быть предназначен для применения в качестве терапевтического средства. В этом отношении изобретение также относится к применению связывающего средства согласно первому аспекту в получении лекарственного средства. В некоторых вариантах осуществления применение является применением связывающего средства согласно первому аспекту в получении лекарственного средства для лечения заболевания, опосредованного ФНО-альфа. В этом отношении изобретение также относится к фармацевтической композиции для лечения заболевания, опосредованного ФНО-альфа. Также изобретение относится к средству для лечения заболевания, опосредованного ФНО-альфа. Средство включает связывающий элемент согласно первому аспекту. Средство может по существу состоять из связывающего элемента согласно первому аспекту.

[035] Кроме того, молекула нуклеиновой кислоты согласно второму аспекту, вектор согласно третьему аспекту или клетка-хозяин согласно четвертому аспекту могут использоваться в качестве лекарственного средства. Молекула нуклеиновой кислоты согласно второму аспекту, вектор согласно третьему аспекту или клетка-хозяин согласно четвертому аспекту в некоторых вариантах осуществления могут быть предназначены для применения в лечении заболевания, опосредованного ФНО-альфа. В некоторых вариантах осуществления молекула нуклеиновой кислоты согласно второму аспекту, вектор согласно третьему аспекту или клетка-хозяин согласно четвертому аспекту могут использоваться в диагностике. Молекула нуклеиновой кислоты согласно второму аспекту, вектор согласно третьему аспекту или клетка-хозяин согласно четвертому аспекту могут также использоваться в косметике. В некоторых вариантах осуществления молекула нуклеиновой кислоты согласно второму аспекту, вектор согласно третьему аспекту или клетка-хозяин согласно четвертому аспекту используются в целях обнаружения. Следовательно, связывающий элемент, раскрытый в настоящей заявке, или молекула нуклеиновой кислоты, кодирующая то же, соответствующий вектор или клетка-хозяин могут использоваться в получении лекарственного средства, которое может быть использовано в лечении заболевания, опосредованного ФНО-альфа.

[036] В седьмом аспекте изобретение относится к способу ингибирования взаимодействия между ФНО-альфа и ФНО-Р1 и/или ФНО-Р2. Способ включает стадию получения ФНО-альфа и ФНО-Р1 и/или ФНО-Р2. Способ также включает стадию контакта ФНО-альфа со связывающим элементом согласно первому аспекту.

[037] В восьмом аспекте изобретение относится к способу ингибирования биологической активности ФНО-альфа. Способ включает стадию получения ФНО-альфа. Способ также включает стадию контакта ФНО-альфа со связывающим элементом согласно первому аспекту.

[038] В девятом аспекте изобретение относится к способу получения связывающего элемента, раскрытого в настоящей заявке. Способ включает культивирование клетки-хозяина согласно четвертому аспекту. Способ, таким образом, включает обеспечение экспрессии связывающего элемента. Таким образом может быть получена реакционная смесь. Способ также включает выделение связывающего элемента, например, из соответствующей полученной реакционной смеси. В некоторых вариантах осуществления способ включает очистку связывающего элемента.

[039] В некоторых вариантах осуществления способ согласно девятому аспекту может дополнительно включать по меньшей мере одну стадию химического синтеза. Стадия химического синтеза может быть, например, стадией модификации связывающего элемента после его получения. Иллюстративным примером является посттрансляционная модификация, такая как гликозилирование или ПЭГилирование. ПЭГилирование представляет собой ковалентное присоединение одной или более молекул полиэтиленгликоля (ПЭГ). В некоторых вариантах осуществления стадия химического синтеза обеспечивает введение липидной молекулы посредством ковалентного присоединения. В некоторых вариантах осуществления стадия химического синтеза обеспечивает введение углеводной молекулы посредством ковалентного присоединения. В некоторых вариантах осуществления стадия химического синтеза обеспечивает введение детектируемой молекулы, такой как радиоизотопная метка. Детектируемая метка может быть также введена посредством ковалентного присоединения.

[040] В десятом аспекте изобретение относится к способу получения связывающего элемента, как раскрыто в настоящей заявке. Способ включает контакт бесклеточной системы экспрессии с матрицей продукции нуклеиновой кислоты. Матрица продукции нуклеиновой кислоты кодирует связывающий элемент согласно первому аспекту. В некоторых вариантах осуществления способ включает получение бесклеточной системы. Способ также может включать получение матрицы продукции нуклеиновой кислоты. Способ также включает обеспечение транскрипции и трансляции матрицы продукции нуклеиновой кислоты. В результате способ включает обеспечение образования реакционной смеси. Кроме того, способ включает выделение связывающего элемента из реакционной смеси.

[041] В некоторых вариантах осуществления способ согласно десятому аспекту включает обогащение связывающего элемента. В некоторых вариантах осуществления способ согласно десятому аспекту включает очистку связывающего элемента. В некоторых вариантах осуществления способ согласно десятому аспекту включает выделение связывающего элемента. В некоторых вариантах осуществления способ включает по меньшей мере одну стадию химического синтеза. Таким образом, получение связывающего элемента может включать этап химического синтеза.

[042] В одиннадцатом аспекте изобретение относится к способу обнаружения присутствия ФНО-альфа в биологическом образце. Способ может быть способом in vivo или способом in vitro. Способ включает стадию контакта биологического образца со связывающим элементом согласно первому аспекту. В некоторых вариантах осуществления способ включает получение связывающего элемента согласно первому аспекту. Контакт биологического образца со связывающим элементом согласно первому аспекту проводят в условиях, обеспечивающих специфичное связывание связывающего элемента с ФНО-альфа. Способ также включает стадию обнаружения, образовался ли комплекс между связывающим элементом и ФНО-альфа.

[043] В некоторых вариантах осуществления способ согласно одиннадцатому аспекту может включать оценку количества комплекса, образовавшегося между связывающим элементом и ФНО-альфа. Способ может включать определение количества комплекса, образовавшегося между связывающим элементом и ФНО-альфа.

[044] В способе согласно одиннадцатому аспекту биологический образец обычно является образцом, полученным от пациента. В некоторых вариантах осуществления биологический образец является образцом физиологической жидкости, полученным от пациента. В некоторых вариантах осуществления биологический образец является биоптатом. Образец физиологической жидкости в некоторых вариантах осуществления является пробой крови. В некоторых вариантах осуществления образец физиологической жидкости является пробой мочи. В некоторых вариантах осуществления образец физиологической жидкости является пробой спинномозговой жидкости. В некоторых вариантах осуществления образец физиологической жидкости является пробой синовиальной жидкости. Образец физиологической жидкости в некоторых вариантах осуществления является пробой лимфы.

[045] В некоторых вариантах осуществления способ согласно одиннадцатому аспекту является способом распределения пациента для терапии заболевания, опосредованного ФНО-альфа. Способ может считаться способом определения, будет ли пациент отвечать на терапию заболевания, опосредованного ФНО-альфа, с использованием связывающего элемента, раскрытого в настоящей заявке. Способ может включать сравнение количества комплекса, образованного между связывающим элементом и ФНО-альфа, с пороговым значением. Количество комплекса, образованного между связывающим элементом и ФНО-альфа, которое равно или превышает пороговое значение, указывает, что пациент будет отвечать на терапию заболевания, опосредованного ФНО-альфа, с использованием связывающего элемента. Количество комплекса, образованного между связывающим элементом и ФНО-альфа, которое ниже порогового значения, указывает, что пациент не будет отвечать на терапию заболевания, опосредованного ФНО-альфа, с использованием связывающего элемента.

[046] Согласно двенадцатому аспекту изобретение относится к комбинации связывающего элемента согласно первому аспекту и раствора ФНО-альфа известной концентрации. Такой раствор ФНО-альфа может служить для получения стандартного раствора, например, в целях калибровки. Комбинация связывающего элемента и раствора ФНО-альфа может быть включена в набор. Комбинация связывающего элемента и раствора ФНО-альфа могут определять набор. Набор может включать два контейнера, при этом первый контейнер содержит связывающий элемент, второй контейнер содержит раствор ФНО-альфа. Набор также может по существу состоять из первого контейнера, содержащего связывающий элемент, и второго контейнера, содержащего раствор ФНО-альфа. В одном варианте осуществления набор состоит из первого контейнера, второго контейнера и инструкций по применению.

[047] Согласно тринадцатому аспекту изобретение относится к комбинации связывающего элемента согласно первому аспекту и реактива для обнаружения. Набор может включать два контейнера, при этом первый контейнер содержит связывающий элемент, второй контейнер содержит реактив для обнаружения. В некоторых вариантах осуществления связывающий элемент включает детектируемую метку, такую как фермент. Детектируемая метка может требовать присутствия реактива. В качестве иллюстративного примера, может требоваться субстрат фермента, превращение которого катализирует фермент. Субстрат фермента может, например, давать обнаруживаемый продукт. Соответствующий реактив, например субстрат фермента, может быть включен во второй контейнер.

[048] Согласно четырнадцатому аспекту изобретение относится к изделию, которое, например, может быть набором. Такое изделие может включать связывающий элемент согласно первому аспекту вместе с упакованной комбинацией реактивов с инструкциями. Изделие может по существу состоять из связывающего элемента и упакованной комбинации реактивов с инструкциями. В одном варианте осуществления изделие состоит из связывающего элемента и упакованной комбинации реактивов с инструкциями.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

[049] Фигура 1A представляет собой график, на котором показаны результаты специфичного связывания scFv-фрагментов с рекомбинантным человеческим (рч) ФНО-альфа в ELISA. scFv1 (незакрашенный круг) или scFv DLX105 (незакрашенный квадрат), служащий в качестве положительного контроля, добавляли к иммобилизированному рчФНО-альфа в различных концентрациях. Связанные scFv-фрагменты детектировали при использовании белка L-HRP. scFv с другой и, таким образом, нерелевантной специфичностью (DLX1084) использовали в качестве отрицательного контроля (закрашенный треугольник). На Фигуре 1B показано, что все scFv-фрагменты, иммобилизированные на планшете ELISA, подверглись правильному рефолдингу и могли распознаваться белком L-HRP.

[050] Фигура 2 представляет собой график, на котором показано ингибирование опосредованной рчФНО-альфа клеточной цитотоксичности scFv-фрагментами в клетках PK-15 в низких пикомолярных концентрациях. Серийные разведения scFv1 (незакрашенный круг) или положительный контроль scFv DLX105 (незакрашенный квадрат) предварительно инкубировали с растворимым ФНО-альфа, с последующим инкубированием с клетками PK-15.

[051] Фигура 3 представляет собой график, на котором показано превосходное ингибирование опосредованной растворимым ФНО-альфа клеточной цитотоксичности в клетках PK-15 scFv1 фрагментом антитела по сравнению с другими коммерческими антагонистами ФНО-альфа IgG типа. Серийные разведения scFv1 (незакрашенный круг), голимумаба (закрашенный треугольник), адалимумаба (закрашенный квадрат) или инфликсимаба (закрашенный круг) предварительно инкубировали с растворимым ФНО-альфа, с последующим инкубированием с клетками PK-15.

[052] Фигура 4 представляет собой график, на котором показано, что scFv1 связывает и нейтрализует трансмембранную (тм) форму ФНО-альфа. На Фигуре 4A представлен проточный цитометрический анализ scFv1 (простая линия) и отрицательный контроль scFv DLX1084 (закрашенная гистограмма) с тмФНО-альфа-экспрессирующими клетками CHO. На Фигуре 4B представлена выживаемость клеток при серийных разведениях scFv1 (незакрашенный треугольник), положительный контроль scFv DLX105 (незакрашенный квадрат) и отрицательный контроль scFv DLX1084 (закрашенный треугольник), которые инкубировали с клетками CHO, экспрессирующими тмФНО-альфа, с последующим добавлением клеток HEK-Dual, чувствительных к ФНО-альфа.

ПОДРОБНОЕ ОПИСАНИЕ

[053] В целях упрощения понимания объяснений в отношении связывающих элементов, нуклеиновых кислот, векторов, клеток-хозяев, композиций, способов и применений, раскрытых в настоящем описании, сначала определены некоторые термины.

Определения

[054] Если не определено иное, все остальные научно-технические термины, используемые в описании, фигурах и формуле изобретения, имеют свое обычное значение, обычно известное среднему специалисту в данной области техники. Хотя подобные или эквивалентные описанным в настоящей заявке методы и материалы могут использоваться при практическом применении или тестировании связывающих элементов, нуклеиновых кислот, векторов, клеток-хозяев, композиций, способов и применений, раскрытых в настоящем описании, подходящие методы и материалы описаны ниже. Все публикации, заявки на патенты, патенты и другие источники, указанные в настоящем описании, полностью включены посредством отсылки. В случае противоречия настоящее описание, включая определения, будет иметь преимущественную силу. Материалы, методы и примеры являются иллюстративными и не должны считаться ограничивающими.

[055] Слово "приблизительно" при использовании в настоящем описании относится к значению, находящемуся в пределах приемлемого диапазона ошибок для определенного значения, как определено средним специалистом в данной области, что будет частично зависеть от того, каким образом значение измерено или определено, то есть от ограничений системы измерения. Например, "приблизительно" может означать в пределах одного или больше чем одного среднеквадратичного отклонения, согласно практике в данной области техники. Термин "приблизительно" также используется для указания, что рассматриваемое количество или значение может быть указанным значением или некоторым другим значением, которое является приблизительно таким же. Фраза предназначена для выражения того, что подобные значения обеспечивают эквивалентные результаты или эффекты согласно изобретению. В данном контексте "приблизительно" может относиться к диапазону выше и/или ниже до 10%. Слово "приблизительно" в некоторых вариантах осуществления относится к диапазону выше и ниже определенного значения, которое составляет до 5%, например до 2%, до 1% или до 0,5% выше или ниже указанного значения. В одном варианте осуществления "приблизительно" относится к диапазону на 0,1% выше и ниже данного значения.

[056] Термин "введение" при использовании в настоящем описании относится к любому способу переноса, доставки, внесения или транспортировки вещества, такого как соединение, например фармацевтическое соединение, или другого средства, такого как антиген, пациенту. Способы введения включают пероральное введение, наружный контакт, внутривенное, внутрибрюшинное, внутримышечное, интраназальное или подкожное введение (см. ниже). Введение "в комбинации с" другим веществом, таким как одно или более терапевтических средств, включает одновременное (параллельное) и последовательное введение в любом порядке.

[057] Слово "анализ" при использовании в настоящем документе относится к общеизвестному в уровне техники способу анализа параметра, например, активности катализатора, присутствия, образования или количества вещества, содержащегося в биологическом образце. Такое вещество может присутствовать в живом организме или представлять живой организм, такой как белок, нуклеиновая кислота, липид, клетка, вирус, сахарид, полисахарид, витамин или ион, и другие примеры. Слово "анализ" подчеркивает, что осуществляется определенная процедура или ряд процедур, которые могут быть выполнены для представления соответствующего анализа. Анализ может включать количественно определенные реактивы и установленные методики для оценки присутствия, отсутствия, количества или активности биологического объекта.

[058] Термин "анализ связывания" обычно относится к способу определения взаимодействия вещества. Следовательно, некоторые варианты осуществления анализа связывания могут использоваться для качественного или количественного определения способности материала, например, вещества, связываться с другим веществом, например, белком, нуклеиновой кислотой или любым другим веществом. Некоторые варианты осуществления анализа связывания могут использоваться для анализа присутствия и/или количества вещества на основе связывания вещества с реактивом, таким как партнер связывания, который используется в способе/анализе. В качестве иллюстративного примера, анализ связывания ФНО-альфа может включать применение партнера связывания, такого как связывающий элемент, раскрытый в настоящей заявке, который специфично связывается с ФНО-альфа. В случае, когда анализ связывания основан на использовании иммуноглобулина или белковой связывающей молекулы с иммуноглобулиноподобными функциями в качестве партнера связывания, такой способ/процедуру также можно назвать "иммуноанализом". В этом отношении подразумевается, что сигналы, полученные в иммуноанализе, являются прямым результатом образования комплексов между одним или более иммуноглобулинами или белковыми связывающими молекулами с иммуноглобулиноподобными функциями и соответствующим аналитом, таким как ФНО-альфа, содержащим необходимый эпитоп(ы), с которым связывается (связываются) партнер(ы) связывания. Хотя такой анализ позволяет обнаруживать полноразмерный аналит, и результат анализа может быть выражен как концентрация целевого биомаркера, сигнал, получаемый в анализе, фактически является результатом присутствия всех таких "иммунореактивных" молекул в образце. Количество и/или присутствие аналита также можно определить не только с помощью иммуноанализа, но и других способов, включающих измерения белка, такие как дот-блоттинг, Вестерн-блоттинг, хроматографические методы, масс-спектрометрия и измерения нуклеиновых кислот, такие как определение количества мРНК.

[059] При использовании в настоящем описании, термины "консервативная модификация" и "консервативная замена" относятся к модификации и замене, соответственно, которые сохраняют физически, биологически, химически или функционально свойства по сравнению с соответствующим референсным источником. Молекула, которая включает последовательность с консервативной заменой, например, имеет такой же размер, форму, электрический заряд, химические свойства, включая сопоставимую способность образовывать ковалентные или водородные связи, и/или сопоставимую полярность. Такие консервативные модификации включают, без ограничения, одну или более замен, вставок и делеций нуклеотидных оснований и аминокислот.

[060] Например, консервативные аминокислотные замены включают такие замены, при которых аминокислотный остаток заменен аминокислотным остатком, имеющим аналогичную боковую цепь. Например, аминокислотные остатки, являющиеся несущественными в отношении связывания с антигеном, могут быть заменены другим аминокислотным остатком из семейства с аналогичной боковой цепью, например, серин может быть заменен треонином. Аминокислотные остатки обычно подразделяются на семейства на основе общих, сходных свойств боковой цепи, такие как:

1. неполярные боковые цепи (например, глицин, аланин, валин, лейцин, изолейцин, метионин);

2. незаряженные полярные боковые цепи (например, аспарагин, глутамин, серин, треонин, тирозин, пролин, цистеин, триптофан);

3. основные боковые цепи (например, лизин, аргинин, гистидин, пролин);

4. кислотные боковые цепи (например, аспарагиновая кислота, глутаминовая кислота);

5. бета-разветвленные боковые цепи (например, треонин, валин, изолейцин) и

6. ароматические боковые цепи (например, тирозин, фенилаланин, триптофан, гистидин).

Эта классификация может быть дополнительно разделена. В качестве дальнейшей ориентации, каждая из следующих восьми групп содержит аминокислоты, которые могут обычно использоваться для определения консервативных замен друг для друга:

1) Аланин (Ala), Глицин (Gly);

2) Аспарагиновая кислота (Asp), Глутаминовая кислота (Glu);

3) Аспарагин (Asn), Глутамин (Gln);

4) Аргинин (Arg), Лизин (Lys);

5) Изолейцин (Ile), Лейцин (Leu), Метионин (Met), Валин (Val);

6) Фенилаланин (Phe), Тирозин (Tyr), Триптофан (Trp);

7) Серин (Ser), Треонин (Thr); и

8) Цистеин (Cys), Метионин (Met).

Консервативная замена может быть принята как замена первой аминокислоты в одной из этих шести групп выше другой аминокислотой в той же группе из шести групп.

Консервативные замены обычно являются следующими заменами, перечисленными согласно аминокислоте, которую подвергают мутации, причем каждая сопровождается одной или более заменами, которые могут быть приняты как консервативные: Ala → Gly, Ser, Val; Arg → Lys; Asn → Gln, His; Asp → Glu; Cys → Ser; Gln → Asn; Glu → Asp; Gly → Ala; His → Arg, Asn, Gln; Ile → Leu, Val; Leu → Ile, Val; Lys → Arg, Gln, Glu; Met → Leu, Tyr, Ile; Phe → Met, Leu, Tyr; Ser → Thr; Thr → Ser; Trp → Tyr; Tyr → Trp, Phe; Val → Ile, Leu. Другие замены также допускаются и могут быть определены эмпирически или в соответствии с другими известными консервативными или неконсервативными заменами. Консервативная замена может также включать использование неприродной аминокислоты.

[061] Неконсервативные замены, то есть замены членов одного семейства на членов другого семейства, могут приводить к существенным изменениям, например, в отношении заряда, дипольного момента, размера, гидрофильности, гидрофобности или конформации связывающего элемента, что может приводить к значительному снижению связывающей активности, в особенности, если затрагиваются аминокислоты, которые являются существенными для связывания с молекулой-мишенью. Неконсервативная замена также может включать использование неприродной аминокислоты.

[062] Консервативные и неконсервативные модификации могут быть введены в исходные связывающие элементы множеством стандартных методик, известных в уровне техники, таких как комбинаторная химия, сайт-направленный мутагенез ДНК, ПЦР-опосредованный и/или кассетный мутагенез, химический синтез пептидов/белков, химическая реакция, приводящая к специфичному изменению реакционноспособных групп в исходном связывающем элементе. Варианты могут быть протестированы стандартными методами на их химические, биологические, биофизические и/или биохимические свойства. Предпочтительно, консервативная аминокислотная замена по существу не изменяет функциональные, а обычно также и структурные свойства исходной последовательности. Таким образом, характеристики связывания связывающего элемента, который включает консервативную замену, по меньшей мере существенно, не изменены. Кроме того, консервативная аминокислотная замена обычно по существу не изменяет или не нарушает вторичную структуру исходной последовательности.

[063] Термин "детектируемая метка" используется в настоящем описании для обозначения любого вещества, обнаружение или измерение которого, прямо или косвенно, физическими или химическими способами, является показателем присутствия выбранной целевой биоединицы в образце. Репрезентативные примеры полезных детектируемых меток включают, без ограничения, молекулы или ионы, прямо или косвенно обнаруживаемые по свойствам поглощения света, флуоресценции, отражающей способности, рассеяния света, фосфоресценции или люминесценции, молекулы или ионы, обнаруживаемые по своим радиоактивным свойствам, или молекулы или ионы, обнаруживаемые по своим ядерно-магнитно-резонансным или парамагнитным свойствам. Детектируемая метка в некоторых вариантах осуществления может быть молекулой, которая может быть косвенно обнаружена по поглощению света или флуоресценции, например, различные ферменты, которые вызывают превращение подходящих субстратов, например, из не поглощающих свет в поглощающие свет молекулы или из нефлуоресцентных во флуоресцентные молекулы.

[064] "Эффективное количество" или "терапевтически эффективное количество" такого объекта, как соединение, включая связывающий элемент, раскрытый в настоящей заявке, является количеством - либо в виде разовой дозы, либо как часть ряда доз - которое в применяемой схеме введения дает требуемый терапевтический эффект, то есть для достижения некоторой цели лечения. Терапевтически эффективное количество обычно является количеством, достаточным для обеспечения терапевтического эффекта при лечении или контроле соответствующего патологического состояния, или для задержки или минимизации одного или более симптомов, связанных с присутствием такого состояния. Схема введения будет зависеть от различных факторов, включающих связанные с пациентом и клинические факторы (например, возраст, вес, пол, историю болезни пациента, тяжесть нарушения и/или ответ на лечение), природу нарушения, которое лечат, конкретную композицию, которую будут вводить, путь введения и другие факторы.

[065] "Эпитоп" является антигенным, и, таким образом, эпитоп может быть также принят для определения "антигенной структуры" или "антигенной детерминанты". Таким образом, связывающий домен иммуноглобулина или белковой связывающей молекулы с иммуноглобулиноподобными функциями является "участком взаимодействия с антигеном". Термин "участок взаимодействия с антигеном" определяет, в соответствии с настоящим описанием, мотив полипептида, который способен специфично взаимодействовать со специфическим антигеном или специфической группой антигенов, например, ФНО-альфа в различных биологических видах. Такое связывание/взаимодействие, как также понимают, определяет "специфичное распознавание". Эпитоп обычно состоит из пространственно доступных поверхностных групп участков одного или более химических объектов, таких как полипептидные цепи или моно- или полисахариды. Поверхностные группы, определяющие эпитоп, могут быть, например, группами аминокислот или сахаридных боковых цепей. Эпитоп обычно имеет специфические трехмерные структурные характеристики, а также специфические зарядовые характеристики. Конформационные и неконформационные эпитопы отличаются тем, что связывание с первыми, но не последними, утрачивается в присутствии денатурирующих растворителей.

[066] Термин "эпитоп" также относится к участку на антигене, таком как ФНО-альфа, с которым иммуноглобулин, Т-клеточный рецептор или белковая связывающая молекула с иммуноглобулиноподобными функциями образуют комплекс. В некоторых вариантах осуществления эпитоп является участком на молекуле, против которого продуцируется иммуноглобулин или белковая связывающая молекула с иммуноглобулиноподобными функциями, и/или с которым связывается антитело. Например, эпитоп может быть распознан иммуноглобулином или белковой связывающей молекулой с иммуноглобулиноподобными функциями. Эпитоп может быть "линейным эпитопом", который является эпитопом, в котором первичная аминокислотная последовательность содержит распознаваемый эпитоп. Линейный эпитоп обычно включает по меньшей мере 3, а чаще по меньшей мере 5 аминокислот в уникальной последовательности. Линейный эпитоп может, например, включать от приблизительно 8 до приблизительно 10 аминокислот в уникальной последовательности. Эпитоп также может быть "конформационным эпитопом", который в отличие от линейного эпитопа является эпитопом, в котором первичная аминокислотная последовательность, которая включает эпитоп, не является единственным определяющим компонентом распознаваемого эпитопа (например, эпитоп, в котором первичная аминокислотная последовательность не обязательно распознается антителом, определяющим эпитоп). Обычно конформационный эпитоп включает большее количество аминокислот, чем линейный эпитоп. В отношении распознавания конформационных эпитопов, иммуноглобулин или белковая связывающая молекула с иммуноглобулиноподобными функциями распознает 3-мерную структуру антигена, такого как пептид или белок, или фрагмент пептида или белка. В качестве иллюстративного примера, когда молекула белка сворачивается с образованием трехмерной структуры, некоторые аминокислоты и/или все или части полипептидного скелета, образующие конформационный эпитоп, сближаются, позволяя антителу распознавать эпитоп. Способы определения конформации эпитопов включают, без ограничения, рентгеновскую кристаллографию, 2-мерную спектроскопию ядерного магнитного резонанса, сайт-направленное введение спиновых меток и спектроскопию электронного парамагнитного резонанса.

[067] Под применением термина "обогащенный" в отношении полипептида, нуклеиновой кислоты или клетки подразумевается, что определенная аминокислотная/нуклеотидная последовательность или клетка, включая популяцию клеток, составляет значительно более высокую (в 2-5 раз) фракцию всех аминокислотных последовательностей или последовательностей нуклеиновых кислот, присутствующих в целевом образце, чем в природном источнике, из которого был получен образец. Полипептид, нуклеиновая кислота или клетка также могут составлять значительно более высокую фракцию, чем в нормальном или патологическом организме, или чем в нормальных или патологических клетках, или в клетках, из которых была взята последовательность. Это может быть вызвано избирательным уменьшением количества других присутствующих аминокислотных/нуклеотидных последовательностей или клеток, или избирательным увеличением количества определенной целевой аминокислотной/нуклеотидной последовательности или клетки, или комбинацией того и другого. Однако нужно отметить, что обогащенный не предполагает, что не присутствуют никакие другие аминокислотные последовательности, нуклеотидные последовательности или клетки. Термин просто определяет, что относительное количество целевой последовательности было значительно увеличено. Термин значительный в настоящем описании используется для указания того, что уровень увеличения полезен для лица, достигающего такое увеличение, и обычно означает увеличение относительно других аминокислотных или нуклеотидных последовательностей по меньшей мере приблизительно в 2 раза, например, по меньшей мере приблизительно в 5-10 раз или даже больше. Термин, как предполагается, охватывает только такие ситуации, в которых человек вмешался с целью увеличить пропорцию требуемой аминокислотной последовательности, нуклеотидной последовательности или клетки.

[068] Термин "по существу состоит из", как подразумевается, допускает присутствие дополнительных компонентов в образце или композиции, которые не влияют на свойства образца или композиции. В качестве иллюстративного примера фармацевтическая композиция может включать эксципиенты, если она по существу состоит из действующего ингредиента.

[069] Термины "экспрессирующий" и "экспрессия" в отношении биомаркера следует понимать в соответствии со стандартным значением, используемым в данной области техники. Пептид/белок экспрессируется клеткой через транскрипцию нуклеиновой кислоты в мРНК, с последующей трансляцией в полипептид, который сворачивается, а затем, возможно, процессируется. Следовательно, утверждение, что клетка экспрессирует пептид/белок, подразумевает, что пептид/белок был синтезирован экспрессионным аппаратом соответствующей клетки.

[070] Термин "кассета экспрессии" относится к кодирующей последовательности и промотору, необязательно в комбинации с одной или более контрольными последовательностями. Кассеты экспрессии для ферментов включают, в качестве примера и без ограничения, контрольную последовательность инициации трансляции.

[071] Термин "контрольная последовательность" относится к последовательностям нуклеиновых кислот в гене или кассете экспрессии, которые регулируют транскрипцию кодирующей последовательности и, следовательно, включают промоторы, энхансеры, последовательности терминации транскрипции и последовательности инициации трансляции.

[072] В отношении соответствующего биологического процесса непосредственно, термины "экспрессия", "экспрессия гена" или "экспрессирующий" относятся к полноте регуляторных путей, преобразовывающих информацию, закодированную в последовательности нуклеиновой кислоты гена, сначала в матричную РНК (мРНК) и затем в белок. Таким образом, экспрессия гена включает его транскрипцию в первичную гяРНК, процессинг этой гяРНК в зрелую РНК и трансляцию последовательности мРНК в соответствующую аминокислотную последовательность белка. В данном контексте также следует отметить, что термин "продукт гена" относится не только к белку, в том числе, например, конечному белку (включая его сплайс-вариант), кодируемому указанным геном, и соответствующему белку-предшественнику, где это применимо, но также и к соответствующей мРНК, которая может рассматриваться как "первый продукт гена" в процессе экспрессии гена.

[073] В рамках настоящего описания термин "антитело" относится к полноразмерному иммуноглобулину, а также к его фрагменту. Такой полноразмерный иммуноглобулин может быть моноклональным, поликлональным, химерным, гуманизированным, винированным или человеческим антителом. Антитело, раскрытое в настоящей заявке, в некоторых вариантах осуществления может быть гликозилированным. В некоторых вариантах осуществления антитело, раскрытое в настоящей заявке, может быть негликозилированным.

[074] Под "фрагментом" в отношении полипептида, такого как иммуноглобулин или белковая связывающая молекула, подразумевается любая аминокислотная последовательность, присутствующая в соответствующем полипептиде, при условии, что она короче, чем полноразмерная последовательность, и при условии, что она способна к выполнению функции целевого белка - в случае иммуноглобулина, специфично связывающегося с требуемой мишенью, например, антигеном (например, ФНО-альфа). Термин "фрагмент антитела" относится к части иммуноглобулина, часто к гипервариабельной области и частям окружающих тяжелой и легкой цепей, которые проявляют аффинность специфичного связывания к определенной мишени, обычно молекуле. Гипервариабельная область представляет собой часть иммуноглобулина, которая физически связывается с полипептидом-мишенью. Фрагмент антитела, таким образом, включает или состоит из одной или более частей полноразмерного иммуноглобулина, сохраняющих направленную специфичность иммуноглобулина. Такой фрагмент антитела может, например, не иметь, по меньшей мере, частично, константной области (Fc-области) полноразмерного иммуноглобулина. В некоторых вариантах осуществления фрагмент антитела получают при расщеплении полноразмерного иммуноглобулина. Фрагмент антитела может быть также синтетической или рекомбинантной конструкцией, которая содержит одну или более частей иммуноглобулина или цепей иммуноглобулина (см. например, HOLLIGER, P. and Hudson, J. Engineered antibody fragments and the rise of single domains. Nature Biotechnology 2005, vol. 23, no. 9, p. 1126-1136). Примеры фрагмента антитела включают, без ограничения перечисленным, scFv, Fab, Fv, Fabʹ, F(abʹ)2 фрагмент, dAb, VHH, нанотело, V(NAR) или так называемую минимальную распознающую единицу.

[075] "Одноцепочечный вариабельный фрагмент" или "одноцепочечное антитело" или "scFv" являются примерами типов фрагмента антитела. scFv представляет собой слитый белок, который включает VH и VL домены иммуноглобулина, связанные линкером. Таким образом, он не имеет константной Fc области, которая присутствует в полноразмерном иммуноглобулине.

[076] "Связывающий элемент" при использовании в настоящем описании относится к полноразмерному иммуноглобулину, фрагменту антитела, белковому неиммуноглобулиновому каркасу и/или другому связывающему соединению, которое имеет иммуноглобулиноподобную функцию. Как правило, связывающий элемент является белковой связывающей молекулой. Такой связывающий элемент может быть моновалентным или поливалентным, то есть имеющим один или более антигенсвязывающих участков. Неограничивающие примеры моновалентных связывающих элементов включают scFv, Fab фрагменты, dAb, VHH, дарпины, аффилины и нанотела. Поливалентный связывающий элемент может иметь два, три, четыре или больше антигенсвязывающих участков, благодаря чему можно распознавать один или более различных антигенов. Неограничивающими примерами поливалентных связывающих элементов являются полноразмерные иммуноглобулины, F(abʹ)2 фрагменты, бис-scFv (или тандемные scFv) и диатела; в примерных поливалентных связывающих элементах присутствуют два связывающих участка, то есть связывающий элемент является бивалентным.

[077] В некоторых вариантах осуществления поливалентный связывающий элемент является биспецифическим, то есть связывающий элемент направлен против двух различных мишеней или двух различных участков-мишеней на одной целевой молекуле. Биспецифические антитела, например, рассмотрены в обзоре MÜLLER, D. and Kontermann, R.E. Bispecific antibodies. Edited by DÜBEL, S. Weinheim: Wiley-VCH, 2007. ISBN 3527314539. p. 345-378. В некоторых вариантах осуществления поливалентный связывающий элемент включает больше двух, например три или четыре, различных связывающих участка к трем или четырем, соответственно, различным антигенам. Такой связывающий элемент является поливалентным и мультиспецифическим, в частности три- или тетра-специфическим, соответственно.

[078] "Неиммуноглобулиновые каркасы" являются антигенсвязывающими полипептидами, которые, например, описаны в FIELDER, M. and Skerra, A. Non-antibody scaffolds. Edited by DÜBEL, S. Weinheim: Wiley-VCH, 2007. ISBN 3527314539. p. 467-500; или GILBRETH, R.N. and Koide, S. Structural insights for engineering binding proteins based on non-antibody scaffolds. Curr Opin Struct Biol 2012, vol. 22, p. 413-420. Неограничивающие примеры включают аффитела, аффилины, аднектин, мутеин, основанный на полипептиде семейства липокалинов (Антикалин®), дарпин, ноттин, домен Куниц-типа, авимер, тетранектин и транс-тело. Авимеры содержат так называемые A-домены, которые присутствуют в виде цепочек множества доменов в нескольких поверхностных клеточных рецепторах (Silverman, J., et al., Nature Biotechnology (2005) 23, 1556-1561). Тетранектины, полученные из соответствующего человеческого гомотримерного белка, аналогично содержат петлевые области в лектиновом домене C-типа, которые можно сконструировать для получения требуемого связывания (там же).

[079] "Связывающие соединения" являются химическими или биологическими молекулами, которые связываются с мишенью, и которые не относятся к классу полноразмерных иммуноглобулинов, фрагментов антител и неиммуноглобулиновых каркасов, как определено выше. Примеры связывающих соединений, без ограничения, включают макролиды (GUNDLURU, M. K. et al. Design, synthesis and initial biological evaluation of a novel pladienolide analog scaffold. Medchemcomm. 2011, vol. 2, p. 904-908; PATERSON, I. et al. Total synthesis and biological evaluation of a series of macrocyclic hybrids and analogies of the antimitotic natural products dictyostatin, discodermolide and taxol. Chem Asian J. 2011, vol. 6, p. 459-473; MORITA, H. et al. Synthesis of unnatural alkaloid scaffolds by exploiting plant polyketide synthase. PNAS 2011, vol. 108, p. 13504-13509), полимеры с молекулярными отпечатками ((HOSHINO, Y. et al. Recognition, neutralization and clearance of target peptides in the blood stream of living mice by molecular imprinted polymer nanoparticles: a plastic antibody. J Am Chem Soc, 2010, vol. 19, p. 664-6645), аптамеры (STREHLITZ, B., et al. Aptamers for pharmaceuticals and their application in environmental analytics. Bioanal Rev 2012, vol. 4, p. 1-30; YE, M. et al. Generating Aptamers by Cell-SELEX for Applications in Molecular Medicine. Int J Mol Sci 2012, vol. 13, p. 3341-3353), шпигельмеры (см. например, MAASCH, C. et al. Polyethylenimine-Polyplexes of Spiegelmer NOX-A50 directed against intracellular high mobility group protein A1 (HMGA1) reduce tumor growth in vivo. JBC 2010, vol. 285, p. 40012-40018) или пептиды (циклические или линейные; см., например, GOULD, A. et al. Cyclotides, a novel ultrastable polypeptide scaffold for drug discovery. Curr Pharm Des. 2011, vol. 17, p. 4294-4307). Пептоиды, которые могут действовать как белковые лиганды, представляют собой олиго(N-алкил)глицины, которые отличаются от пептидов тем, что боковая цепь связана с амидным азотом, а не с атомом углерода. Пептоиды обычно устойчивы к действию протеаз и других модифицирующих ферментов и могут обладать намного более высокой клеточной проницаемостью, чем пептиды (см. например. Kwon, Y.-U., and Kodadek, T., J. Am. Chem. Soc. (2007) 129, 1508-1509).

[080] Связывающий элемент, раскрытый в настоящей заявке, может быть ПЭГилированным или гипергликозилированным при необходимости, также см. ниже. В некоторых вариантах осуществления связывающий элемент является слитым белком одной из примерных белковых связывающих молекул, указанных выше, и альбумин-связывающего домена, например, альбумин-связывающего домена стрептококкового белка G. В некоторых вариантах осуществления связывающий элемент является слитым белком фрагмента иммуноглобулина, такого как одноцепочечного диатела, и иммуноглобулинсвязывающего домена, например, бактериального иммуноглобулинсвязывающего домена. В качестве иллюстративного примера, одноцепочечное диатело может быть слито с доменом B стафилококкового белка A, как описано Unverdorben et al. (Protein Engineering, Design & Selection [2012] 25, 81-88).

[081] "IC50" или "полумаксимальная ингибирующая концентрация" является показателем активности антагониста и количественно описывает эффективность соединения при ингибировании биологической или биохимической функции. Это значение соответственно указывает, какое количество некоторого соединения, такого как связывающий элемент, требуется для ингибирования на 50% определенного биологического или биохимического процесса или функции. Хотя IC50 и не является прямым индикатором аффинности, значения IC50 и Ki связаны и могут быть определены с помощью уравнения Ченга-Прусова (CHENG Y. and Prusoff W.H. Relationship between the inhibition constant (Ki) and the concentration of inhibitor which causes 50 per cent inhibition (IC50) of an enzymatic reaction. Biochem Pharmacol 1973, vol. 22, p. 3099-3108; RAMMES, G., et al. Identification of a domain which affects kinetics and antagonistic potency of clozapine at 5-HT3 receptors. PLOS one 2009, vol. 4, p. 1-14; ZHEN, J., et al. Concentration of receptor and ligand revisited in a modified receptor binding protocol for high-affinity radioligands: [3H] spiperone binding to D2 and D3 dopamine receptors. J Neurosci Methods 2010, vol. 188, p. 32-38).

[082] Термин "каркасная область" (FR) относится к каркасу вариабельного домена иммуноглобулина, либо вариабельной области легкой цепи (VL), либо вариабельной области тяжелой цепи (VH), которые содержат соответствующие CDR-области. Каркасные области VL и/или VH обычно включают четыре каркасных участка: FR1, FR2, FR3 и FR4, фланкирующих CDR-области. Таким образом, как известно из уровня техники, VL имеет общую структуру: (FR-L1)-(CDR-L1)-(FR-L2)-(CDR-L2)-(FR-L3)-(CDR-L3)-(FR-L4), тогда как VH имеет общую структуру: (FR-H1)-(CDR-H1)-(FR-H2)-(CDR-H2)-(FR-H3)-(CDR-H3)-(FR-H4).

[083] Термин "CDR" относится к гипервариабельным областям антитела, которые вносят основной вклад в связывание антигена. Как правило, антигенсвязывающий участок включает шесть CDR, включенных в каркасную область. В данном случае, CDR области VL называются CDR-L1, CDR-L2 и CDR-L3, тогда как CDR области VH называются CDR-H1, CDR-H2 и CDR-H3. Они могут быть идентифицированы, как описано в KABAT, E.A., et al. Sequences of Proteins of Immunological Interest. 5th edition. Edited by U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES. NIH Publications, 1991. p. 91-3242. Однако CDR-H1, при использовании в настоящем описании, отличается от определения Кэбата, в котором она начинается с положения 27 и оканчивается перед положением 36 (см. Фигуру 5 для иллюстрации).

[084] При использовании в настоящем описании, система нумерации для идентификации положений аминокислотных остатков в VH и VL антитела, соответствует системе "AHo", описанной HONEGGER, A. and Plückthun, A. Yet another numbering scheme for immunoglobulin variable domains: An automatic modelling and analysis tool. JMB 2001, vol. 309, p. 657-670. В данной публикации текже приведены таблицы перевода между системами AHo и Кэбата (KABAT, E.A., et al. Sequences of Proteins of Immunological Interest. 5th edition. Edited by U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES. NIH Publications, 1991. p. 91-3242).

[085] "Гуманизированные" антитела относятся к антителам, которые включают одну или более, обычно все шесть, областей CDR нечеловеческого исходного антитела или его вариантов или синтетических CDR, и в которых каркасная область является, например, (i) человеческой каркасной областью, потенциально включающей один или более остатков каркасной области нечеловеческого исходного антитела, или (ii) каркасной областью из нечеловеческого антитела, модифицированной с целью увеличения подобия природным человеческим каркасным областям. Методы гуманизации антител известны в уровне техники, см., например, LEGER, O. and Saldanha, J. Antibody Drug Discovery. Edited by WOOD, C. London: Imperial College Press, 2011. ISBN 1848166281. p.1-23.

[086] Термины "иммунизировать", "иммунизация" или "иммунизирующий" относятся к экспозиции иммунной системы животного антигену или его эпитопу, как более подробно показано ниже. Антиген может быть введен животному с применением требуемого пути введения, такого как инъекция, ингаляция или прием внутрь. При повторном экспонировании тому же антигену усиливается адаптивный иммунный ответ, в частности Т-клеточный и В-клеточный ответы.

[087] Термин "выделенный" указывает, что вещество, такое как пептид или молекула нуклеиновой кислоты, было удалено из его нормальной физиологической среды, например, природного источника, или что пептид или нуклеиновая кислота синтезированы. Использование термина "выделенный" указывает, что природная последовательность была удалена из своего нормального клеточного (то есть, хромосомного) окружения. Таким образом, последовательность может находиться в бесклеточном растворе или может быть помещена в другую клеточную среду. Под "выделенным" в отношении полипептида или молекулы нуклеиновой кислоты подразумевается полимер из аминокислот (2 или более аминокислот) или нуклеотидов, соединенных друг с другом, включая молекулу полипептида или нуклеиновой кислоты, которая выделена из природного источника или синтезирована. Термин "выделенный" не подразумевает, что последовательность является только присутствующей аминокислотной цепью или нуклеотидной цепью, но которая по существу не содержит, например, является приблизительно на 90-95% чистой или больше, например, неаминокислотного материала и/или ненуклеотидного материала, соответственно, с которым она обычно ассоциирована.

[088] Термин "идентичность" при использовании в настоящем описании относится к сравнению последовательности двух белков или нуклеиновых кислот. Последовательности белков или нуклеиновых кислот, которые подвергают сравнению, выравнивают с получением максимальной идентичности, например, при использовании биоинформационных инструментов, таких как EMBOSS Needle (попарное выравнивание; доступное по адресу www.ebi.ac.uk). Если одно и то же положение в сравниваемых последовательностях занимает то же нуклетидное основание или аминокислотный остаток, то тогда соответствующие молекулы являются идентичными в данном положении. Соответственно, "процент идентичности" является функцией количества совпадающих положений, деленного на количество сравниваемых положений и умноженного на 100%. Например, если 6 из 10 положений последовательности идентичны, то идентичность составляет 60%. Процент идентичности между двумя белковыми последовательностями может быть, например, определен при использовании алгоритма Нидлмана и Вунша (NEEDLEMAN, S.B. and Wunsch, C.D. A general method applicable to the search for similarities in the amino acid sequence of two proteins. JMB 1970, vol. 48, p. 443-453), который был включен в EMBOSS Needle при использовании матрицы BLOSUM62, "штрафа за введение пропуска" 10, "штрафа за продление пропуска" 0,5, ложного "штрафа за концевой пропуск", "штрафа за введение концевого пропуска" 10 и "штрафа за продление концевого пропуска" 0,5. Две молекулы, имеющие одну и ту же первичную аминокислотную или нуклеотидную последовательность, являются идентичными независимо от какой-либо химической и/или биологической модификации. Например, два антитела, имеющие одну и ту же первичную аминокислотную последовательность, но различные профили гликозилирования, являются идентичными согласно данному определению. В случае нуклеиновых кислот, например, две молекулы, имеющие одну и ту же последовательность, но различные компоненты связи, такие как тиофосфат вместо фосфата, являются идентичными согласно данному определению.

[089] Термин "молекула нуклеиновой кислоты" при использовании в настоящем описании относится к любой нуклеиновой кислоте в любой возможной конфигурации, такой как одноцепочечная, двухцепочечная, или их комбинации. Примеры нуклеиновых кислот включают, например, молекулы ДНК, молекулы РНК, аналоги ДНК или РНК, полученные при использовании аналогов нуклеотидов или при использовании химии нуклеиновых кислот, молекулы запертых нуклеиновых кислот (ЗНК), молекулы пептид-нуклеиновых кислот (ПНК), молекулы алкилфосфонат- и алкилфосфотриэфир-нуклеиновых кислот и молекулы tecto-РНК (например, Liu, B., et al., J. Am. Chem. Soc. (2004) 126, 4076-4077). ЗНК содержит модифицированный РНК скелет с мостиковой метиленовой группой между C4' и O2', что дает соответствующую молекулу с более высокой стабильностью дуплекса и устойчивостью к нуклеазам. Молекулы алкилфосфонат- и алкилфосфотриэфир-нуклеиновых кислот можно рассматривать как молекулу ДНК или РНК, в которой фосфатные группы скелета нуклеиновой кислоты нейтрализованы путем замены P-OH групп фосфатных групп в скелете нуклеиновой кислоты на алкильную и на алкоксигруппу, соответственно. ДНК или РНК могут иметь геномное или синтетическое происхождение и могут быть одноцепочечными или двухцепочечными. Такая нуклеиновая кислота может быть, например, мРНК, кРНК, синтетической РНК, геномной ДНК, кДНК, синтетической ДНК, сополимером ДНК и РНК, олигонуклеотидами и т.д. Соответствующая нуклеиновая кислота может также содержать неприродные аналоги нуклеотидов и/или может быть связана с аффинным тэгом или меткой.

[090] Многие аналоги нуклеотидов известны и могут использоваться в нуклеиновых кислотах, применяемых в способах, раскрытых в настоящем описании. Аналог нуклеотида является нуклеотидом, содержащим модификацию, например, в основании, сахаре или фосфатных группах. В качестве иллюстративного примера, замена 2'-OH остатков в миРНК остатками 2'F, 2'O-Me или 2'H, как известно, повышает стабильность in vivo соответствующей РНК. Модификации в основании могут быть природной или синтетической модификацией A, C, G и T/U, другого пуринового или пиримидинового основания, такого как урацил-5-ил, гипоксантин-9-ил и 2-аминоаденин-9-ил, а также непуринового или непиримидинового нуклеотидного основания. Другие аналоги нуклеотидов служат в качестве универсальных оснований. Примеры универсальных оснований включают 3-нитропиррол и 5-нитроиндол. Универсальные основания способны образовывать пару оснований с любым другим основанием. Модификации оснований часто могут быть объединены, например, с модификацией сахара, такой как, например, 2'-O-метоксиэтил, например, для получения уникальных свойств, таких как повышенная стабильность дуплекса.

[091] При использовании в настоящем документе, выражение "фармацевтически приемлемый" относится к таким активным соединениям, материалам, композициям, носителям и/или лекарственным формам, которые, в рамках рациональной медицинской оценки, подходят для применения в контакте с тканями людей и животных без чрезмерной токсичности, раздражения, аллергической реакции или других проблем или осложнений, соразмерных с приемлемым отношением выгоды/риска.

[092] Термины "полипептид" и "белок" относятся к полимеру из аминокислотных остатков и не ограничиваются определенной минимальной длиной продукта. В случаях, когда оба термина используются одновременно, это двойное название учитывает совместное использование обоих терминов в данной области техники.

[093] Термин "предотвращение" в медицинском/физиологическом контексте, то есть в контексте физиологического состояния, относится к уменьшению вероятности заражения организма или развития патологического состояния.

[094] Термин "очищенный" следует понимать как относительное указание по сравнению с исходным окружением связывающего элемента, которое, таким образом, предоставляет указание того, что связывающий элемент является относительно более чистым, чем в естественном окружении. Таким оразом, данный термин включает, но относится не только к этому, абсолютное значение в смысле абсолютной чистоты от других белковых связывающих молекул с иммуноглобулиноподобной функцией, иммуноглобулинов или фрагментов антител. По сравнению с исходным уровнем уровень после очистки связывающего элемента обычно будет по меньшей мере в 2-5 раз больше (например, в мг/мл). Очистка по меньшей мере на один порядок величины, например, приблизительно на два или три порядка, включая, например, приблизительно четыре или пять порядков величины, предполагается явным образом. Может потребоваться получить связывающий элемент, который, по меньшей мере по существу, не содержит примесей, в частности не содержит другое белковое вещество, на функционально значимом уровне, например, с чистотой приблизительно 90%, приблизительно 95% или 99%. В отношении другого вещества, такого как молекула нуклеиновой кислоты, пептид или белок, или клетка, указанное выше применимо с учетом соответствующих изменений.

[095] "Подобные" белковые последовательности являются такими последовательностями, которые при выравнивании имеют общие аминокислотные остатки и чаще всего, но не обязательно, идентичные аминокислотные остатки в одних и тех же положениях сравниваемых последовательностей. Подобные аминокислотные остатки группируют по химическим свойствам боковых цепей в семейства. Эти семейства описаны ниже для "консервативных аминокислотных замен". "Процент подобия" между последовательностями является количеством положений, которые содержат идентичные или подобные остатки в тех же положениях сравниваемых последовательностей, деленным на общее количество сравниваемых положений и умноженным на 100%. Например, если 6 из 10 положений последовательности содержат идентичные аминокислотные остатки, а 2 из 10 положений содержат подобные остатки, то последовательности обладают 80% подобием. Подобие между двумя последовательностями может быть, например, определено при использовании EMBOSS Needle.

[096] Термин "специфичный", при использовании в настоящем документе, следует понимать, как указание того, что связывающий элемент направлен против, связывается с или реагирует с определенной мишенью, такой как ФНО-альфа. Таким образом, направленный на, связывающийся с или реагирующий с включает, что связывающий элемент специфично связывается с ФНО-альфа. Термин "специфично" в данном контексте означает, что связывающий элемент реагирует с ФНО-альфа или/и его частью, но при этом не реагирует, по меньшей мере по существу, с другим белком. Термин "другой белок" включает любой белок, включая белки, близко родственные или гомологичные, например, ФНО-альфа, против которого направлен связывающий элемент. Термин "по существу не связывается" означает, что связывающий элемент не обладает определенной аффинностью в отношении другого белка, то есть демонстрирует перекрестную реактивность менее чем приблизительно 30% по сравнению с аффинностью к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент демонстрирует перекрестную реактивность меньше чем приблизительно 20%, например, меньше чем приблизительно 10%. В некоторых вариантах осуществления связывающий элемент демонстрирует перекрестную реактивность меньше чем приблизительно 9, 8 или 7% по сравнению с аффинностью к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент демонстрирует перекрестную реактивность меньше чем приблизительно 6%, например, меньше чем приблизительно 5% по сравнению с аффинностью к ФНО-альфа. Будет ли связывающий элемент специфично реагировать, как определено выше, можно легко проверить, среди прочего, путем сравнения реакции соответствующего связывающего элемента с ФНО-альфа и реакции связывающего элемента с другим белком(ами). Термин "специфично распознающий", который может использоваться попеременно с терминами "направленный на" или "реагирующий с", в рамках настоящего описания означает, что определенная молекула, как правило, иммуноглобулин, фрагмент иммуноглобулина или белковая связывающая молекула с иммуноглобулиноподобными функциями способна к специфичному взаимодействию и/или связыванию по меньшей мере с двумя, в том числе по меньшей мере тремя, например, по меньшей мере четырьмя или даже более аминокислотами эпитопа, как определено в настоящей заявке. Как правило, иммуноглобулин или белковая связывающая молекула могут, таким образом, образовывать комплекс с соответствующим эпитопом, например, эпитопом ФНО-альфа. Такое связывание может быть проиллюстрировано специфичностью принципа "замка и ключа". "Специфичное связывание" может быть также определено, например, в соответствии с Вестерн-блоттингом, анализом ELISA, РИА, ЭХЛ, ИРМА, ФАКС, ИГХ и пептидным сканированием.

[097] Термин "разделение" при использовании в настоящем описании указывает, что индивида распределяют в определенную группу в соответствии с характеристиками, соответствующими определенной группе, такими как соответствующая вероятность ответа на связывающий элемент, раскрытый в настоящей заявке. Группы могут быть предназначены, например, для тестирования, назначения, приостановки или отмены применения связывающего элемента. Таким образом, в некоторых вариантах осуществления способа или применения согласно изобретению пациент может быть распределен в подгруппу клинического исследования терапии.

[098] Термин "пациент" при использовании в настоящем описании, также называемый как индивид, относится к человеку или не относящемуся к человеку животному, как правило, млекопитающему. Пациент может быть видом млекопитающего, таким как кролик, мышь, крыса, морская свинка, хомяк, собака, кошка, свинья, корова, коза, овца, лошадь, обезьяна, человекообразная обезьяна или человек. Таким образом, способы, применения и композиции, описанные в настоящем документе, применимы к болезни человека и животного. Как более подробно объяснено ниже, образец был получен у пациента. Таким образом, подразумевается, что выводы, сделанные на основе уровней экспрессии в образце, и решения, основанные на них, относятся к пациенту, у кого/которого был забран образец. Кроме того, хотя пациент обычно является живым организмом, способ или применение, описанное в настоящем документе, также могут использоваться в анализе после смерти. В случае, когда пациент является живым человеком, который получает медицинскую помощь по поводу заболевания или состояния, его также называют "пациент".

[099] Термин "лечение" при использовании в настоящем описании относится к профилактической или превентивной мере, оказывающей терапевтическое воздействие и предотвращающей, замедляющей (уменьшающей) или, по меньшей мере, частично, облегчающей или устраняющей аномальное, в том числе патологическое, состояние в организме пациента. Лечение согласно настоящему описанию включает введение фармацевтически эффективного количества молекулы, как описано в настоящей заявке, то есть, среди прочего, связывающего элемента (такого как антитело), нуклеиновой кислоты, вектора или клетки-хозяина, раскрытых в настоящей заявке, пациентпациенту, с целью предотвращения, лечения, задержки начала и/или прогрессии, уменьшения тяжести, стабилизации, модуляции, лечения или уменьшения интенсивности одного или более симптомов нарушения, связанного с ФНО-альфа. Как правило, связывающий элемент, нуклеиновая кислота, вектор или клетка-хозяин предоставляют в фармацевтической композиции, включающей их, как описано в настоящей заявке. Нуждающиеся в лечении включают имеющих нарушение, а также склонных к наличию нарушения, или тех, у кого требуется предотвратить нарушение (профилактика). Обычно лечение уменьшает, стабилизирует или замедляет прогрессию симптома, который связан с наличием и/или прогрессией заболевания или патологического состояния. Термин "введение" относится к способу введения соединения в клетки, физиологическую жидкость или ткань пациента. Термин "терапевтическое воздействие" относится к ингибированию или активации факторов, вызывающих или способствующих развитию патологического состояния. Терапевтическое воздействие облегчает в некоторой степени один или более симптомов патологического состояния или заболевания. Термин "аномальное состояние" относится к функции в клетках или тканях организма, у которых имеются отличия от их нормальных функций в данном организме.

[0100] Термин "специфичное связывание ФНО-альфа" при использовании в настоящей заявке описывает, что связывающий элемент связывается с ФНО-альфа с более высокой аффинностью, чем со структурно отличным антигеном, который не содержит эпитоп ФНО-альфа, с которым связывается связывающий элемент против ФНО-альфа. Специфичное связывание отражается равновесной константой диссоциации (KD) ниже 1 микромоля. Указанная константа может быть определена, например, при использовании кварцевых микровесов (QCM) в приборе Attana или технологии поверхностного плазмонного резонанса (SPR) в приборе BIACORE.

[0101] При использовании в настоящем описании, "чФНО-альфа" относится к ФНО-альфа человека и включает природный чФНО-альфа и рчФНО-альфа. "рФНО-альфа" относится к рекомбинантному ФНО-альфа. Рекомбинантный ФНО-альфа может иметь или может не иметь N-концевого остатка метионина, в зависимости от метода, которым он был получен. "рчФНО-альфа" бета относится к рекомбинантному ФНО-альфа человека. рчФНО-альфа может быть получен, например, от Peprotech, USA, номер по кат. 300-01A. ФНО-альфа также может быть получен при выделении из биологических образцов человеческого или нечеловеческого происхождения.

[0102] "Вариант" относится к аминокислотной или нуклеотидной последовательности, которая отличается от исходной последовательности вследствие добавления (в том числе вставок), делеции и/или замены одного или более аминокислотных остатков или нуклеотидных оснований, с сохранением по меньшей мере одной требуемой активности исходной последовательности, раскрытой в настоящем описании. В случае антител такая требуемая активность может включать специфичное связывание антигена. Аналогично, вариант последовательности нуклеиновой кислоты может быть изменен по сравнению с исходной последовательностью в результате добавления, делеции и/или замены одного или более нуклеотидных оснований, но при этом кодируемое антитело сохраняет требуемую активность, как описано выше. Варианты могут быть природными, такими как аллельные или сплайс-варианты, или могут быть искусственно сконструированными.

[0103] Реакции гибридизации нуклеиновых кислот могут быть выполнены при условиях различной строгости. "Строгие условия" широко известны и описаны в уровне техники. Как правило, во время реакции гибридизации может использоваться буфер на основе SSC, где SSC представляет собой 0,15 М NaCl и 15 мМ цитратный буфер, имеющий pH 7,0. Увеличение концентраций буфера и присутствие денатурирующего агента повышает строгость этапа гибридизации. Например, условия гибридизации высокой строгости могут включать использование: (i) 50% (об./об.) формамида, 5×SSC (0,75 М NaCl, 0,075 М цитрата натрия), 50 мМ фосфата натрия (pH 6,8), 0,1% пирофосфата натрия, 5×раствора Денхардта, обработанной ультразвуком ДНК спермы лосося (50 мкг/мл), 0,1% ДСН и 10% декстрансульфата при 42°C с промывкой при 42°C в 0,2×SSC и 0,1% ДСН; (ii) 50% (об/об) формамида с 0,1% бычьего сывороточного альбумина/0,1% фиколла/0,1% поливинилпирролидона/50 мМ натрий-фосфатного буфера при pH 6,5 с 750 мМ хлорида натрия, 75 мМ цитрата натрия при 42°C, или (iii) 10% декстрансульфата, 2×SSC и 50% формамида при 55°C, с последующей промывкой высокой строгости, состоящей из 0,1×SSC, содержащего ЭДТА, при 55°C. Дополнительно или альтернативно, один, два или более этапов промывки с использованием растворов для промывки с низкой ионной силой и при высокой температуре могут быть включены в методику гибридизации при использовании, например, 0,015 М хлорида натрия/0,0015 М цитрата натрия/0,1% додецилсульфата натрия при 50°C.

[0104] Охват и значение при любом использовании какого-либо термина будут очевидны из определенного контекста, в котором используется термин. Некоторые дополнительные определения отдельных терминов, используемых по всему тексту настоящего документа, приведены в соответствующем контексте подробного описания, в зависимости от обстоятельств.

[0105] Термины "включающий", "содержащий", "имеющий" и т.д. следует читать как широкие или открытые и без ограничения. Формы единственного числа в оригинальном тексте настоящей заявки, такие как "a", "an" или "the", включают множественные ссылки, если из контекста прямо не следует иное. Таким образом, например, ссылка на "вектор" включает один вектор, а также множество векторов, одинаковых, например, такой же оперон, или различных. Аналогичным образом, ссылка на "клетку" включает одну клетку, а также множество клеток. Если не указано иное, термин "по меньшей мере", предшествующий ряду элементов, следует понимать как относящийся к каждому элементу в ряду. Термины "по меньшей мере один" и "по меньшей мере один из" включают например, один, два, три, четыре или пять, или больше элементов. Кроме того, подразумевается, что небольшие изменения выше и ниже установленного диапазона могут использоваться с достижением по существу таких же результатов, как в случае значения в пределах указанного диапазона. Кроме того, если не указано иное, раскрытие диапазонов предполагается как непрерывный диапазон, включающий каждое значение между минимальным и максимальным значениями.

[0106] Охват и значение любого используемого термина будут очевидны из определенного контекста, в котором используется термин. Некоторые дополнительные определения отдельных терминов, используемых по всему тексту настоящего документа, приведены в соответствующем контексте подробного описания, в зависимости от обстоятельств.

[0107] Различные аспекты описания более подробно описаны в следующих подразделах. Необходимо понимать, что различные варианты осуществления, предпочтения и диапазоны можно комбинировать по усмотрению. Кроме того, в зависимости от определенного варианта осуществления, выбранные определения, варианты осуществления или диапазоны могут не использоваться.

Описание связывающего элемента/антитела

[0108] Связывающий элемент, предложенный в настоящей заявке, в некоторых вариантах осуществления является белковой связывающей молекулой, специфичной к ФНО-альфа. Белковая связывающая молекула обычно имеет иммуноглобулиноподобную функцию. В некоторых вариантах осуществления связывающий элемент по существу состоит из белковой связывающей молекулы, специфичной к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент включает белковую связывающую молекулу, специфичную к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент является фрагментом антитела, специфичным к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент по существу состоит из фрагмента антитела, специфичного к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент включает фрагмент антитела, специфичный к ФНО-альфа. Связывающий элемент в некоторых вариантах осуществления является молекулой полноразмерного иммуноглобулина, специфичного к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент по существу состоит из молекулы полноразмерного иммуноглобулина, специфичного к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент включает молекулу полноразмерного иммуноглобулина, специфичного к ФНО-альфа. Связывающий элемент в некоторых вариантах осуществления является неиммуноглобулиновым каркасом, специфичным к ФНО-альфа. Неиммуноглобулиновый каркас обычно обладает иммуноглобулиноподобной функцией. В некоторых вариантах осуществления связывающий элемент по существу состоит из неиммуноглобулинового каркаса, специфичного к ФНО-альфа. В некоторых вариантах осуществления связывающий элемент включает неиммуноглобулиновый каркас, специфичный к ФНО-альфа.

[0109] Связывающий элемент обладает специфичностью связывания с ФНО-альфа, то есть он специфично связывается с ФНО-альфа. В некоторых вариантах осуществления связывающий элемент специфично связывается только с ФНО-альфа, но не связывается с какой-либо дополнительной мишенью. В некоторых вариантах осуществления связывающий элемент является биспецифическим в том аспекте, что он специфично связывается с ФНО-альфа, с которым он связывается на двух различных эпитопах. В некоторых вариантах осуществления связывающий элемент является биспецифическим в том аспекте, что он специфично связывается с ФНО-альфа и, кроме того, также связывается с дополнительной мишенью. В некоторых вариантах осуществления связывающий элемент является мультиспецифическим, то есть он специфично связывается с ФНО-альфа и, кроме того, также связывается с более чем одной дополнительной мишенью. Связывающий элемент в некоторых вариантах осуществления является моновалентным связывающим элементом против ФНО-альфа. Связывающий элемент связывается с ФНО-альфа аналогично иммуноглобулину. В некоторых вариантах осуществления связывающий элемент является иммуноглобулином или его фрагментом. Связывающий элемент, специфично направленный против ФНО-альфа, как правило, определяется одной молекулой. Такая молекула обычно является белковой. Связывающий элемент может иметь одну, две или более цепей. В том случае, когда связывающий элемент включает множество цепей, две или больше таких цепей могут быть ковалентно или нековалентно связаны друг с другом.

[0110] Связывающий элемент, такой как моновалентный связывающий элемент, ингибирует биологическое действие растворимого ФНО-альфа человека с IC50 ниже 50 пМ. В некоторых вариантах осуществления IC50 ниже чем приблизительно 40 пМ. IC50 в некоторых вариантах осуществления имеет значение приблизительно 30 пМ или меньше.

[0111] В некоторых вариантах осуществления моновалентный связывающий элемент является фрагментом антитела. Соответствующий фрагмент антитела, как правило, имеет молекулярную массу приблизительно 60 кДа или ниже. В некоторых вариантах осуществления фрагмент антитела имеет молекулярную массу приблизительно 55 кДа или меньше. Молекулярная масса фрагмента антитела в некоторых вариантах осуществления составляет приблизительно 50 кДа или меньше. В некоторых вариантах осуществления фрагмент антитела имеет молекулярную массу приблизительно 45 кДа или меньше. В некоторых вариантах осуществления молекулярная масса составляет приблизительно 40 кДа или приблизительно 35 кДа или меньше. Молекулярная масса фрагмента антитела в некоторых вариантах осуществления составляет приблизительно 30 кДа или 25 кДа. В некоторых вариантах осуществления фрагмент антитела имеет молекулярную массу меньше 30 кДа или меньше 25 кДа. Молекулярная масса фрагмента антитела в некоторых вариантах осуществления составляет приблизительно 23 кДа или меньше, или приблизительно 24 кДа или меньше. В некоторых вариантах осуществления фрагмент антитела имеет молекулярную массу приблизительно 25 кДа или меньше, или приблизительно 26 кДа или меньше. Молекулярная масса фрагмента антитела в некоторых вариантах осуществления составляет 27 кДа или меньше.

[0112] В одном аспекте предложен связывающий элемент, направленный против ФНО-альфа. Специфичность связывания связывающего элемента может быть проверена с использованием методик, известных в уровне техники. Множество стандартных технологий дисплея доступно для измерения характеристик связывания связывающего элемента, такого как иммуноглобулин, фрагмент иммуноглобулина или белковая связывающая молекула. Ли с сотр. (Li et al., Organic & Biomolecular Chemistry (2006), 4, 3420-3426), например, продемонстрировали, каким образом одноцепочечный Fv фрагмент, способный образовывать комплекс с выбранным ДНК адаптером, может быть получен при использовании фагового дисплея. Методики дисплея, например, позволяют получать сконструированные иммуноглобулины и лиганды с высокими аффинностями в отношении выбранной молекулы-мишени. Таким образом, также можно проводить скрининг ряда пептидов или белков, которые имеют лишь малые отличия, обычно с помощью генной инженерии. Таким образом, можно проводить скрининг и затем создавать белки или пептиды с учетом свойств взаимодействия и биофизических параметров. Многократные раунды мутации и отбора могут быть применены in vitro.

[0113] Технология in vitro дисплея для отбора пептидов и белков основана на физической связи между пептидом или белком и нуклеиновой кислотой, кодирующей их. С этой целью была создана большая группа методик, при этом наиболее часто используют фаговый/вирусный дисплей, рибосомный дисплей, поверхностный клеточный дисплей, 'пептиды на плазмидах', мРНК дисплей, ДНК дисплей и компартментализацию in vitro, включающую дисплей на микросферах (см., например, обзоры Rothe, A., et al., FASEB J. (2006) 20, 1599-1610; Sergeeva, A., et al., Advanced Drug Delivery Reviews (2006) 58, 1622-1654).

[0114] Различные способы физического соединения пептида, включая белок, и нуклеиновой кислоты также доступны. Экспрессия в клетке с молекулой клеточной поверхности, экспрессия в виде слитого полипептида с вирусным/фаговым белком оболочки, стабилизированный in vitro комплекс молекулы РНК, рибосомы и соответствующего полипептида, ковалентное связывание in vitro через молекулу пуромицина или через микросферы являются примерами способов связывания белка/пептида и нуклеиновой кислоты, используемых в настоящее время в данной области. Другая методика дисплея основана на эмульсии "вода в масле". Капли воды служат в качестве камер, в каждой из которых транскрибируется и транслируется один ген (Tawfik, D.S., & Griffiths, A.D., Nature Biotech. (1998) 16, 652-656, US patent application 2007/0105117). Такая физическая связь между пептидом, включая белок, и нуклеиновой кислотой (кодирующей его) дает возможность выделения нуклеиновой кислоты, кодирующей выбранный пептид/белок. По сравнению с такими методиками, как иммунопреципитация, в методиках дисплея, таким образом, могут быть идентифицированы или отобраны не только партнеры связывания выбранной молекулы-мишени, но и нуклеиновая кислота этого партнера связывания может быть выделена и использована для дальнейшей обработки. Существующие методики дисплея, таким образом, обеспечивают способы, например, обнаружения мишени, обнаружения контакта и оптимизации контакта. Обширные библиотеки пептидов или белков, например, антител, потенциально можно использовать для крупномасштабного скрининга.

[0115] ФНО-альфа, с которым специфично связывается связывающий элемент, является цитокином, который среди прочего участвует в регуляции иммунных клеток. ФНО-альфа участвует в нарушениях, связанных с иммунной системой организма, включающих аутоиммунные нарушения и иммунно-опосредованные нарушения. ФНО-альфа в некоторых вариантах осуществления является человеческим ФНО-альфа, который существует в растворимой форме и в мембранной форме. Мембранная форма имеет внутриклеточный домен, трансмембранный домен и внеклеточный домен. Растворимая форма соответствует аминокислотным положениям 77-233 из 233 аминокислот мембранной формы. Мембранная форма человеческого ФНО-альфа имеет регистрационный номер в базе Uniprot/Swissprot P01375 (версия 202 от 4 марта 2015 года).

[0116] ФНО-альфа из других видов также существует в форме растворимой молекулы и трансмембранного белка. Например, собачий ФНО-альфа имеет длину 233 аминокислот, из которых внеклеточный домен охватывает аминокислоты 57-233. Растворимая форма охватывает аминокислотные положения 77-233 (сравнить регистрационный номер в базе Uniprot/Swissprot P51742, версия 112 от 4 марта 2015 года). В некоторых вариантах осуществления ФНО-альфа, с которым специфично связывается связывающий элемент, является мышиным ФНО-альфа, который имеет регистрационный номер в базе Uniprot/Swissprot P06804 (версия 167 от 4 марта 2015 года). В некоторых вариантах осуществления ФНО-альфа, с которым специфично связывается связывающий элемент, является кошачьим ФНО-альфа, который имеет регистрационный номер в базе Uniprot/Swissprot P19101 (версия 110 от 7 января 2015 года). ФНО-альфа, с которым специфично связывается связывающий элемент, в некоторых вариантах осуществления является бычьим ФНО-альфа, который имеет регистрационный номер в базе Uniprot/Swissprot Q06599 (версия 129 от 4 марта 2015 года). В некоторых вариантах осуществления ФНО-альфа является ФНО-альфа морской свинки, который имеет регистрационный номер в базе Uniprot/Swissprot P51435 (версия 106 от 4 марта 2015 года). ФНО-альфа в некоторых вариантов осуществления является собачьим ФНО-альфа, который имеет регистрационный номер в базе Uniprot/Swissprot P51742 (версия 112 от 4 марта 2015 года). В некоторых вариантах осуществления ФНО-альфа, с которым специфично связывается связывающий элемент, является ФНО-альфа макака-резуса, который имеет регистрационный номер в базе Uniprot/Swissprot P48094 (версия 108 от 4 марта 2015 года).

[0117] Связывающий элемент, раскрытый в настоящей заявке, может включать по меньшей мере одну из VH CDR последовательностей CDR-H1, CDR-H2 и CDR-H3, представленных в SEQ ID No: 6, 7 и 8, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает больше одной из VH CDR последовательностей CDR-H1, CDR-H2 и CDR-H3, представленных в SEQ ID No: 6, 7 и 8, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает все VH CDR последовательности CDR-H1, CDR-H2 и CDR-H3, представленные в SEQ ID No: 6, 7 и 8, соответственно, или их варианты. Связывающий элемент может также включать по меньшей мере одну из VL CDR последовательностей CDR-L1, CDR-L2 и CDR-L3, представленных в SEQ ID No: 3, 4 и 5, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает больше одной из VL CDR последовательностей CDR-L1, CDR-L2 и CDR-L3, представленных в SEQ ID No: 3, 4 и 5, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает все VL CDR последовательности CDR-L1, CDR-L2 и CDR-L3, представленные в SEQ ID No: 3, 4 и 5, соответственно, или их варианты.

[0118] В некоторых вариантах осуществления связывающий элемент включает по меньшей мере одну из VH CDR последовательностей CDR-H1, CDR-H2 и CDR-H3, представленных в SEQ ID No: 6, 7 и 8, соответственно, или их варианты, но не включает ни одну из VL CDR последовательностей CDR-L1, CDR-L2 и CDR-L3, представленных в SEQ ID No: 3, 4 и 5, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает по меньшей мере одную из VH CDR последовательностей CDR-H1, CDR-H2 и CDR-H3, представленных в SEQ ID No: 6, 7 и 8, соответственно, или их варианты, и по меньшей мере одну из VL CDR последовательностей CDR-L1, CDR-L2 и CDR-L3, представленных в SEQ ID No: 3, 4 и 5, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает все VH CDR последовательности CDR-H1, CDR-H2 и CDR-H3, представленные в SEQ ID No: 6, 7 и 8, соответственно, или их варианты, и по меньшей мере одну из VL CDR последовательностей CDR-L1, CDR-L2 и CDR-L3, представленных в SEQ ID No: 3, 4 и 5, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает по меньшей мере одну из VH CDR последовательностей CDR-H1, CDR-H2 и CDR-H3, представленных в SEQ ID No: 6, 7 и 8, соответственно, или их варианты, и все VL CDR последовательности CDR-L1, CDR-L2 и CDR-L3, представленные в SEQ ID No: 3, 4 и 5, соответственно, или их варианты. В некоторых вариантах осуществления связывающий элемент включает все VH CDR последовательности CDR-H1, CDR-H2 и CDR-H3, представленные в SEQ ID No: 6, 7 и 8, соответственно, или их варианты, и все VL CDR последовательности CDR-L1, CDR-L2 и CDR-L3, представленные в SEQ ID No: 3, 4 и 5, соответственно, или их варианты.

[0119] Такой связывающий элемент способен к нейтрализации растворимого ФНО-альфа человека с IC50 ниже 50 пМ. В некоторых вариантах осуществления связывающий элемент способен к нейтрализации растворимого ФНО-альфа человека с IC50 ниже чем приблизительно 40 пМ. В некоторых вариантах осуществления связывающий элемент способен к нейтрализации растворимого ФНО-альфа человека с IC50 ниже чем приблизительно 30 пМ или меньше.

[0120] IC50 можно, например, определить при использовании клеточного анализа активности. В некоторых вариантах осуществления значение IC50 выше определяют при ингибировании индуцированной ФНО-альфа цитотоксичности в клетках PK-15 в присутствии 1,4 пМ рчФНО-альфа. В типовых вариантах осуществления используют приблизительно 10000 клеток, и связывающий элемент титруют при 37°C. Клетки обычно инкубируют со смесью связывающего элемента и растворимого ФНО-альфа в течение 12-16 часов, в некоторых вариантах осуществления - в течение 16 часов. Предпочтительно, значение IC50 является средним значением, полученным по меньшей мере из трех независимых повторов такого анализа. В одном варианте осуществления такой анализ является анализом PK-15, описанным в Примере 3.

[0121] Связывающий элемент также может быть способен к нейтрализации трансмембранного (тм) ФНО-альфа человека с IC50 ниже чем приблизительно 100 нМ. В некоторых вариантах осуществления это значение IC50 может быть ниже чем приблизительно 80 нМ или приблизительно 75 нМ. В некоторых вариантах осуществления связывающий элемент может быть способен к нейтрализации тм ФНО-альфа человека с IC50 ниже чем приблизительно 70 нМ. Связывающий элемент также может быть способен к нейтрализации тм ФНО-альфа человека с IC50 ниже чем приблизительно 65 нМ или приблизительно 60 нМ. В некоторых вариантах осуществления IC50 может быть ниже чем приблизительно 50 нМ. В некоторых вариантах осуществления связывающий элемент может быть способен к нейтрализации тм ФНО-альфа человека с IC50 ниже чем приблизительно 10 нМ.

[0122] IC50 для тмФНО-альфа может быть, например, измерено в анализе с использованием клеток HEK-Dual, чувствительных к ФНО-альфа, стимулированных тмФНО-альфа экспрессирующими клетками CHO. Например, такой анализ подробно описан в примере 3. В типичном примере 10000 клеток CHO/лунка, которые предварительно инкубировали со связывающим элементом, и 20000 чувствительных к ФНО-альфа HEK-Dual клеток/лунка использовали и культивировали при 37°C в течение 24 часов.

[0123] Таким образом, в некоторых вариантах осуществления предложен связывающий элемент, который способен к нейтрализации растворимого ФНО-альфа человека в большей степени, чем трансмембранного ФНО-альфа человека, где значение IC50 в отношении растворимого ФНО-альфа человека по меньшей мере в 100 раз лучше, чем значение IC50 в отношении трансмембранного ФНО-альфа человека. Иными словами, значение IC50 соответствующего связывающего элемента в отношении растворимого ФНО-альфа человека ниже в 100 раз или более по сравнению со значением IC50 того же связывающего элемента в отношении трансмембранного ФНО-альфа человека. Следовательно, связывающий элемент намного более эффективен при нейтрализации растворимого ФНО-альфа человека, чем при нейтрализации трансмембранного ФНО-альфа человека.

[0124] Связывающий элемент, описанный в настоящей заявке, может быть, например, антителом (таким как полноразмерный иммуноглобулин) или фрагментом антитела (таким как Fab, Fabʹ, F(abʹ)2, scFv, Fv фрагмент, нанотело, VHH или минимальная распознающая единица), или неиммуноглобулиновым каркасом.

[0125] В типовом варианте осуществления связывающий элемент и, в частности, моновалентный связывающий элемент, как описано выше, является scFv. VH и VL домены могут быть связаны в любой ориентации, VL-линкер-VH или VH-линкер-VL, гибким линкером. В предпочтительном варианте осуществления ориентация является VL-линкер-VH, то есть вариабельная область легкой цепи расположена на N-конце, а вариабельная область тяжелой цепи расположена на C-конце полипептида.

[0126] Связывающий элемент в некоторых вариантах осуществления является гуманизированным связывающим элементом. В некоторых вариантах осуществления связывающий элемент является гуманизированным антителом или фрагментом гуманизированного антитела.

[0127] В некоторых вариантах осуществления антитело и, в частности, фрагмент антитела, как раскрыто в настоящем описании, включают вариабельную область тяжелой цепи субтипа VH3. В некоторых вариантах осуществления антитело и, в частности, фрагмент антитела, как раскрыто в настоящем описании, включают вариабельную область легкой цепи субтипа Vкаппа1. В некоторых вариантах осуществления антитело и фрагмент антитела, как раскрыто в настоящем описании, включают вариабельную область тяжелой цепи субтипа VH3 и вариабельную область легкой цепи субтипа Vкаппа1. В некоторых вариантах осуществления антитело и фрагмент антитела, как раскрыто в настоящем описании, включают только вариабельную область тяжелой цепи субтипа VH3, но не включают вариабельную область легкой цепи субтипа Vкаппа1. В некоторых вариантах осуществления антитело и фрагмент антитела, как раскрыто в настоящем описании, включают только вариабельную область легкой цепи субтипа Vкаппа1, но не включают вариабельную область тяжелой цепи субтипа VH3.

[0128] Также представлены варианты последовательностей, раскрытых в настоящем описании. В некоторых вариантах осуществления последовательность VH является вариантом SEQ ID No: 2 и обладает по меньшей мере 85% идентичностью последовательности с SEQ ID No: 2. В некоторых вариантах осуществления последовательность VH является вариантом SEQ ID No: 2 и обладает по меньшей мере 85% идентичностью последовательности с SEQ ID No: 2. В некоторых вариантах осуществления последовательность VH является вариантом SEQ ID No: 2 и обладает по меньшей мере 90% идентичностью последовательности с SEQ ID No: 2. В некоторых вариантах осуществления последовательность VH является вариантом SEQ ID No: 2 и обладает по меньшей мере 91% идентичностью последовательности с SEQ ID No: 2. В некоторых вариантах осуществления последовательность VH является вариантом SEQ ID No: 2 и обладает по меньшей мере 92% или 93% идентичностью последовательности с SEQ ID No: 2. В некоторых вариантах осуществления соответствующий вариант SEQ ID No: 2 обладает по меньшей мере 93% или 94% идентичностью последовательности с SEQ ID No: 2. В некоторых вариантах осуществления последовательность VH является вариантом SEQ ID No: 2 и обладает по меньшей мере 94%, по меньшей мере 95%, по меньшей мере 96%, по меньшей мере 97%, по меньшей мере 98% или по меньшей мере 99% идентичностью последовательности с SEQ ID No: 2. В некоторых вариантах осуществления последовательность VH является вариантом SEQ ID No: 2 и обладает 100% идентичностью последовательности с SEQ ID No: 2.

[0129] Дополнительно или альтернативно, связывающий элемент, раскрытый в настоящем описании, является антителом, которое включает вариант VL последовательности SEQ ID No: 1, обладающий по меньшей мере 85% идентичностью последовательности с последовательностью SEQ ID No: 1. В некоторых вариантах осуществления антитело или вариант включают вариабельную легкую цепь, которая включает последовательность, которая обладает по меньшей мере 90% идентичностью последовательности с SEQ ID No: 1. В некоторых вариантах осуществления антитело или вариант включают вариабельную легкую цепь, которая по существу состоит из последовательности, которая обладает по меньшей мере 90% идентичностью последовательности с SEQ ID No: 1. В некоторых вариантах осуществления антитело или вариант включают вариабельную легкую цепь, которая состоит из последовательности, которая обладает по меньшей мере 90% идентичностью последовательности с SEQ ID No: 1. В некоторых вариантах осуществления связывающий элемент является антителом, включающим вариант VL последовательности SEQ ID No: 1, обладающий 91% или большей, включая 92% или более, идентичностью последовательности с SEQ ID No: 1. Связывающий элемент в некоторых вариантах осуществления является антителом, которое содержит вариант VL последовательности SEQ ID No: 1 с последовательностью, которая обладает 93% или большей, включая 94% или более, идентичностью последовательности с последовательностью SEQ ID No: 1. В некоторых вариантах осуществления связывающий элемент является антителом, которое содержит вариант VL последовательности SEQ ID No: 1, который обладает 95% или большей, включая 96% или более, идентичностью последовательности с SEQ ID No: 1. В некоторых вариантах осуществления VL последовательность является вариантом SEQ ID No: 1 и обладает по меньшей мере 97% идентичностью последовательности с SEQ ID No: 1. В некоторых вариантах осуществления VL последовательность является вариантом SEQ ID No: 1 и обладает 97% или большей, включая 98% или более, идентичностью последовательности с SEQ ID No: 1. Связывающий элемент в некоторых вариантах осуществления является антителом, которое включает вариант VL последовательности SEQ ID No: 1, обладающий по меньшей мере 99% идентичностью последовательности с последовательностью SEQ ID No: 1. В некоторых вариантах осуществления VL последовательность является вариантом SEQ ID No: 1 и обладает 100% идентичностью последовательности с SEQ ID No: 1.

[0130] В одном варианте осуществления такое антитело включает VH последовательность, обладающую 85% или большим, например, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или большим, и предпочтительно 100% подобием последовательности с SEQ ID No: 2. Дополнительно или альтернативно, антитело включает VL последовательность, которая обладает 85% или большим, например, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% или большим, и предпочтительно 100% подобием последовательности с SEQ ID No: 1.

[0131] В предпочтительном варианте осуществления антитело включает VH, представленную в SEQ ID No: 1, и VL, представленную в SEQ ID No: 2, или их варианты. Каркасные последовательности SEQ ID No: 1 и 2 получены из человеческого иммуноглобулина, описанного в WO 03/097697 (ESBATech AG). Его VH и VL каркасные последовательности были модифицированы для гуманизации и стабилизации антител кролика, см., например, WO 2009/155726 (ESBATech, AN ALCON BIOMEDICAL RESEARCH UNIT LLC; BORRAS, L., et al. Generic approach for the generation of stable humanized single-chain Fv fragments from rabbit monoclonal antibodies. JBC 2010, vol. 285, no. 12, p. 9054-9066). Варианты SEQ ID No: 1, 2, 11 или 12 должны оставаться стабильными в формате scFv, то есть они остаются мономерными в высокой степени после длительного инкубирования. Например, "остается мономерным в высокой степени после длительного инкубирования" при использовании в настоящем описании относится, например, к содержанию мономера по меньшей мере 80% при концентрации 10 мг/мл в PBS, pH 7,2 (фосфатно-солевой буфер), при 4°C, 22°C или 37°C после 2 недель инкубирования.

[0132] Связывающий элемент, в особенности в случае scFv, может включать линкерную последовательность. Такая линкерная последовательность обычно содержит от десяти до приблизительно 25 аминокислот. Обычно такой линкерный пептид содержит большое количество глицинов, которые придают гибкость, а также серинов и/или треонинов для улучшения растворимости. В предпочтительном варианте осуществления используется линкер (GGGGS)4 (SEQ ID No: 10) или его вариант. Также могут использоваться вариации этого мотива, содержащие три - пять повторов. Другие подходящие линкеры описаны, например, в ALFTHAN, K. Properties of a single-chain antibody containing different linker peptides. Prot Eng 1995, vol. 8, no. 7, p. 725-731.

[0133] Таким образом, в некоторых вариантах осуществления связывающий элемент имеет аминокислотную последовательность, которая включает SEQ ID No: 9. В некоторых вариантах осуществления связывающий элемент имеет аминокислотную последовательность, которая по существу состоит из SEQ ID No: 9. В одном варианте осуществления связывающий элемент имеет аминокислотную последовательность, которая состоит из SEQ ID No: 9.

[0134] В некоторых вариантах осуществления рассматриваются варианты связывающего элемента, предложенного в настоящей заявке. Например, может потребоваться улучшить связывание антигена, антителозависимую клеточно-опосредованную цитотоксичность (ADCC), комплементзависимую цитотоксичность (CDC), уменьшить чувствительность к протеолизу и/или чувствительность к окислению, увеличить стабильность или растворимость, уменьшить иммуногенность и/или изменить другие биологические, биохимические или биофизические свойства связывающего элемента. В некоторых вариантах осуществления вариант не демонстрирует какое-либо улучшение по сравнению с исходным связывающим элементом. Вариант в некоторых вариантах осуществления может быть белковой молекулой, которая отличается от данного связывающего элемента в одном, двум или более положениях своей аминокислотной последовательности. Обычно отличием от данного связывающего элемента является замена. В некоторых вариантах осуществления отличием от данного связывающего элемента является делеция. Вариант может быть мутеином, то есть пептидом/белком, полученным при экспрессии генной последовательности, измененной посредством сайт-специфического мутагенеза.

[0135] Варианты связывающих элементов, предложенные в настоящей заявке, могут быть получены с помощью белковой и/или химической инженерии, путем введения соответствующих модификаций в последовательность нуклеиновой кислоты, кодирующую связывающий элемент, или путем белкового/пептидного синтеза. Вариант может быть получен посредством любой комбинации(й) одной или более делеций, замен, добавлений и вставок в каркасную область или участки CDR, при условии, что полученный связывающий элемент обладает требуемыми характеристиками, на предмет которых он может быть подвергнут скринингу с использованием подходящих методов. В некоторых вариантах осуществления вариант связывающего элемента отличается от конкретной последовательности связывающего элемента, определенного в настоящей заявке, одной или двумя заменами. В некоторых вариантах осуществления вариант связывающего элемента отличается от конкретной последовательности связывающего элемента, определенного в настоящей заявке, заменами в количестве до пяти. Замена в аминокислотной последовательности связывающего элемента может быть консервативной заменой, как описано выше. Примеры консервативных замен включают:

1. Замену аланина (A) валином (V);

2. Замену аргинина (R) лизином (K);

3. Замену аспарагина (N) глутамином (Q);

4. Замену аспарагиновой кислоты (D) глутаминовой кислотой (E);

5. Замену цистеина (C) серином (S);

6. Замену глутаминовой кислоты (E) аспарагиновой кислотой (D);

7. Замену глицина (G) аланином (A);

8. Замену гистидина (H) аргинином (R) или лизином (K);

9. Замену изолейцина (I) лейцином (L);

10. Замену метионина (M) лейцином (L);

11. Замену фенилаланина (F) тирозином (Y);

12. Замену пролина (P) аланином (A);

13. Замену серина (S) треонином (T);

14. Замену триптофана (W) тирозином (Y);

15. Замену фенилаланина (F) триптофаном (W);

и/или

16. Замену валина (V) лейцином (L)

и наоборот.

[0136] Последовательности, описанные в настоящей заявке, могут включать одну или более, например две или три, из таких консервативных замен. В некоторых вариантах осуществления связывающий элемент, раскрытый в настоящей заявке, включает последовательность, которая содержит четыре или более консервативных замен по сравнению с последовательностью, раскрытой в настоящей заявке. В некоторых вариантах осуществления связывающий элемент включает последовательность, которая содержит пять или более консервативных замен. В некоторых вариантах осуществления связывающий элемент содержит шесть или более, например семь или более, консервативных замен по сравнению с последовательностью, раскрытой в настоящей заявке. В некоторых вариантах осуществления связывающий элемент может включать восемь, девять, десять, одиннадцать, двенадцать или более таких консервативных замен.

[0137] Неконсервативные замены могут привести к большему количеству существенных изменений, например, в отношении заряда, дипольного момента, размера, гидрофильности, гидрофобности или конформации полипептида. В одном варианте осуществления связывающий элемент включает одну или более, например две, три, четыре, пять, шесть, семь, восемь, девять, десять, одиннадцать, двенадцать или более, таких неконсервативных замен.

[0138] Модификации могут присутствовать в участках CDR или в каркасных последовательностях. Например, CDR, предложенные в настоящей заявке, могут включать одну, две, три, четыре, пять или даже больше модификаций. Например, последовательности CDR-L1, CDR-L2 и CDR-L3, взятые как целое, являются на 75% или более, например, на 76% или более, 77% или более, 78% или более, 79% или более, 80% или более, 85% или более, 90% или более, 91% или более, 92% или более, 93% или более, 94% или более, 95% или более, 96% или более, 97% или более, 98% или более, и предпочтительно на 99% или более идентичными последовательностям CDR, предложенным в настоящей заявке, в частности последовательностям (i) SEQ ID No: 3, 4 и 5. Дополнительно или альтернативно, последовательности CDR-H1, CDR-H2 и CDR-H3, взятые как целое, являются по меньшей мере на 80%, например, по меньшей мере на 81%, 82%, 83%, 84%, 95%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или предпочтительно на 99% идентичными последовательностям CDR, предложенным в настоящей заявке, в частности последовательностям (i) SEQ ID No: 6, 7 и 8.

[0139] В одном варианте осуществления CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 и CDR-H3, взятые как целое, являются по меньшей мере на 85%, например, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или предпочтительно на 99% подобными последовательностям CDR, предложенным в настоящей заявке. Дополнительно или альтернативно, CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 и CDR-H3, взятые как целое, являются по меньшей мере на 85%, например, на 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или предпочтительно на 99% подобными последовательностям CDR, предложенным в настоящей заявке.

[0140] Дополнительно или альтернативно, вариант может включать одну или две замены в любой из последовательностей SEQ ID No: 1-10. В некоторых вариантах осуществления вариант включает три замены в любой из последовательностей SEQ ID No: 1-10. В некоторых вариантах осуществления вариант включает четыре замены в любой из последовательностей SEQ ID No: 1-10.

[0141] Предпочтительный тип варианта является таким, в котором одна или более CDR заменены. Как правило, CDR-H3 и CDR-L3 вносят наиболее значительный вклад в связывание антигена. Например, все CDR-L1, CDR-L2, CDR-H1 и/или CDR-H2 могут быть заменены другими CDR природного или искусственного происхождения. В некоторых вариантах осуществления одна или более CDR заменены аланиновой кассетой.

[0142] Дополнительно или альтернативно, VH область антитела может включать одну или более улучшающих растворимость точечных мутаций. В WO2009/155725 (ESBATech, a Novartis Company) описан мотив, который, как оказалось, повышал общую растворимость антитела. Остатки помещены в положения, расположенные в интерфейсе вариабельного домена и константного домена антитела, и стабилизируются в определенных фрагментах антитела, таких как scFv, не имеющих константного домена. В частности, присутствуют один или два следующих остатков:

(i) серин (S) в аминокислотном положении 12 тяжелой цепи (согласно нумерации AHo);

(ii) серин (S) или треонин (T) в аминокислотном положении 103 тяжелой цепи (согласно нумерации AHo); и/или

(iii) серин (S) или треонин (T) в аминокислотном положении 144 тяжелой цепи (согласно нумерации AHo).

В некоторых вариантах осуществления присутствуют все три указанных остатка.

[0143] В некоторых вариантах осуществления антитело содержит серин в положении 12 VH; серин в положении 103 VH; и треонин в положении 144 VH (все согласно нумерации AHo).

[0144] В некоторых вариантах осуществления вариант связывающего элемента, раскрытого в настоящей заявке, сохраняет, по сравнению со связывающим элементом, специфичное связывание с ФНО-альфа. Вариант может, например, сохранять специфичное связывание с человеческим ФНО-альфа. В некоторых вариантах осуществления вариант связывающего элемента, раскрытого в настоящей заявке, обладает активностью (IC50) в отношении ингибирования биологического действия растворимого ФНО-альфа человека ниже чем приблизительно 500 пМ. В некоторых вариантах осуществления активность варианта в отношении ингибирования биологического действия растворимого ФНО-альфа человека ниже чем приблизительно 400 пМ. IC50 варианта по сравнению со связывающим элементом в некоторых вариантах осуществления может быть ниже чем приблизительно 300 пМ, включая приблизительно 200 пМ, приблизительно 100 пМ или приблизительно 50 пМ. В одном варианте осуществления вариант связывающего элемента обладает активностью (IC50) в отношении ингибирования биологического действия растворимого ФНО-альфа человека ниже чем приблизительно 40 пМ, по сравнению со связывающим элементом.

[0145] Вариант связывающего элемента в некоторых вариантах осуществления способен ингибировать трансмембранный ФНО-альфа с активностью (IC50) ниже чем приблизительно 100 нМ, предпочтительно приблизительно 80 нМ или ниже. В некоторых вариантах осуществления вариант способен ингибировать трансмембранный ФНО-альфа с активностью (IC50) приблизительно 75 нМ или ниже. В некоторых вариантах осуществления вариант способен ингибировать трансмембранный ФНО-альфа с активностью (IC50) приблизительно 70 нМ или ниже, например, приблизительно 65 нМ или ниже. В некоторых вариантах осуществления вариант способен ингибировать трансмембранный ФНО-альфа с активностью (IC50) приблизительно 60 нМ или ниже.

[0146] Вариант связывающего элемента в некоторых вариантах осуществления обладает перекрестной реактивностью с человеческим и нечеловеческим ФНО-альфа. Вариант связывающего элемента в некоторых вариантах осуществления способен связываться с ФНО-альфа тех же видов, с какими связывается (исходный) связывающий элемент, например, ФНО-альфа яванского макака, собаки, кошки и/или макака-резуса. В некоторых вариантах осуществления вариант связывающего элемента конкурирует со связывающим элементом, раскрытым в настоящей заявке, за связывание с ФНО-альфа. Вариант может, например, конкурировать со связывающим элементом, раскрытым в настоящей заявке, за связывание с человеческим ФНО-альфа. В некоторых вариантах осуществления вариант способен конкурировать со связывающим элементом, раскрытым в настоящей заявке, за связывание с таким же нечеловеческим ФНО-альфа, с которым способен связываться связывающий элемент.

[0147] В некоторых вариантах осуществления вариант связывающего элемента, раскрытого в настоящей заявке, сохраняет специфичное связывание с ФНО-альфа; обладает активностью (IC50) в отношении ингибирования биологического действия растворимого ФНО-альфа человека ниже чем приблизительно 500 пМ, например, ниже чем 400 пМ, 300 пМ, 200 пМ, 100 пМ, 50 пМ, предпочтительно ниже 40 пМ; ингибирует трансмембранный ФНО-альфа с активностью IC50 ниже 100 нМ, предпочтительно ниже чем приблизительно 80 нМ, 75 нМ, 70 нМ, 65 нМ или 60 нМ; обладает перекрестной реактивностью с человеческим и нечеловеческим ФНО-альфа и связывается с ФНО-альфа тех же видов, что и исходный связывающий элемент, например, с ФНО-альфа яванского макака, собаки, кошки и/или макака-резуса; и конкурирует со связывающим элементом, раскрытым в настоящей заявке, за связывание с ФНО-альфа, таким как человеческий ФНО-альфа, и предпочтительно с тем же нечеловеческим ФНО-альфа, с которым связываются связывающие элементы.

[0148] Варианты могут быть также получены при перетасовке легких и тяжелых цепей. Одну легкую цепь можно комбинировать с библиотекой тяжелых цепей, с получением библиотеки вариантов. В одном варианте осуществления одна легкая цепь выбрана из группы последовательностей VL, указанных выше, и/или библиотека тяжелых цепей включает одну или более последовательностей VH, указанных выше. Аналогичным образом, одну тяжелая цепь можно комбинировать с библиотекой легких цепей. В некоторых вариантах осуществления одна тяжелая цепь выбрана из группы последовательностей VH, указанных выше, и/или библиотека легких цепей включает одну или более последовательностей VL, указанных выше.

[0149] Связывающий элемент может включать любую из последовательностей VL и/или VH, указанных выше. Связывающие элементы, имеющие однодоменный формат, такие как нанотело или VHH, включают только одну из последовательностей VL или VH, указанных выше, предпочтительно последовательности VH и VL являются моновалентными. Поливалентные связывающие элементы, такие как F(abʹ)2 фрагменты, бис-scFv (также известный как тандемный scFv) или диатела, в особенности биспецифические связывающие элементы, могут включать одну или больше указанных выше последовательностей VL и/или одну или более указанных выше последовательностей VH. Поливалентные связывающие элементы могут включать VH и/или VL последовательности, направленные против антигенов, отличных от ФНО-альфа.

[0150] Связывающие элементы, раскрытые в настоящей заявке, являются особо стабильными. В частности, моновалентные фрагменты антитела, раскрытые в настоящей заявке, и scFv, раскрытые в настоящей заявке, являются особо стабильными. При использовании в настоящем описании термин "стабильность" относится к биофизическому свойству полипептида оставаться мономерным в растворе после длительного инкубирования и/или инкубирования при повышенной температуре. Нестабильные полипептиды имеют тенденцию к димеризации или олигомеризации и даже преципитации, вследствие чего уменьшается время их хранения, и они становятся менее пригодными для фармацевтических применений.

[0151] Связывающие элементы, предложенные в настоящей заявке, и, в особенности, фрагмент моновалентного антитела, указанный выше, остается мономерным по меньшей мере на 75%, предпочтительно по меньшей мере на 80%, 85%, 90%, 95% и наиболее предпочтительно на 97% после инкубирования в течение 1 недели при 37°C в концентрации 10 мг/мл, в PBS при pH 7,2. Дополнительно или альтернативно, связывающий элемент, предложенный в настоящей заявке, и, в особенности, моновалентный фрагмент антитела, указанный выше, остается мономерным на 90% или больше после 1 недели при 4°C или при 22°C в концентрации 10 мг/мл, в PBS при pH 7,2. В некоторых вариантах осуществления связывающий элемент, раскрытый в настоящем описании, остается мономерным на 92% или больше, например, на 94% или больше, после 1 недели при 4°C или при 22°C в концентрации 10 мг/мл, в PBS при pH 7,2. В некоторых вариантах осуществления связывающий элемент остается мономерным на 95% или больше, например, на 96% или больше, или на 97% или больше, после 1 недели при 4°C или при 22°C в концентрации 10 мг/мл, в PBS при pH 7,2. В одном варианте осуществления связывающий элемент остается мономерным на 99% или больше после 1 недели при 4°C или при 22°C в концентрации 10 мг/мл, в PBS при pH 7,2.

[0152] Фракция мономеров может быть, например, определена с помощью Э-ВЭЖХ (эксклюзионной высокоэффективной жидкостной хроматографии). Подходящей подвижной фазой для такого анализа является, например, PBS pH 7,2. Содержание мономера может быть определено количественно при вычислении площади пиков сигнала UV280, измеренного во время белковой хроматографии. Подходящей системой является, например, Dionex UltiMate 3000 RS HPLC под управлением программы Chromeleon® 6.5, которая также позволяет выполнить последующий анализ хроматограммы и количественный анализ пиков.

[0153] Связывающий элемент, такой как моновалентный фрагмент антитела, включая scFv, может иметь теоретическую изоэлектрическую точку (pI) в диапазоне 5-10, предпочтительно 7-9. Теоретическая pI может быть, например, вычислена при использовании инструмента ProtParam на сервере ExPASy (доступном по адресу http://web.expasy.org/protparam/; см. также GASTEIGER E. et al. Protein Identification and Analysis Tools on the ExPASy Server. (In) The Proteomics Protocols Handbook. Edited by WALKER J.M. Totowa: Humana Press Inc., 2005. ISBN 9781588295934. p. 571-607).

[0154] Связывающий элемент, например, scFv, может быть сконцентрирован в PBS, pH 7,2, до концентраций выше 35 мг/мл, предпочтительно выше 40 мг/мл, 45 мг/мл, 47 мг/мл, 48 мг/мл, 49 мг/мл, наиболее предпочтительно выше 50 мг/мл. Чем выше может быть сконцентрирован связывающий элемент, тем выше растворимость связывающего элемента.

[0155] Связывающий элемент может обладать перекрестной реактивностью с ФНО-альфа из не относящихся к человеку видов, таким как, без ограничения, ФНО-альфа кошки, ФНО-альфа макака-резуса, ФНО-альфа собаки. Это особенно полезно в целях доклинического исследования, например, в исследованиях на животных. Предпочтительно связывающий элемент не обладает перекрестной реактивностью с человеческим лимфотоксином альфа2/бета1, человеческим лимфотоксином альфа1/бета2, человеческим CD40 лигандом/TNFSF5 и/или человеческим ФНО бета/TNFSF1.

[0156] Также предложен связывающий элемент, конкурирующий с антителом, как раскрыто в настоящей заявке, причем связывающий элемент предназначен для связывания с человеческим ФНО-альфа. Например, такой конкурирующий (или перекрестно-блокирующий) связывающий элемент может быть нейтрализирующим. В типовых вариантах осуществления такой связывающий элемент обладает активностью IC50 ниже 50 пМ при ингибировании индуцированной растворимым 1,4 пМ рчФНО-альфа цитотоксичности в клетках PK-15.

[0157] При использовании в настоящем описании термин "конкуренция" относится к конкуренции между связывающими элементами за связывание с одной мишенью. Конкуренция может быть определена с помощью конкурентных анализов связывания, в которых целевой связывающий элемент предотвращает или ингибирует, или уменьшает специфичное связывание связывающих элементов, раскрытых в настоящей заявке, с общим антигеном (в данном случае чФНО-альфа или его фрагментом). Такие конкурентные анализы связывания известны в уровне техники и включают, без ограничения, твердофазный прямой или непрямой радиоиммуноанализ (РИА) и твердофазный прямой или непрямой иммуноферментный анализ (ИФА). Как правило, такой анализ включает использование очищенного антигена, связанного на твердой поверхности, тестируемого связывающего элемента и референсного связывающего элемента, как описано в настоящей заявке. Конкурентное ингибирование измеряют путем определения количества либо (i) референсного связывающего элемента, связанного на твердой поверхности в присутствии тестируемого связывающего элемента, либо (ii) тестируемого связывающего элемента, связанного на твердой поверхности в присутствии референсного связывающего элемента. Конкурирующий связывающий элемент может связываться (i) с тем же эпитопом, что и референсный связывающий элемент, (ii) с перекрывающимся эпитопом, или (iii) с другим эпитопом на той же молекуле-мишени, но при этом стерически препятствовать связыванию референсного связывающего элемента с его мишенью.

[0158] Обычно в том случае, когда конкурирующий связывающий элемент присутствует в избытке, он уменьшает специфичное связывание связывающего элемента, как описано в настоящей заявке, с ФНО-альфа, то есть он перекрестно блокирует связывание, на 40-45% или больше. В случае, когда он присутствует в избытке, конкурирующий связывающий элемент в некоторых вариантах осуществления уменьшает специфичное связывание связывающего элемента с ФНО-альфа на 45-50% или больше, например, на 50-55% или больше, или на 55-60% или больше. В некоторых вариантах осуществления связывание связывающего элемента в присутствии конкурирующего связывающего элемента уменьшено на 60-65% или больше, на 65-70% или больше, на 70-75% или больше, или на 75% или больше. Предпочтительно связывание связывающего элемента, описанного в настоящей заявке, в присутствии конкурирующего связывающего элемента уменьшено на 80-85% или больше. В некоторых вариантах осуществления связывание связывающего элемента в присутствии конкурирующего связывающего элемента уменьшено на 85-90% или больше, включая 90-95% или больше. В некоторых вариантах осуществления связывание связывающего элемента в присутствии конкурирующего связывающего элемента уменьшено на 95-97% или больше. В некоторых вариантах осуществления связывание связывающего элемента в присутствии конкурирующего связывающего элемента уменьшено на 97% или больше.

[0159] В некоторых вариантах осуществления конкурирующий связывающий элемент связывается с чФНО-альфа с KD аффинности приблизительно 1 пМ или больше. В некоторых вариантах осуществления конкурирующий связывающий элемент связывается с чФНО-альфа с KD приблизительно 10 пМ или больше. В некоторых вариантах осуществления конкурирующий связывающий элемент связывается с чФНО-альфа с KD аффинности приблизительно 100 пМ или больше, например, 500 пМ или больше. Конкурирующий связывающий элемент в некоторых вариантах осуществления связывается с чФНО-альфа с KD приблизительно 1 нМ или больше. В некоторых вариантах осуществления конкурирующий связывающий элемент связывается с чФНО-альфа с KD приблизительно 10 нМ или больше.

[0160] Таким образом, в одном аспекте предложен связывающий элемент, который:

(i) способен к связыванию растворимого и трансмембранного ФНО-альфа;

(ii) нейтрализует растворимый ФНО-альфа с IC50 приблизительно 30±6 пМ при измерении по ингибированию индуцированной 1,4 пМ рчФНО-альфа цитотоксичности в клетках PK-15;

(iii) нейтрализует тмФНО-альфа с IC50 приблизительно 50 нМ при измерении в клетках HEK-Dual, чувствительных к ФНО-альфа, стимулируемых тм экспрессирующими клетками CHO; и/или

(iv) обладает перекрестной реактивностью с растворимым ФНО-альфа человека, макака-резуса, яванского макака, собаки и кошки. В одном варианте осуществления связывающий элемент включает по меньшей мере один, например по меньшей мере CDR-L3 и CDR-H3, предпочтительно все CDR, представленные в SEQ ID No: 3-8. В одном варианте осуществления связывающим элементом является scFv, который включает SEQ ID No: 9 и имеет следующие одну или более особенностей:

(v) является стабильным по меньшей мере на 90% при 4°C и концентрации 10 мг/мл в PBS, pH 7,2, в течение 6 месяцев;

(vi) является стабильным по меньшей мере на 95% при 4°C и концентрации 10 мг/мл в PBS, pH 7,2, в течение 2 недель;

(vii) имеет Тп 76°C; и/или

(viii) имеет pI 8,27.

[0161] В одном варианте осуществления связывающий элемент, раскрытый в настоящем описании, является моновалентным, таким как scFv или Fab фрагмент. В другом варианте осуществления связывающий элемент является поливалентным. Такая поливалентная молекула может быть бивалентной (такой как полноразмерный иммуноглобулин или F(abʹ)2 фрагмент) или включает по меньшей мере три целевых связывающих участка.

[0162] Поливалентный связывающий элемент может быть биспецифическим антителом, таким как диатело, одноцепочечное диатело или тандемный scFv (см., например, KONTERMANN, R.E. Methods in Molecular Biology. Edited by LO, B. Totowa, N.J.: Humana Press, 2004. ISBN 1588290921. p. 227-242). В соответствующем биспецифическом антителе может успешно использоваться более короткий линкер, чем линкеры, описанные выше для scFv, то есть содержащий только один - три повтора основного мотива SEQ ID NO: 14 (см., например, HOLLIGER, P., et al. Diabodies: small bivalent and bispecific antibody fragments. PNAS 1993, vol. 90, no. 14, p. 6444-6448). В другом варианте осуществления поливалентный связывающий элемент является триателом, минителом или тетрателом.

[0163] Также предложены T-тела, которые включают антитело, раскрытое в настоящей заявке. T-тела представляют собой Т-клеточные рецепторы иммуноглобулинов (cIgTCR), которые сочетают распознавание антигена антител с сигнальными и эффекторными свойствами комплекса Т-клеточного рецептора. В таких конструкциях антитело в некоторых вариантах осуществления является фрагментом антитела, таким как Fv, Fab, scFv или scFv-Fc. В одном варианте осуществления антителом является scFv. По поводу дополнительно обсуждения общей конструкции T-тел и их применения см., например, SCHIRRMANN, T. and Pecher, G. Handbook of Therapeutic Antibodies. Edited by DÜBEL, S. Weinheim: Wiley-VCH, 2009. ISBN 3527314539. p.533-561.

[0164] Связывающий элемент согласно настоящему описанию в некоторых вариантах осуществления может включать захватывающую группу, такую как стрептавидин-связывающая метка, например, STREP-TAGS®, описанный в заявке на патент США US 2003/0083474, патенте США 5,506,121 или 6,103,493. Другие примеры захватывающей группы включают, без ограничения, мальтозосвязывающий белок, глутатион-S-трансферазу (GST), кальмомодулин-связывающий пептид (CBP), FLAG-пептид (например, с последовательностью Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-Gly), эпитоп T7 (Ala-Ser-Met-Thr-Gly-Gly-Gln-Gln-Met-Gly), мальтозо-связывающий белок (MBP), эпитоп HSV с последовательностью Gln-Pro-Glu-Leu-Ala-Pro-Glu-Asp-Pro-Glu-Asp гликопротеина D вируса простого герпеса, эпитоп гликопротеина вируса везикулярного стоматита (VSV-G) с последовательностью Tyr-Thr-Asp-Ile-Glu-Met-Asn-Arg-Leu-Gly-Lys, эпитоп гемагглютинина (HA) с последовательностью Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala и эпитоп "myc" фактора транскрипции c-myc с последовательностью Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu.

[0165] Другим примером захватывающей группы является металлхелатирующий агент, который способен связывать ион металла. Соответствующей захватывающей группой может быть этилендиамин, этилендиаминтетрауксусная кислота (ЭДТА), этиленгликольтетрауксусная кислота (ЭГТА), диэтилентриаминпентауксусная кислота (ДТПА), N,N-бис(карбоксиметил)глицин (также названный нитрилотриуксусной кислотой, НТА), 1,2-бис(o-аминофенокси)-этан-N,N,N',N'-тетрауксусная кислота (BAPTA), 2,3-димеркапто-1-пропанол (димеркапрол), порфин или гем. В соответствии со стандартным методом аффинной хроматографии с иммобилизованными металлами, используемым в данной области, например, олигогистидиновая метка способна образовывать комплекс с ионами меди (Cu2+), никеля (Ni2+), кобальта (Co2+) или цинка (Zn2+), которые могут быть, например, представлены для хроматографических целей посредством хелатообразователя нитрилотриуксусной кислоты (НТА).

Нуклеиновые кислоты, векторы, клетки-хозяева и способ получения

[0166] Связывающий элемент, описанный в настоящей заявке, может кодировать одна последовательность нуклеиновой кислоты или множество последовательностей нуклеиновой кислоты. В случае множества последовательностей нуклеиновой кислоты каждая последовательность может кодировать одну вариабельную область. В некоторых вариантах осуществления последовательность нуклеиновой кислоты может кодировать две или более вариабельных областей. Как правило, множество последовательностей нуклеиновых кислот кодирует вариабельные области связывающего элемента. Обычно каждая вариабельная область кодируется одной отдельной последовательностью нуклеиновой кислоты. Соответствующие последовательности нуклеиновых кислот, кодирующие вариабельные области, могут быть включены в одну молекулу нуклеиновой кислоты. В некоторых вариантах осуществления две или более последовательностей нуклеиновых кислот, кодирующие вариабельные области, включены в одну молекулу нуклеиновой кислоты. В некоторых вариантах осуществления каждая последовательность нуклеиновой кислоты, кодирующая вариабельную область, включена в одну отдельную молекулу нуклеиновой кислоты. Таким образом, множество молекул нуклеиновых кислот могут использоваться в получении связывающего элемента, например, каждая кодирует по меньшей мере одну вариабельную область. Соответствующие молекулы нуклеиновых кислот в некоторых вариантах осуществления могут определять кассету экспрессии. Как указано выше, кассета экспрессии является молекулой нуклеиновой кислоты, способной направлять экспрессию определенной нуклеотидной последовательности в соответствующей клетке-хозяине.

[0167] Кассета экспрессии включает промотор, функционально связанный с целевой нуклеотидной последовательностью, которая функционально связана с одним или более сигналами терминации. Она может также включать последовательности, требуемые для надлежащей трансляции нуклеотидной последовательности. Кодирующая область может кодировать целевой полипептид и может также кодировать функциональную целевую РНК, включая, без ограничения, антисмысловую РНК или нетранслируемую РНК, в смысловом или антисмысловом направлении. Кассета экспрессии, включающая целевую нуклеотидную последовательность, может быть химерной, что означает то, что по меньшей мере один из ее компонентов является гетерологичным по отношению по меньшей мере к одному из ее других компонентов. Кассета экспрессии может быть также такой кассетой экспрессии, которая является природной, но была получена в рекомбинантной форме, применимой для гетерологичной экспрессии. В некоторых вариантах осуществления, тем не менее, кассета экспрессии является гетерологичной по отношению к хозяину; то есть определенная последовательность нуклеиновой кислоты в кассете экспрессии обычно не встречается в клетке-хозяине и была введена в клетку-хозяина или предшественника клетки-хозяина в процессе трансформации. Экспрессия нуклеотидной последовательности в кассете экспрессии может находиться под контролем конститутивного промотора или индуцируемого промотора, который инициирует транскрипцию только при воздействии на клетку-хозяина некоторого специфического внешнего стимула. В случае многоклеточного организма, такого как растение или животное, промотор может быть также специфическим для определенной ткани, органа или стадии развития.

[0168] Зная последовательность связывающего элемента или его частей, кДНК, кодирующие последовательность полипептида, могут быть получены способами, известными в уровне техники, например, путем синтеза гена. Такие кДНК можно клонировать с помощью стандартных методик клонирования и мутагенеза в подходящий вектор, такой как вектор экспрессии или вектор клонирования. Необязательно вариабельную легкую цепь кодирует отдельная нуклеиновая кислота, отличная от нуклеиновой кислоты, кодирующей вариабельную тяжелую цепь антитела. Кроме того, дополнительные последовательности, такие как метка (например, His-метка), константный домен для продукции Fab или полноразмерного иммуноглобулина, линкер, кодирующая последовательность с другой специфичностью связывания или другой функциональный полипептид, такой как фермент, для получения слитой конструкции или биспецифической молекулы могут быть включены в генетическую конструкцию.

[0169] В зависимости от выбранной стратегии клонирования, генетические конструкции могут давать связывающий элемент, имеющий один или более дополнительных остатков на N-конце или C-конце. Например, N-концевой метионин, полученный из старт-кодона, или дополнительный аланин могут присутствовать в экспрессируемом полипептиде, если они не были удалены после трансляции. Таким образом, следует понимать, что антитела, раскрытые в настоящей заявке, включают раскрытые последовательности, а не состоят из них. Таким образом, в одном варианте осуществления связывающий элемент имеет последовательность SEQ ID No: 9 или 19.

[0170] Основные методики стандартного клонирования, мутагенеза и методов молекулярной биологии описаны, например, в Molecular Cloning, A Laboratory Manual (GREEN, M. and Sambrook, J. Molecular Cloning: a Laboratory Manual. 4th edition. Cold Spring Harbor Laboratory, 2012. ISBN 1936113422.).

[0171] Подходящие клетки-хозяева для экспрессии генетических конструкций могут быть прокариотическими или эукариотическими. Подходящие прокариотические клетки-хозяева являются грамотрицательными или грамположительными и включают виды из семейств Escherichia, Erwinina, Enterobacter, Klebsiella, Pseudomonas или Bacillus. В некоторых вариантах осуществления клеткой-хозяином является Escherichia coli, например, один или более штаммов E. coli BL21 (DE3) (Life TechnologiesTM, номер по кат. C6000-03) и OrigamiTM 2(DE3) (Novagen, номер по кат. 71345).

[0172] Если требуются посттрансляционные модификации, такие как гликозилирование или фосфорилирование, может быть предпочтительным использование эукариотической клетки-хозяина. Например, эукариотические микроорганизмы, такие как обычно используемые штаммы Saccharomyces cerevisiae или Pichia pastoris, могут служить в качестве клетки-хозяина. Подходящие примеры клеток-хозяев также включают клетку растения или животного, в частности клетки насекомых или млекопитающих. Подходящие клетки млекопитающих включают, без ограничения, клетки яичников китайского хомячка (CHO), человеческие эмбриональные клетки почек (HEK), эндотелиальные клетки пупочной вены человека (HUVEC) или клетки миеломы NS0.

[0173] Связывающий элемент может быть получен путем экспрессии в подходящей клетке-хозяине. Например, векторы экспрессии, описанные выше, вводят в клетку-хозяина стандартными методами, такими как электропорация или химическая трансформация. Затем трансформированные клетки культивируют в условиях, подходящих для экспрессии рекомбинантного белка, обычно в подходящей питательной среде, необязательно модифицированной для индукции промоторов, отбора трансформантов или амплификации целевых кодирующих последовательностей. Связывающий элемент выделяют из культуры и, необязательно, очищают при использовании стандартных методик в данной области. Выход рекомбинантного белка может быть повышен при оптимизации среды и условий культивирования, таких как температура или подача кислорода. В прокариотах связывающий элемент может продуцироваться в периплазму, внутриклеточно в виде телец включения или секретироваться в среду культивирования. При выделении белок может быть очищен с использованием методов, известных в уровне техники, таких как гель-фильтрация, ионообменная хроматография, обращенно-фазовая хроматография, гидрофобное взаимодействие, хроматография на носителях смешанного типа и/или аффинная хроматография.

[0174] В одном варианте осуществления связывающий элемент получают в бесклеточной системе. Это обычно включает in vitro транскрипцию, с последующей in vitro трасляцией матриц продуктов нуклеиновой кислоты, кодирующих белок, как описано в настоящей заявке, например, плазмидной ДНК или матриц ПЦР продуктов. Например, используются неочищенные лизаты растущих клеток, которые обеспечивают необходимые ферменты, а также клеточный аппарат синтеза белка. Необходимые строительные блоки, такие как аминокислоты или нуклеотидные основания, а также энергоснабжающие молекулы и другие могут поступать извне. Бесклеточные системы экспрессии могут быть, например, основаны на лизированных ретикулоцитах кролика (например, Rabbit Reticulocyte Lysate System, Promega, номер по кат. L4540), клетках HeLa (например, 1-Step Human In Vitro Translation Kit, Thermo Scientific, номер по кат. 88881), клетках насекомых (например, EasyXpress Insect Kit II, Qiagen, номер по кат. 32561), зародышах пшеницы (например, Wheat Germ Extract, Promega, номер по кат. L4380) или клетках E.coli (например, PURExpress® In Vitro Protein Synthesis Kit, NEB, номер по кат. E6800S). Кроме того, для получения могут использоваться оптимизированные бесклеточные системы экспрессии антител для улучшенного образования дисульфидной связи. Коммерческие наборы включают лизаты клеток насекомых (например, EasyXpress Disulfide Insect Kit, Qiagen, номер по кат. 32582) или лизаты клеток E.coli (например, EasyXpress Disulfide E. coli Kit, Qiagen, номер по кат. 32572). Бесклеточный синтез белка, например, обладает преимуществами, которые заключаются в том, что он быстрый, позволяет достигать высоких выходов продукта, дает возможность легкой модификации условий реакции, отличается образованием низкого количества или даже не дает побочных продуктов. Бесклеточный синтез белка может включать биологические и/или химические этапы, которые не могут быть проведены в полностью биологических или химических системах продукции. Например, природные или химически модифицированные аминокислоты могут быть включены в белок в нужных положениях. Слитые белки ScFv-токсин были успешно получены в бесклеточных системах (NICHOLLS, P. J., et al. Characterization of single-chain antibody (sFv)-toxin fusion proteins produced in vitro in rabbit reticulocyte lysate. JBC 1993, vol. 268, pp. 5302-5308). Таким образом, в одном варианте осуществления предложен способ получения связывающего элемента, описанного в настоящей заявке, или T-тела, как указано выше, который включает стадиюы: (a) получения бесклеточной системы, (b) получения матрицы продукции нуклеиновой кислоты, кодирующей связывающий элемент, как указано выше, или T-тело, как указано выше, (c) обеспечения транскрипции и трансляции матрицы продукции нуклеиновой кислоты; (d) выделения; и, необязательно, (e) очистки связывающего элемента или T-тела, соответственно.

[0175] Дополнительно или альтернативно, способ получения связывающего элемента, описанного в настоящей заявке, включает по меньшей мере одну стадию химического синтеза. Например, способ может быть полностью химическим. В другом варианте осуществления клеточные или бесклеточные системы продукции, описанные выше, включают такой по меньшей мере одну стадию химического синтеза.

[0176] В некоторых вариантах осуществления связывающий элемент, как описано в настоящей заявке, получают в клеточной системе при использовании вектора экспрессии для внутриклеточной экспрессии в E. coli. При экспрессии полипептид образуется в виде телец включения в клетке-хозяине, которые отделяют от других частиц клетки, с последующей солюбилизацией в денатурирующем агенте, таком как гидрохлорид гуанидина (GndHCl), и рефолдингом, который проводят с помощью методов ренатурации, известных специалисту.

[0177] Требуемый связывающий элемент может быть также получен в трансгенном животном. Подходящее трансгенное животное может быть получено согласно стандартным методам, например, включающим этапы (i) получения трансгенного эмбриона, например, с помощью микроинъекций ДНК конструкций, которые включают кодирующую последовательность связывающих элементов, а также подходящих контрольных последовательностей в яйцеклетки; (ii) переноса яйцеклеток псевдобеременным самкам-реципиентам; (iii) наблюдения вынашивания или беременности; и (iv) отбор потомка, экспрессирующего требуемое антитело.

[0178] Следует понимать, что нуклеиновые кислоты, векторы, клетки-хозяева и способ получения, описанный выше, также относятся к связывающим элементам (в случаях, если они являются белком) и/или к T-телам, описанным в настоящей заявке.

Химические и/или биологические модификации

[0179] В одном аспекте связывающий элемент, раскрытый в настоящем описании, модифицирован химически и/или биологически. Такая модификация может включать, без ограничения, гликозилирование, ПЭГилирование, ГЭКилирование, технологию слияния с альбумином, ПАСилирование, мечение красителями и/или радиоизотопами, конъюгирование с ферментами и/или токсинами, фосфорилирование, гидроксилирование и/или сульфатирование. Аналогичным образом, любой связывающий элемент, последовательность нуклеиновой кислоты, вектор и/или клетка-хозяин, описанные выше, могут быть модифицированы соответствующим образом.

[0180] Химические и/или биологические модификации могут быть выполнены для оптимизации фармакодинамики или водорастворимости белка, или уменьшения его побочного действия. Например, ПЭГилирование, ПАСилирование и/или ГЭКилирование могут быть применены для замедления почечного клиренса и, таким образом, увеличения полупериода существования связывающего элемента в плазме. Дополнительно или альтернативно, модификация может сообщать различную функциональность белку, например, токсин для более эффективной борьбы с раковыми клетками или детектирующую молекулу для диагностических целей.

[0181] Гликозилирование относится к процессу, в ходе которого происходит присоединение углеводов к белкам. В биологических системах этот процесс осуществляется ферментативным путем в клетке как форма котрансляционной и/или посттрансляционной модификации. Белок, в данном случае связывающий элемент, такой как антитело, может быть также химически гликозилированным. Как правило, без ограничения, гликозилирование является (i) N-связанным с азотом боковых цепей аргинина или аспарагина; (ii) O-связанным с кислородом гидроксигруппы боковых цепей серина, треонина, тирозина, гидроксилизина или гидроксипролина; (iii) включает присоединение ксилозы, фукозы, маннозы и N-ацетилглюкозамина к фосфосерину; или (iv) протекает в форме C-маннозилирования, при котором сахар манноза присоединяется к остатку триптофана, присутствующему в специфической распознаваемой последовательности. Профили гликозилирования можно контролировать, например, при выборе походящих клеточных линий, среды культивирования, технологических режимов белковой инженерии и стратегии процесса (HOSSLER, P. Optimal and consistent protein glycosylation in mammalian cell culture. Glycobiology 2009, vol. 19, no. 9, p. 936-949).

[0182] Белковая инженерия в целях контроля или изменения профиля гликозилирования может включать делецию и/или добавление одного или более участков гликозилирования. Создание участков гликозилирования можно удобно выполнять при введении соответствующей последовательности распознавания фермента в аминокислотную последовательность связывающего элемента или путем добавления или замены одного или более перечисленных выше аминокислотных остатков.

[0183] Может потребоваться выполнить ПЭГилирование связывающего элемента. ПЭГилирование может изменять фармакодинамические и фармакокинетические свойства белка. Полиэтиленгликоль (ПЭГ) подходящей молекулярной массы ковалентно присоединяют к белковой цепи (см., например, PASUT, G. and Veronese, F. State of the art in PEGylation: the great versatility achieved after forty years of research. J Control Release 2012, vol. 161, no. 2, p. 461-472). ПЭГилирование может также уменьшать иммуногенность, защищая ПЭГилированный белок от воздействия иммунной системы, и/или изменять его фармакокинетику, например, увеличивая in vivo стабильность связывающего элемента, защищая его от протеолитического расщепления, увеличивая его полупериод существования и изменяя его биораспределение.

[0184] Аналогичные эффекты могут быть достигнуты при использовании миметиков ПЭГ, например, при ГЭКилировании или ПАСилировании антитела. При ГЭКилировании используются производные гидроксиэтилкрахмала ("ГЭК"), тогда как при ПАСилировании антитело связывают с конформационно неупорядоченными полипептидными последовательностями, состоящими из аминокислот пролина, аланина и серина. Такие миметики ПЭГ и подобные соединения, например, описаны в BINDER, U. and Skerra, A. Half-Life Extension of Therapeutic Proteins via Genetic Fusion to Recombinant PEG Mimetics, in Therapeutic Proteins: Strategies to Modulate Their Plasma Half-Lives. Edited by KONTERMANN, R., Weinheim, Germany: Wiley-VCH, 2012. ISBN: 9783527328499. p. 63-81.

[0185] Связывающий элемент может включать эпитоп, такой как эпитоп связывания рецептора реутилизации. Такой эпитоп связывания рецептора реутилизации обычно относится к эпитопу Fc-области молекулы IgG (например, IgG1, IgG2, IgG3 или IgG4) и вызывает увеличение полупериода существования молекулы in vivo.

[0186] Дополнительно или альтернативно, связывающий элемент метят или конъюгируют со второй молекулой, которая придает дополнительные функции после связывания с мишенью. Вторая молекула, например, может иметь дополнительную иммунологическую эффекторную функцию, может быть эффективной в направлении воздействия лекарственного средства или может использоваться для обнаружения, без ограничения перечисленным. Вторая молекула может быть, например, химически связана или генетически слита со связывающим элементом при использовании методов, известных в уровне техники.

[0187] Молекулы, которые могут служить в качестве второй молекулы, включают, без ограничения, радионуклид, также называемый радиоизотопом, апофермент, фермент, кофактор, пептидную молекулу, такую как HIS-метка, белок, углевод, такой как маннозо-6-фосфатная метка, флуорофор, такой как флуоресцеинизотиоцианат (ФИТЦ), фикоэритрин, зеленый/синий/красный или другой флуоресцентный белок, аллофикоцианин (АФЦ), хромофор, витамин, такой как биотин, хелатообразователь, антиметаболит, такой как метотрексат, липосому, токсин, такой как цитотоксическое средство, или радиотоксин. Иллюстративными примерами радионуклида являются 35S, 32P, 14C, 18F и 125I. Примеры подходящих ферментов включают, без ограничения, щелочную фосфатазу, пероксидазу хрена, бета-галактозидазу и ангиогенин. Иллюстративным примером подходящего белка является лектин. Примеры подходящих цитотоксических препаратов включают, без ограничения, таксол, грамицидин D и колхицин.

[0188] Меченый связывающий элемент наиболее полезен в целях детектирования in vitro и in vivo или диагностики. Например, связывающий элемент, меченный подходящим радиоизотопом, ферментом, флуорофором или хромофором, может быть обнаружен с помощью радиоиммуноанализа (РИА), иммуноферментного анализа (ELISA) или анализа отдельных клеток на основе цитометрии (например, анализа ФАКС), соответственно. Аналогичным образом, нуклеиновые кислоты и/или векторы, раскрытые в настоящей заявке, могут использоваться в целях детектирования или диагностики, например, при использовании их меченых фрагментов в качестве зондов в анализах гибридизации. Методики мечения можно найти, например, в JOHNSON, I. and Spence, M. T.Z. Molecular Probes Handbook, A Guide to Fluorescent Probes and Labeling Technologies. Life Technologies, 2010. ISBN: 0982927916.

[0189] Следует понимать, что изложенное выше также относится к T-телам.

Композиции

[0190] Связывающий элемент, последовательность нуклеиновой кислоты и/или вектор, раскрытые в настоящей заявке, могут быть представлены в композиции, которая дополнительно включает подходящий носитель, эксципиент или разбавитель. В типовых вариантах осуществления соответствующая композиция включает антитело, описанное в настоящей заявке.

[0191] Такая композиция может быть, например, диагностической, косметической или фармацевтической композицией. В терапевтических или косметических целях композиция является фармацевтической композицией, включающей фармацевтический носитель, эксципиент или разбавитель, то есть не токсичные в используемых схемах применения и концентрации.

[0192] Подходящий "носитель", "эксципиенты" или "разбавители" включают, без ограничения: (i) буферы, такие как фосфатный, цитратный или другой, органические кислоты; (ii) антиоксиданты, такие как аскорбиновую кислоту и токоферол; (iii) консерванты, такие как 3-пентанол, хлорид гексаметония, хлорид бензалкония, бензиловый спирт, алкилпарабен, пирокатехин или циклогексанол; (iv) аминокислоты, такие как, например, гистидин, аргинин; (v) пептиды, предпочтительно до 10 остатков, такие как полилизин; (vi) белки, такие как бычий или человеческий сывороточный альбумин; (vii) гидрофильные полимеры, такие как поливинилпирролидон; (viii) моносахариды, дисахариды, полисахариды и/или другие углеводы, в том числе глюкозу, маннозу, сахарозу, маннит, трегалозу, сорбит, аминодекстран или полиамидоамины; (ix) хелатообразующие соединения, например, ЭДТА; (x) солеобразующие ионы, такие как натрий; (xi) комплексные соединения металлов (например, Zn-белковые комплексы); и/или (xii) ионные и неионогенные поверхностно-активные вещества, такие как TWEENTM, PLURONICSTM или полиэтиленгликоль (ПЭГ).

[0193] Многие примеры соединений имеют различные функции и могут, например, действовать в качестве носителя и в качестве разбавителя. Следует также понимать, что композиция может включать больше одного из каждого носителя, разбавителя или вспомогательного вещества.

[0194] Связывающий элемент, последовательности нуклеиновой кислоты или вектор могут быть представлены на твердых материалах-подложках, таких как сферы и микрочастицы. Как правило, молекула связывающего элемента связана с таким носителем через ковалентную связь (необязательно с участием линкера), нековалентную связь или и то, и другое. Сферы и микрочастицы могут включать, например, крахмал, целлюлозу, полиакрилат, полиацетат, полигликолят, полилактид-гликолид, латекс или декстран.

[0195] В одном варианте осуществления предложена фармацевтическая композиция, которая включает связывающий элемент, последовательности нуклеиновых кислот или вектор, как описано выше. Композиция также может включать одно или более дополнительных терапевтически активных соединений в терапевтически эффективном количестве. Дополнительное терапевтически активное соединение в некоторых вариантах осуществления является соединением, активным против заболевания, опосредованного ФНО.

Терапевтические применения

[0196] Молекула, описанная в настоящей заявке, в особенности связывающий элемент (такой как антитело), молекула нуклеиновой кислоты или вектор могут использоваться в качестве лекарственного средства. Как правило, такое лекарственное средство включает терапевтически эффективное количество молекулы, предложенной в настоящей заявке. Таким образом, соответствующая молекула может использоваться для получения лекарственного средства, применимого в лечении одного или более нарушений, связанных с ФНО-альфа.

[0197] В одном аспекте предложен способ лечения нарушения, связанного с ФНО-альфа. Способ включает стадиюы введения фармацевтически эффективного количества молекулы, как описано в настоящей заявке, в особенности антитела, пациентпациенту. В одном варианте осуществления фармацевтическую композицию, описанную выше, которая включает такое фармацевтически эффективное количество связывающего элемента, например антитела, вводят пациенту. Лекарственное средство, указанное выше, могут вводить пациенту.

[0198] Пациент, нуждающийся в лечении, может быть человеком или не относящимся к человеку животным. Обычно пациент является млекопитающим, например, мышью, крысой, кроликом, хомяком, собакой, кошкой, обезьяной, человекообразной обезьяной, козой, овцой, лошадью, курицей, морской свинкой или свиньей. В типовых вариантах осуществления у пациента диагностировано связанное с ФНО-альфа нарушение или у него может развиться такое нарушение. В случае модели на животных животное может быть генно-инженерно модифицировано с целью вызвать у него развитие связанного с ФНО-альфа нарушения. В модели на животных животное может быть также генно-инженерно модифицировано таким образом, что оно демонстрирует признаки заболевания, опосредованного ФНО-альфа.

[0199] Известно множество связанных с ФНО-альфа нарушений, при которых антагонист ФНО-альфа показал терапевтический эффект. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является пролиферативная диабетическая ретинопатия (LIMB GA et al. Distribution of TNF alpha and its reactive vascular adhesion molecules in fibrovascular membranes of proliferative diabetic retinopathy. Br J Ophthalmol. 1996 Feb; 80(2):168-73). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является по меньшей мере одно из подагрического артрита, острого подагрического артрита и хронического подагрического артрита (TAUSCHE AK et al, Severe gouty arthritis refractory to anti-inflammatory drugs: treatment with anti-tumour necrosis factor alpha as a new therapeutic option. Ann Rheum Dis. 2004 Oct; 63(10):1351-2). Связанное с ФНО-альфа нарушение в некоторых вариантах осуществления является синдромом Шницлера. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является системный ювенильный идиопатический артрит (KOTANIEMI K et al., Long-term efficacy of adalimumab in the treatment of uveitis associated with juvenile idiopathic arthritis. Clin Ophthalmol. 2011;5:1425-9, Epub 2011 Oct 3). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является ревматоидный артрит (PARAMESWARAN, N. and PAIAL S. Tumor Necrosis Factor-a Signaling in Macrophages. Crit Rev Eukaryot Gene Expr. 2010; vol. 20(2), pp. 87-103). Связанное с ФНО-альфа нарушение может быть также крапивницей (SAND FL and THOMSEN SF. TNF-Alpha Inhibitors for Chronic Urticaria: Experience in 20 Patients. J Allergy (Cairo). 2013;2013:130905. Epub 2013 Sep 18). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является васкулит (CHUNG SA and SEO P. Advances in the use of biologic agents for the treatment of systemic vasculitis. Curr Opin Rheumatol. 2009 Jan;21(1):3-9). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является диабет 1-го типа или диабет 2-го типа. Связанным с ФНО-альфа нарушением в некоторых вариантах осуществления является рецидивирующий многоочаговый остеомиелит. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является рецидивирующий полихондрит (CARTER JD. Treatment of relapsing polychondritis with a TNF antagonist. J Rheumatol. 2005 Jul;32(7):1413). Связанным с ФНО-альфа нарушением в некоторых вариантах осуществления является криопирин-ассоциированный периодический синдром (КАПС). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является болезнь Бехчета (PERRA D et al. Adalimumab for the treatment of Behçet's disease: experience in 19 patients. Rheumatology (Oxford). 2012 Oct; 51(10):1825-31. Epub 2012 Jun 20). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является семейная средиземноморская лихорадка. Связанное с ФНО-альфа нарушение может быть также хронической обструктивной болезнью легких (ХОБЛ). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является ревматическая полимиалгия. В некоторых вариантах осуществления связанное с ФНО-альфа нарушение основано на одной или более мутациях NACHT, LRR и PYD-домены-содержащего белка 3 (NALP3). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является гангренозная пиодермия (PATEL F et al. Effective Strategies for the Management of Pyoderma Gangrenosum: A Comprehensive Review. Acta Derm Venereol. 2014 Nov 12). Связанным с ФНО-альфа нарушением в некоторых вариантах осуществления является хроническая идиопатическая крапивница. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является псориаз (см., например, CORDORO, KM and FLEDMAN SR. TNF-alpha inhibitors in dermatology. Skin Therapy Letter 2007, vol. 12, pp. 4-6). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является остеоартроз. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является влажная форма возрастной макулодистрофии. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является синдром сухого глаза. Связанным с ФНО-альфа нарушением в некоторых вариантах осуществления является синдром SAPHO (синовит-акне-пустулез-гиперостоз-остеит). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является синдром активации макрофагов. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является периодическая болезнь (Di Gangi M et al. Long-term efficacy of adalimumab in hyperimmunoglobulin D and periodic fever syndrome. Isr Med Assoc J. 2014 Oct; 16(10):605-7). Связанным с ФНО-альфа нарушением в некоторых вариантах осуществления является аденит. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является фарингит или синдром афтозных язв. Связанным с ФНО-альфа нарушением в некоторых вариантах осуществления является болезнь Стилла взрослых. Связанным с ФНО-альфа нарушением также может быть дефицит мевалонаткиназы. В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является увеит (KOTANIEMI K et al., Long-term efficacy of adalimumab in the treatment of uveitis associated with juvenile idiopathic arthritis. Clin Ophthalmol. 2011;5:1425-9. Epub 2011 Oct 3). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является воспалительное заболевание кишечника (PARAMESWARAN, N. and PAIAL S. Tumor Necrosis Factor-a Signaling in Macrophages. Crit Rev Eukaryot Gene Expr. 2010; vol. 20(2), pp. 87-103). Связанным с ФНО-альфа нарушением в некоторых вариантах осуществления является атеросклероз (PARAMESWARAN, N. and PAIAL S. Tumor Necrosis Factor-a Signaling in Macrophages. Crit Rev Eukaryot Gene Expr. 2010; vol. 20(2), pp. 87-103). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является ФНО-рецептор-ассоциированный периодический синдром (TRAPS). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является анкилозирующий спондилит (PARAMESWARAN, N. and PAIAL S. Tumor Necrosis Factor-a Signaling in Macrophages. Crit Rev Eukaryot Gene Expr. 2010; vol. 20(2), pp. 87-103). Связанным с ФНО-альфа нарушением может быть также гнойный гидраденит (Brunasso AM, Massone C. Treatment of hidradenitis suppurativa with tumour necrosis factor-alpha inhibitors: An update on infliximab. Acta Derm Venereol. 2011, vol. 91(1), pp.70; Sotiriou E. et al., Etanercept for the treatment of hidradenitis suppurativa, Acta Derm Venereol. 2009, vol. 89(1), pp. 82-83). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением является псориаз (PARAMESWARAN, N. and PAIAL S. Tumor Necrosis Factor-a Signaling in Macrophages. Crit Rev Eukaryot Gene Expr. 2010; vol. 20(2), pp. 87-103). В некоторых вариантах осуществления связанным с ФНО-альфа нарушением являются обыкновенные угри.

[0200] Термин "КАПС" или криопирин-ассоциированный периодический синдром, как подразумевается, включает семейный холодовой аутовоспалительный синдром (FCAS), синдром Макла-Уэльса (MWS) и мультисистемное воспалительное заболевание неонатального возраста, также известное как хронический детский неврологический кожно-артикулярный синдром (CINCA).

[0201] Фармацевтическую композицию можно применять одним или более различными подходящими путями введения. Введение может быть, например, выполнено парентерально. В некоторых вариантах осуществления введение выполняют внутримышечно. В некоторых вариантах осуществления введение выполняют внутривенно струйно или непрерывной инфузией. Введение в некоторых вариантах осуществления проводят интраартикулярно. В некоторых вариантах осуществления введение выполняют интрасиновиально. Введение в некоторых вариантах осуществления может быть подкожным. В некоторых вариантах осуществления введение выполняют наружно, например, на кожу или в глаз. Введение в некоторых вариантах осуществления выполняют ректально. В некоторых вариантах осуществления введение производят дермально, например, интрадермально, подкожно или трансдермально. Введение в некоторых вариантах осуществления может быть выполнено местно. Другие подходящие способы введения включают, без ограничения перечисленными, введение, например, интрацеребрально, интрацереброспинально, интратекально, эпидурально или внутрибрюшинно; перорально; урогенитально; интравитреально; системно; внутривенно; интраокулярно; в ухо; интраназально; ингаляционно; подъязычно; буккально. Предпочтительными являются наружный, ректальный, местный, интраназальный, внутривенный и/или интрадермальный пути введения.

[0202] Связывающий элемент, раскрытый в настоящей заявке, последовательность нуклеиновой кислоты, вектор или клетка-хозяин, раскрытая в настоящей заявке, могут быть объединены с одним или более другими терапевтически эффективными соединениями. Такое соединение в некоторых вариантах осуществления может быть способным нарушать передачу сигналов через рецептор ФНО-альфа. Соответствующее соединение в некоторых вариантах осуществления может быть способным ингибировать одну или более дополнительных мишеней, таких как, например, другие медиаторы воспалительных реакций. Такое соединение(я) можно вводить одновременно или последовательно.

[0203] В случае терапевтического применения связывающий элемент может быть также помечен изотопом или связан с токсином или связан с другой эффекторной функцией, как описано выше.

[0204] Следует понимать, что изложенное выше также относится к T-телам.

Диагностические применения и/или обнаружение

[0205] Связывающий элемент, раскрытый в настоящей заявке, может использоваться в целях обнаружения или диагностики in vivo и/или in vitro. Например, целый ряд иммуноанализов, включающих антитела для обнаружения экспрессии в определенных клетках или тканях, известен специалисту. Аналогичным образом, любой связывающий элемент, последовательность нуклеиновой кислоты, вектор и/или клетка-хозяин, описанные в предыдущем тексте, могут использоваться соответствующим образом, как подробно описано в данном разделе.

[0206] В случае таких применений связывающий элемент, например, антитело, последовательность нуклеиновой кислоты, вектор или клетка-хозяин, раскрытые в настоящей заявке, могут включать детектируемую метку. В некоторых вариантах осуществления связывающий элемент, последовательность нуклеиновой кислоты, вектор или клетка-хозяин, раскрытые в настоящей заявке, не включают детектируемую метку. В качестве иллюстративного примера, немеченое антитело можно применять и детектировать вторичным антителом, специфично связывающимся с эпитопом на связывающем элементе, например, антителе, описанном в настоящей заявке.

[0207] В некоторых вариантах осуществления связывающий элемент, последовательность нуклеиновой кислоты, вектор и/или клетка-хозяин связаны с одним или более веществами, которые может распознавать детектирующее вещество. Например, связывающий элемент может быть присоединен ковалентной связью к биотину, который может быть обнаружен по его способности связываться со стрептавидином. Аналогичным образом, нуклеиновые кислоты и/или векторы, раскрытые в настоящей заявке, могут использоваться в целях обнаружения или диагностики, например, при использовании их меченых фрагментов в качестве зондов в анализах гибридизации.

[0208] В некоторых вариантах осуществления любая из молекул, предложенных в настоящей заявке, в особенности антитело, может использоваться для обнаружения присутствия ФНО-альфа в образце, предпочтительно образце биологического происхождения. Термин "ФНО-альфа" при использовании в данном контексте включает полноразмерный ФНО-альфа, его фрагменты и/или предшественники, то есть трансмембранный ФНО-альфа и растворимый ФНО-альфа. Термин "обнаружение" охватывает количественное и/или качественное обнаружение. В некоторых вариантах осуществления биологический образец включает клетку или ткань, полученные у больных людей. Неограничивающие примеры биологических образцов включают кровь, мочу, спинномозговую жидкость, биоптат, лимфу и/или не снабжаемые кровью ткани.

[0209] В некоторых вариантах осуществления способ включает контакт биологического образца со связывающим элементом к ФНО-альфа (таким как антитело против ФНО-альфа), как описано в настоящей заявке, при условиях, позволяющих связывание ингибитора с его мишенью, ФНО-альфа, если таковая присутствует, и обнаружение комплекса ингибитор-мишень. Такой способ может быть in vitro или in vivo способом. В одном варианте осуществления такой связывающий элемент применяется для отбора пациентов, соответствующих критериям для терапии связывающими элементами, описанными в настоящей заявке, например, где ФНО-альфа является биомаркером для отбора пациентов. Аналогичным образом, вместо связывающего элемента такой способ может включать применение T-тела, описанного в настоящей заявке.

[0210] В другом аспекте связывающий элемент, например антитело, применяется в косметических применениях, например, для улучшения эстетического вида кожи.

[0211] Аналогичным образом, T-тело, последовательность нуклеиновой кислоты, вектор и/или клетка-хозяин, описанные выше, могут использоваться соответствующим образом, как подробно описано выше.

Изделие

[0212] В другом аспекте предложено изделие (то есть набор). Изделие включает вещество, например, материал, применимый для (i) лечения, предотвращения или задержки прогрессии связанных с ФНО-альфа нарушений; (ii) диагностических или (iii) косметических целей. Изделие может включать инструкции по применению и один или более контейнеров. Подходящие контейнеры включают, например, флаконы, ампулы, шприцы, картриджи, планшеты и пробирки и могут быть изготовлены из множества материалов, таких как стекло или пластмасса. По меньшей мере один контейнер содержит композицию, которая включает связывающий элемент, как раскрыто в настоящей заявке. Контейнер может иметь стерильный порт доступа. Соответствующий контейнер обычно имеет маркировку.

[0213] Реактивы обычно предоставлены в установленных количествах сухих порошков, обычно лиофилизированных, включающих эксципиенты, которые после растворения дают раствор реактива, имеющий требуемую концентрацию. Также могут быть включены другие добавки, такие как стабилизаторы и/или буферы. Если связывающий элемент помечен ферментом, то набор обычно включает соответствующие субстраты и кофакторы.

[0214] Инструкции по применению могут содержать указания, что композиция применяется для лечения, предотвращения и/или задержки прогрессии выбранного нарушения; или инструкции для выполнения детектирования или диагностического анализа. Инструкции могут быть представлены на этикетке и/или на вкладыше в упаковку.

УКАЗАННЫЕ ПОСЛЕДОВАТЕЛЬНОСТИ

[0215] Последовательности, раскрытые в настоящем описании, являются следующими:

[0216] SEQ ID No: 1 - VL scFv1

EIVMTQSPSTLSASVGDRVIITCQASQSISSYLAWYQQKPGKAPKLLIYWASTLASGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQSYYYTSNNSDGFWAFGQGTKLTVLG

[0217] SEQ ID No: 2 - VH scFv1

EVQLVESGGGLVQPGGSLRLSCKASGIDFSNSGITWVRQAPGKGLEWVGYIYPGFGIRNYANSVRGRFTISRDTSKNTVYLQMNSLRAEDTAVYYCARDPIYASSSGYADIWGQGTLVTVSS

[0218] SEQ ID No: 3 - CDR-L1 scFv1

QASQSISSYLA

[0219] SEQ ID No: 4 - CDR-L2 scFv1

WASTLAS

[0220] SEQ ID No: 5 - CDR-L3 scFv1

QSYYYTSNNSDGFWA

[0221] SEQ ID No: 6 - CDR-H1 scFv1

IDFSNSGIT

[0222] SEQ ID No: 7 - CDR-H2 scFv1

YIYPGFGIRNYANSVRG

[0223] SEQ ID No: 8 - CDR-H3 scFv1

DPIYASSSGYADI

[0224] SEQ ID No: 9 - scFv1

EIVMTQSPSTLSASVGDRVIITCQASQSISSYLAWYQQKPGKAPKLLIYWASTLASGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQSYYYTSNNSDGFWAFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCKASGIDFSNSGITWVRQAPGKGLEWVGYIYPGFGIRNYANSVRGRFTISRDTSKNTVYLQMNSLRAEDTAVYYCARDPIYASSSGYADIWGQGTLVTVSS

[0225] SEQ ID No: 10 - линкер

GGGGSGGGGSGGGGSGGGGS

[0226] SEQ ID No: 11 - DLX105

MADIVMTQSPSSLSASVGDRVTLTCTASQSVSNDVVWYQQRPGKAPKLLIYSAFNRYTGVPSRFSGRGYGTDFTLTISSLQPEDVAVYYCQQDYNSPRTFGQGTKLEVKRGGGGSGGGGSGGGGSSGGGSQVQLVQSGAEVKKPGASVKVSCTASGYTFTHYGMNWVRQAPGKGLEWMGWINTYTGEPTYADKFKDRFTFSLETSASTVYMELTSLTSDDTAVYYCARERGDAMDYWGQGTLVTVSS

[0227] Ниже представлены примеры, иллюстрирующие способы и композиции, раскрытые в настоящей заявке. Подразумевается, что различные другие варианты осуществления могут быть осуществлены на практике, с учетом общего описания, приведенного выше.

ПРИМЕРЫ

Пример 1 - Идентификация scFvs, нейтрализующих ФНО-альфа

[0228] Иммунизация кроликов: Кроликов иммунизировали рекомбинантным человеческим (рч) ФНО-альфа (Peprotech, USA, номер по кат. 300-01A). Лимфатические узлы извлекали после последней бустер-иммунизации и клетки криокосервировали.

[0229] Сортировка В-клеток кролика методом проточной цитометрии и их культивирование: специфичные к ФНО-альфа В-клетки памяти сортировали как отдельные клетки в 96-луночные микропланшеты при использовании FACSAria III (BD Biosciences). Одиночные клоны В-клеток культивировали в присутствии питающих клеток и кондиционированной среды, содержащей 10% эмбриональной телячьей сыворотки (FCS).

[0230] В общей сложности 3150 одиночных клонов В-клеток сортировали, культивировали и супернатанты клеточных культур анализировали с помощью ELISA на присутствие специфичных IgG против ФНО-альфа. Кратко, рчФНО-альфа (Peprotech, номер по кат. 300-01A) наносили в концентрации 2 мкг/мл в течение ночи при 4°C на 96-луночные микропланшеты Maxisorp в PBS. После блокирования 5% обезжиренным сухим молоком добавляли супернатанты клеточных культур. ФНО-альфа-специфичные IgG детектировали IgG-HRP против антител кролика (Southern Biotech, номер по кат. 4050-05). ELISA проявляли субстратом BM Blue POD (Roche Applied Science). В общей сложности идентифицировали 566 отобранных ФНО-альфа-специфичных IgG-продуцирующих клонов В-клеток, и затем антитела IgG анализировали на предмет их нейтрализирующей способности в анализе на клетках PK-15. Двести IgG-продуцирующих клонов В-клеток, как обнаружили, нейтрализовали цитотоксическую активность рчФНО-альфа.

[0231] Секвенирование ФНО-альфа-нейтрализирующих IgG: все клоны В-клеток кролика, продуцирующие нейтрализирующие IgG-антитела против ФНО-альфа, подвергали выделению мРНК при использовании набора RNeasy Mini Kit (Qiagen Germany, номер по кат. 74106). мРНК использовали в качестве матрицы для обратной транскрипции согласно методике производителя (набор OneStep RT-PCR, Qiagen Germany, номер по кат. 210212). Затем проводили реакции ПЦР с использованием олигонуклеотидов для специфической амплификации последовательностей, кодирующих тяжелую и легкую цепи IgG кролика (Biometra Thermocycler T3). ПЦР-фрагменты тяжелых и легких цепей независимо секвенировали (ABI, Sanger 3730xl; Microsynth AG, Balgach, Switzerland), и полученные нуклеотидные последовательности транслировали в аминокислотные последовательности с использованием EMBOSS Transeq (http://www.ebi.ac.uk/Tools/st/) и выравнивали с использованием CLUSTALW2 (http://www.ebi.ac.uk/Tools/msa/clustalw2/).

[0232] Конструкция генов scFv против ФНО-альфа и экспрессия белка scFv: CDR области IgG кролика вариабельной легкой и вариабельной тяжелой цепей, как определено выше, идентифицировали и прививали на человеческие акцепторные каркасные области легкой и тяжелой цепи. В некоторые вводили точечные мутации. Были получены бактериальные векторы экспрессии, кодирующие белки scFv с N-концевой вариабельной легкой цепью, связанной последовательностью SEQ ID No: 10 с C-концевой вариабельной тяжелой цепью. Белки ScFv экспрессировали в E.coli BL21 (DE3); Novagen, USA, номер по кат. 69450-3) в виде телец включения, которые очищали, солюбилизировали, и белки подвергали рефолдингу. Ренатурированные scFv очищали с помощью эксклюзионной хроматографии и собирали мономерные пиковые фракции, соответствующие приблизительно 26 кДа. Очищенные scFv анализировали на связывание с ФНО-альфа с помощью ELISA. ScFv исследовали далее для определения ФНО-альфа-нейтрализирующей способности в анализе на клетках PK-15. При использовании этой методики, из 72 проанализированных scFv, пять ФНО-альфа-специфичных scFv идентифицировали как мощные ингибиторы ФНО-альфа человека.

Пример 2 - Связывание человеческого растворимого и трансмембранного ФНО-альфа

[0233] Прежде всего, специфичное распознавание ФНО-альфа подтверждали с помощью ELISA (Фигура 1). Кратко, рчФНО-альфа наносили в концентрации 2 мкг/мл в течение ночи при 4°C на 96-луночные микропланшеты Maxisorp в PBS. После блокирования 5% обезжиренным сухим молоком добавляли все пять предварительно отобранных scFv с повышением концентрации (10-3000 нг/мл), и детектировали scFv белком L-HRP (Sigma-Aldrich, номер по кат. P3226). ELISA проявляли субстратом BM Blue POD (Roche Applied Science). ФНО-альфа-специфичный scFv DLX105 использовали в качестве положительного контроля. Впрочем, CDR области были одинаковыми. DLX1084, scFv нерелевантной специфичности, использовали в качестве отрицательного контроля. На Фигуре 1 показано, что scFv1 специфично связывается с рчФНО-альфа. Все scFv, в случае прямой иммобилизации на микропланшетах, распознавались белком L-HRP (Фигура 1 B). Это подтверждает, что: (i) scFv были надлежащим образом ренатурированы, (ii) контрольный scFv DLX1084 не связывал рчФНО-альфа, и (iii) идентифицированный scFv1 является специфичным к рчФНО-альфа.

[0234] Распознавание природно продуцированного ФНО-альфа человека оценивали с помощью сэндвич-ELISA. Природная форма ФНО-альфа человека была получена из клеточной линии моноцитов человека THP-1 (DSMZ Germany, номер по кат. ACC 16). Клетки THP-1 культивировали в 6-луночных планшетах для культур тканей и стимулировали 10 нг/мл форбол-12-миристат-13-ацетата (PMA; Sigma-Aldrich, номер по кат. P1585) в течение 6 часов, после чего стимулировали 1 мкг/мл ЛПС (Sigma-Aldrich, номер по кат. L4391) в течение 16 часов при 37°C. Супернатанты клеток собирали и секретированный ФНО-альфа определяли количественно при использовании человеческого ФНО-альфа/TNFSF1A ELISA DuoSet (R&D Systems, номер по кат. DY210). Образцы scFv иммобилизировали на 96-луночных микропланшетах (Maxisorp, Nunc) в концентрации 5 мкг/мл в PBS, pH 7,2. После блокирования и промывки природную форму ФНО-альфа человека или рекомбинантно экспрессированный ФНО-альфа человека (Peprotech, номер по кат. 300-01A) наносили в конечной концентрации 5 нг/мл. Связанный ФНО-альфа детектировали биотинилированным поликлональным антителом против ФНО-альфа и стрептавидином-HRP (BD Pharmingen, номер по кат. 554060). Все пять отобранных scFv одинаково хорошо связывали и рчФНО-альфа, и природную форму ФНО-альфа человека.

[0235] Распознавание трансмембранных ФНО-альфа: клетки CHO, экспрессирующие вариант Δ1-12 человеческого ФНО-альфа, который остается мембраноассоциированным, окрашивали пятью отобранными scFv или контрольными scFv и анализировали с помощью проточной цитометрии. Клетки инкубировали с увеличиваемыми количествами scFv, и связанные scFv детектировали с использованием биотинилированного белка L и последующим окрашиванием ФЭ-меченным стрептавидином. Все пять образцов scFv, включая scFv1, эффективно связывали тмФНО-альфа, тогда как отрицательный контроль scFv DLX1084 не связывал тмФНО-альфа. Гистограммы проточной цитометрии для scFv1 и отрицательного контроля scFv DLX1084 показаны на Фигуре 4A.

Пример 3 - Нейтрализация растворимого и трансмембранного ФНО-альфа человека

[0236] Полноразмерные антитела и scFv тестировали на их способность к нейтрализации ФНО-альфа в анализе на клетках PK-15 (эпителиальные клетки почки свиньи, DSMZ, Germany, номер по кат. ACC640). Положительный контроль scFv DLX105, а также коммерческие антитела (инфликсимаб, голимумаб и адалимумаб) использовали для сравнения. Люминесцентный анализ жизнеспособности клеток CellTiter-Glo® адаптировали для определения значений IC50 для ФНО-альфа-специфичных scFv. В этом анализе генерация люминесцентного сигнала пропорциональна присутствующему количеству АТФ, которое непосредственно пропорционально количеству живых клеток, присутствующих в культуре. Кратко, растворимую форму рчФНО-альфа (1,4 пМ) предварительно инкубировали с увеличиваемыми концентрациями scFv (от 200 пг/мл до 3 мкг/мл) и добавляли к клеткам PK-15 (10000/лунка). Реактив CellTiter-Glo® (Promega, номер по кат. G7572) использовали согласно инструкциям производителя. Люминесценцию измеряли на люминометре для микропланшетов GloMax® 96. Кривые ингибирования были построены, и значения IC50 были вычислены при использовании программы GraphPad Prism®, версии 6.04. scFv1 эффективно блокировал цитотоксичность рчФНО-альфа с IC50 30±6 пМ, тогда как значение IC50 для моновалентного положительного контроля scFv DLX105 (260±34 пМ) было значительно более высоким (Фигура 2, Таблица 1). ScFv 2-5 мощно ингибировали цитотоксическую активность рчФНО-альфа со значениями IC50 в пределах от 25 пМ до 40 пМ. Значения IC50 для всех пяти моновалентных scFv были сопоставимы со значениями доступных в продаже бивалентных антител инфликсимаб, адалимумаб и голимумаб (Фигура 3).

[0237] В Примере 2 показано, что все отбранные scFv связывают трансмембранную форму ФНО-альфа. С целью исследовать, нейтрализуют ли scFv биологическую активность тмФНО-альфа, исследовали цитотоксический эффект тмФНО-альфа в отношении ФНО-альфа-чувствительных клеток HEK-Dual (InvivoGen, номер по кат. hkd-tnfa). ФНО-альфа-чувствительные клетки HEK-Dual были разработаны для контроля биоактивности ФНО-альфа посредством оценки активации NF-κB. Клетки были получены из человеческих эмбриональных клеток почки 293 при стабильной котрансфекции двух NF-κB-индуцируемых репортерных конструкций. В результате ФНО-альфа-чувствительные клетки HEK-Dual секретируют люциферазу и эмбриональную щелочную фосфатазу в ответ на ФНО-альфа-индуцированную активацию NF-κB. Оба продукта репортерных генов измеряли в супернатанте клеточных культур при использовании Quanti-Luc (InvivoGen, номер по кат. rep-qlc1) и Quanti-Blue (InvivoGen, номер по кат. rep-qb1). Клетки CHO, экспрессирующие тмФНО-альфа, сеяли при плотности 10000 клеток/лунка в 96-луночные плоскодонные микропланшеты в 100 мкл RPMI 1640, содержащей 5% FCS. Серийные разведения scFv1, положительный контроль scFv DLX105 или отрицательный контроль scFv DLX1084 (10-300 нМ) инкубировали с тмФНО-альфа-экспрессирующими клетками CHO при 37°C в течение 20 мин. Затем клетки HEK-Dual добавляли в количестве 20000 клеток/лунка и совместно культивировали при 37°C в течение 24 часов. Полученные в результате супернатанты клеточных культур использовали для измерения активности люциферазы и секретированной эмбриональной щелочной фосфатазы. Кривые ингибирования были построены и значения IC50 были вычислены при использовании программы GraphPad Prism®, версия 6.04. Пять отобранных scFv ингибировали активность трансмембранного ФНО-альфа со значениями IC50 в пределах от 10 нМ до 50 нМ, причем scFv5 имел наиболее высокое значение IC50. scFv1 и положительный контроль scFv DLX105 ингибировали активность тмФНО-альфа с IC50 50 нМ и 32 нМ, соответственно (Фигура 4B, таблица 1). Аналогичные результаты были получены при использовании Quanti-Blue для измерения активности щелочной фосфатазы. Таким образом, при таких экспериментальных условиях 400 нМ scFv1 ингибировали 50% активности тмФНО-альфа.

Таблица 1: Нейтрализующая активность против растворимого и трансмембранного ФНО-альфа

scFv Растворимый ФНО-альфа Трансмембранный ФНО-альфа
scFv1 30±6 пМ 50 нМ*
положительный контроль scFv DLX105 260±34 пМ 32 нМ*

* аналогичные результаты были получены в 2 независимых экспериментах.

Пример 4 - Перекрестная реактивность scFv в биологических видах и семействе ФНО-альфа

[0238] Профиль перекрестной реактивности пяти отобранных scFv в отношении гомологов ФНО-альфа из других видов, помимо человека, оценивали с помощью ELISA. Исследовали следующие рекомбинантно экспрессированные белки ФНО-альфа: макака-резуса (R&D Systems, USA, номер по кат. 1070-RM-025/CF), яванского макака (Sinobiological, номер по кат. 90018 CNAE), собаки (Kingfisher Biotech, USA, номер по кат. RP0261D-025) и кошки (R&D Systems, номер по кат. 2586FTCF), кролика (Kingfisher, номер по кат. RP0429U), крысы (Peprotech, номер по кат. 400-14) мыши (Peprotech, номер по кат. 315-01A), морской свинки (R&D Systems, номер по кат. 5035-TG-025/CF), свиньи (R&D Systems, номер по кат. 690-PT-025/CF). Кратко, белки наносили в концентрации 2 мкг/мл в течение ночи при 4°C на 96-луночные микропланшеты Maxisorp в PBS, pH 7,2. После блокирования 5% обезжиренным сухим молоком в лунки добавляли увеличиваемые концентрации scFv (0,1, 0,3 и 1,0 мкг/мл). Успешное нанесение каждого белка отдельно подтверждали ФНО-альфа-специфичными контрольными антителами. Поскольку scFv1 был обнаружен с помощью белка L-HRP (Sigma-Aldrich, USA, номер по кат. P3226), контрольные полноразмерные антитела IgG были обнаружены с помощью либо стрептавидина-HRP (BD Pharmingen, USA, номер по кат. 554060), либо других подходящих вторичных антител, меченных HRP. ELISA проявляли субстратом BM Blue POD (Roche Applied Science) и измеряли оптическое поглощение при 450 нм. Перекрестную реактивность scFvs1-5 сравнивали с scFv DLX2481. DLX2481 является вариантом EP-34 scFv, как описано в WO2009/155723 (ESBATech, an Alcon Biomedical Research Unit LLC), включающим несколько точечных мутаций в каркасных областях. scFv1, scFv3 и scFv4 специфично распознавали ортологи ФНО-альфа пяти видов, а именно, белки ФНО-альфа человека, макака-резуса, яванского макака, кошки и собаки. scFv2 специфично распознавал рчФНО-альфа, но не обладал перекрестной реактивностью ни с одним другим протестированным видом. scFv DLX2481 распознавал только рекомбинантный ФНО-альфа человека. Кроме того, перекрестная реактивность scFv1 с членам семейства ФНО измеряли с помощью прямого ELISA с покрытым рекомбинантным человеческим лимфотоксином α2/β1 (R&D Systems, USA, номер по кат. 679-TX-010/CF), рекомбинантным человеческим лимфотоксином α1/β2 (R&D Systems, номер по кат. 678-LY-010/CF), рекомбинантным человеческим CD40 лигандом/TNFSF5 (R&D Systems, номер по кат. 6420-CL-025/CF) и рекомбинантным человеческим ФНО-бета/TNFSF1 (R&D Systems, номер по кат. 211-TB-010/CF). scFv1 не давал перекрестной реакции с этими белками семейства ФНО до концентрации 40 нМ.

Пример 5 - Стабильность scFv

[0239] Можно наблюдать два различных процесса, которые могут влиять на стабильность scFv. Во-первых, scFv может быть склонным к димеризации, часто сопровождаемой олигомеризацией и последующей агрегацией и преципитацией. Во-вторых, деградация scFv, дающая фрагменты меньшего размера, может протекать с течением времени.

[0240] Исследовали стабильность пяти отобранных scFv, разведенных в PBS, pH 7,2, при хранении при различных температурных условиях. scFv хранили в концентрации 10 мг/мл при 4°C, 22°C, 37°C и -20°C в полипропиленовых пробирках объемом 1,5 мл. В указанные моменты времени каждый образец исследовали визуально и измеряли концентрацию белка при 280 нм. Тогда как scFv 3 и 4 показали более низкую стабильность при 4°C и при 37°C после 1 недели инкубирования, никакой видимой преципитации белка и никакой значимой потери белка в случае scFv1 не наблюдали. Образцы анализировали с помощью Э-ВЭЖХ для определения уровней (%) мономеров, димеров и высокомолекулярных олигомеров по отношению к общей площади пика: использовали колонку TOSOH TSKgel G2000 SWXL, диольная фаза, длина×внутр.диам. 30 см × 7,8 мм, величина частиц 5 мкм (Sigma, номер по кат. 08540). Наносили 5 мкл scFv1 при концентрации 1 мг/мл. В качестве подвижной фазы выбрали PBS, pH 7,2.

[0241] Анализ Э-ВЭЖХ не показал поддающихся обнаружению низкомолекулярных продуктов деградации при описанных выше экспериментальных условиях. Значимой димеризации scFv1 при хранении в течение 4 недель при 4°C, 22°C и -20°C не наблюдали. Образование димеров scFv1 составило до 2,61%, 6,09%, 8,75% и 11,02% после 1, 2, 3 или 4 недель хранения при 37°C, соответственно (Таблица 2), и лишь незначительное количество высокомолекулярных молекул наблюдали после хранения в течение 3 и 4 недель при 37°C.

[0242] Таблица 2: содержание мономера scFv1 (%), измеренное с помощью Э-ВЭЖХ после хранения при указанных условиях

День 7 День 14 День 21 День 28
scFv1, 10 мг/мл, 4°C 99,73 99,64 99,57 99,15
scFv1, 10 мг/мл, 22°C 99,52 99,17 98,89 98,57
scFv1, 10 мг/мл, 37°C 96,54 92,01 88,22 84,68
scFv1, 10 мг/мл, -20°C nd* nd nd 99,09

*nd, не определяли.

[0243] Измерение стабильности scFv1 продлили до 6 месяцев. После шести месяцев при 4°C препарат scFv1 содержал 91,17% мономеров.

[0244] Термостабильность scFv1 также оценивали с помощью дифференциальной сканирующей флуориметрии (ДСФ). scFv1 в концентрации 0,54 мг/мл, разведенный в PBS, pH 7,2, нагревали с 30°C до 95°C с шагом 1°C/5 секунд в приборе ПЦР в реальном времени (Corbett, Rotor-Gene) в присутствии 20× SYPRO® Orange (Sigma-Aldrich, номер по кат. S5692, 5000×) в PBS, pH 7,2. Значения флуоресценции измеряли (длина волны возбуждения 470 нм; длина волны эмиссии 555 нм) во время градиентного анализа. Средняя температура плавления (Тп) scFv1, вычисленная с использованием программы Rotor-Gene 6000 Series 1.7, составила 76,0°C. для scFv1.

[0245] Белковые биопрепараты могут быть подвергнуты шоковому воздействию замораживания/оттаивания в ходе производства, хранения и транспортировки, что может вызывать агрегацию и деградацию. Для оценки стабильности scFv1 во время циклов замораживания/оттаивания, scFv1 разводили в PBS, pH 7,2, в концентрации 10 мг/мл в полипропиленовых пробирках объемом 1,5 мл. Пробирки погружали в жидкий азот на 5 мин. Для размораживания их инкубировали в водяной бане при комнатной температуре в течение 10 мин. Выполняли один, 3, 5, 7 или 10 циклов замораживания/оттаивания и анализировали образцы с помощью Э-ВЭЖХ, как указано выше. Практически 100% scFv1 оставалось мономерным после 10 циклов замораживания/оттаивания, и при этом не наблюдали никакой потери или преципитации белка.

[0246] Для дальнейшего исследования scFv1 был выбран из пула пяти предварительно отобранных scFv благодаря его выдающимся показателям стабильности, его высокой активности и его широкому спектру перекрестной реактивности.

Пример 6 - Стабильность в 90% человеческой сыворотке

[0247] Пять scFv scFv1-5 разбавляли до 0,1 мг/мл в PBS, pH 7,2. Аликвоту scFv добавляли в человеческую сыворотку (Sigma, номер по кат. H4522), получив конечную концентрацию 10 мкг/мл в 90% об./об. человеческой сыворотке. Параллельно scFv разбавляли в PBS, pH 7,2, содержащем 1% BSA. Образцы инкубировали при 4°C и 37°C в течение 1, 4 и 20 часов. ФНО-альфа-связывающую способность образцов измеряли с помощью прямого ELISA с иммобилизированным ФНО-альфа, как описано в примере 2. Подвергнутый воздействию сыворотки, scFv1 тестировали в увеличиваемых концентрациях (20-500 нг/мл) и детектировали белком L-HRP. Результаты указывают, что 20-часовое воздействие человеческой сыворотки при 37°C не вызывало значимого изменения ФНО-альфа-связывающей способности scFv1 и scFv2-5.

Пример 7 - Растворимость scFv

[0248] Пять отобранных scFv, scFv1-5, очищали и хранили в буфере PBS, pH 7,2 (фосфатно-солевой буферный раствор 1×, Gibco, Life TechnologiesTM, номер по кат. 20012). scFv1 концентрировали при использовании центрифужных концентраторов Vivaspin 20 (Sartorius Stedim Biotech, номер по кат. VS2001) при комнатной температуре до 50 мг/мл и анализировали визуально и с помощью аналитической ВЭЖХ (колонка TOSOH TSKgel G2000 SWXL, номер по кат. 08540). Полученные растворы scFv1 были чистыми и без осадков, причем 100% белка было мономерным. Таким образом, растворимость scFv1 в PBS, pH 7,2, составляет≥50 мг/мл.

Пример 8 - Нейтрализация ФНО-альфа макака-резуса, яванского макака и собаки

[0249] ScFv1 исследовали на ингибирование цитотоксической активности белков ФНО-альфа макака-резуса, яванского макака и собаки против клеток PK-15, как описано выше. Серийное разведение scFv1 инкубировали с 50 пг/мл рекомбинантного белка ФНО-альфа макака-резуса, яванского макака или собаки. Смеси добавляли к клеткам PK-15, затем еще инкубировали и анализировали, как описано в примере 3. ScFv1 был очень активным при нейтрализации белков ФНО-альфа макака-резуса, яванского макака и собаки.

Пример 9 - Эффективность in vivo

[0250] Способность scFv1 блокировать биологическую активность ФНО-альфа человека in vivo была продемонстрирована при использовании нокаутной мыши Tg1278TNF-ko, линии мышей, которая содержит трансген, кодирующий полноразмерный ген ФНО-альфа человека с фланкирующими областями. Эти мыши обычно экспрессируют нормально регулируемый ФНО-альфа человека в отсутствие мышиного ФНО-альфа и демонстрируют нормальное развитие без видимой патологии.

[0251] Восприимчивость мышей к липополисахариду (ЛПС), полученному из грамотрицательных бактерий, увеличивается при обработке D-галактозамином (D-gal), гепатотоксическим веществом, которое повышает чувствительность к летальному воздействию ЛПС в 100000 раз. Действие D-gal ограничено исключительно гепатоцитами, где он вызывает истощение урациловых нуклеотидов, которое приводит к нарушению биосинтеза РНК и белков. Введение ЛПС/D-gal мышам приводит к устойчивой летальности, наблюдаемой в течение 48 часов, вызванной молниеносным повреждением печени, характеризующимся широким распространением апоптотической гибели гепатоцитов, которая, прежде всего, является результатом сигнализации ФНО-альфа через ФНО-рецептор 1. Обработка мышей нейтрализующим антителом против ФНО-альфа защищает их от летального воздействия гепатотоксичности ЛПС/D-gal.

[0252] ScFv1 и положительный контроль scFv DLX105 вводили два раза, внутрибрюшинно, в дозах 10,0 мг/кг массы тела чФНО-альфа трансгенным мышам возрастом 8-9 недель, за 1 час до и через 1 час после внутрибрюшинной провокации ЛПС/D-Gal (10 нг/доза ЛПС, 20 мг/доза D-gal). Через два часа после провокации ЛПС/D-gal, забирали пробы крови и измеряли уровни мышиного IL-6 в сыворотке при использовании набора Mouse IL-6 DuoSet ELISA согласно инструкциям производителя (R&D Systems, номер по кат. DY406). В группе отрицательного контроля два раза внутрибрюшинно вводили scFv нерелевантной специфичности (отрицательный контрольный scFv) в дозе 10 мг/кг. scFv1 и положительный контроль scFv DLX105 эффективно защищали ЛПС/D-gal-провоцированных мышей, тогда как отрицательный контрольный scFv не обеспечивал такой защиты (Таблица 4). Таким образом, уровни IL-6 в сыворотке мышей были значительно ингибированы scFv1 и положительным контрольным scFv DLX105, тогда как отрицательный контроль scFv не ингибировал IL-6 в сыворотке мышей (Таблица 4).

[0253] В Таблице 4 показан защитный эффект scFv1, положительного контрольного scFv DLX105 и отрицательного контрольного scFv. Показаны выживаемость (%) мышей и уровни мышиного IL-6 в сыворотке как средние значения в пг/Мл, включая стандартное отклонение.

Tg1278/TNFko, n=6 Лечение Выживаемость (%), 48 ч Выживаемость (%), 120 ч Выживаемость Уровни IL-6 в сыворотке, 2 ч
3♂/3♀ DLX105 83,3 66,7 4/6 603±223 пг/мл
3♂/3♀ Отр. контроль scFv 0 0 0/6 5240±1212 пг/мл
3♂/3♀ scFv1 100 83,3 5/6 787±385 пг/мл

[0254] Хотя показаны и описаны предпочтительные варианты осуществления изобретения, следует понимать, что изобретение не ограничивается этим, но может быть осуществлено иным образом, и при этом в рамках следующей ниже формулы изобретения. Поскольку многочисленные модификации и альтернативные варианты осуществления настоящего изобретения будут очевидными специалистам, настоящее описание следует рассматривать исключительно как иллюстративное и предназначенное для пояснения специалистам наилучшего способа осуществления настоящего изобретения. Таким образом, все подходящие модификации и эквиваленты можно рассматривать, как включенные в следующую формулу изобретения.

1. Связывающий элемент, обладающий специфичностью связывания к ФНО-альфа, включающий:

(i) вариабельные последовательности CDR-H1, CDR-H2 и CDR-H3 тяжелой цепи, представленные в SEQ ID No: 6, 7 и 8; и

(ii) вариабельные последовательности CDR-L1, CDR-L2 и CDR-L3 легкой цепи, представленные в SEQ ID No: 3, 4 и 5.

2. Связывающий элемент по п.1, где связывающий элемент имеет IC50 в отношении ФНО-альфа человека ниже 50 пМ, где связывающий элемент необязательно является моновалентным связывающим элементом, таким как scFv.

3. Связывающий элемент по п.1 или 2, являющийся гуманизированным.

4. Связывающий элемент по любому из пп. 1-3, включающий:

(i) вариабельную легкую цепь, обладающую по меньшей мере 90% идентичностью последовательности с SEQ ID No 1; и/или

(ii) вариабельную легкую цепь, обладающую по меньшей мере 90% идентичностью последовательности с SEQ ID No 2.

5. Связывающий элемент по любому из пп. 1-4, включающий линкерную последовательность, где линкерная последовательность является последовательностью, представленной в SEQ ID No: 10, или его вариант.

6. Связывающий элемент по п.5, включающий SEQ ID No 9.

7. Связывающий элемент по любому из пп. 1-6, где вариабельная тяжелая цепь включает по меньшей мере один из следующих остатков:

(i) Серин (S) в аминокислотном положении 12 тяжелой цепи (согласно нумерации AHo);

(ii) Серин (S) или Треонин (T) в аминокислотном положении 103 тяжелой цепи (согласно нумерации AHo); и/или

(iii) Серин (S) или Треонин (T) в аминокислотном положении 144 тяжелой цепи (согласно нумерации AHo).

8. Связывающий элемент по любому из пп. 1-7, который представляет собой или включает:

(i) фрагмент антитела, такой как Fab, Fab', F(ab)'2, scFv, Fv фрагмент, нанотело, VHH или минимальную распознающую единицу;

(ii) молекулу полноразмерного иммуноглобулина; и/или

(iii) неиммуноглобулиновый каркас, такой как аффитело, молекулу аффилина, аднектин, мутеин липокалина, дарпин, ноттин, домен Куниц-типа, авимер, тетранектин или транс-тело.

9. Связывающий элемент по любому из пп. 1-8, являющийся моновалентным или поливалентным, где связывающий элемент необязательно является биспецифическим, предпочтительно диателом, одноцепочечным диателом или тандемным scFv.

10. Связывающий элемент по любому из пп. 1-9, остающийся по меньшей мере на 93% мономерным после инкубирования в течение 1 недели при 37°C в концентрации 10 мг/мл в PBS, pH7,2.

11. Связывающий элемент по любому из пп. 1-10, являющийся химически или биологически модифицированным.

12. Связывающий элемент по п.11, являющийся гликозилированным, ПЭГилированным или ГЭКилированным.

13. Выделенная молекула нуклеиновой кислоты, включающая последовательность, кодирующую связывающий элемент по любому из пп. 1-12, для экспрессии связывающего элемента.

14. Вектор, включающий последовательность молекулы нуклеиновой кислоты по п.13, для экспрессии связывающего элемента.

15. Клетка-хозяин, включающая молекулу нуклеиновой кислоты по п.13 или вектор по п.14, для экспрессии связывающего элемента.

16. Композиция, включающая связывающий элемент по любому из пп. 1-12; а также подходящий носитель, разбавитель или эксципиент, для применения в терапевтических целях в отношении заболевания, опосредованного ФНО-альфа.

17. Композиция, включающая связывающий элемент по любому из пп. 1-12; а также подходящий носитель, разбавитель или эксципиент, для применения в диагностических целях для детекции присутствия ФНО-альфа в образце.

18. Композиция, включающая связывающий элемент по любому из пп. 1-12; а также подходящий носитель, разбавитель или эксципиент, для применения в косметических целях для улучшения эстетического вида кожи.

19. Композиция, включающая молекулу нуклеиновой кислоты по п.13, вектор по п.14 или клетку-хозяин по п.15; а также подходящий носитель, разбавитель или эксципиент, для экспрессии связывающего элемента.

20. Композиция по п.16, являющаяся фармацевтической композицией, причем носитель является фармацевтически приемлемым носителем, разбавителем или эксципиентом.

21. Композиция по п.20, находящаяся в форме, подходящей для парентерального, перорального, ректального, системного, урогенитального, наружного, интравитреального, интраокулярного, ушного, интраназального, дермального, подъязычного или буккального введения.

22. Способ лечения заболевания, опосредованного ФНО-альфа, включающий введение пациенту фармацевтической композиции по любому из пп. 16, 20 или 21.

23. Способ по п.22, где заболевание, опосредованное ФНО-альфа, является по меньшей мере одним из пролиферативной диабетической ретинопатии, подагрического артрита, острого подагрического артрита и хронического подагрического артрита, синдрома Шницлера, системного ювенильного идиопатического артрита, ревматоидного артрита, крапивницы, васкулита, диабета 1-го типа, диабета 2-го типа, рецидивирующего многоочагового остеомиелита, рецидивирующего полихондрита, криопирин-ассоциированного периодического синдрома (КАПС), болезни Бехчета, семейной средиземноморской лихорадки, хронической обструктивной болезни легких, ревматической полимиалгии, NALP3-мутаций, гангренозной пиодермии, хронической идиопатической крапивницы, остеоартроза, влажной формы возрастной макулодистрофии, синдрома сухого глаза, псориаза, синовит-акне-пустулез-гиперостоз-остеит синдрома, синдрома активации макрофагов, периодической болезни, аденита, фарингита, синдрома афтозных язв, болезни Стилла взрослых, дефицита мевалонат-киназы, увеита, воспалительного заболевания кишечника, атеросклероза, ФНО-рецептор-ассоциированного периодического синдрома (TRAPS), анкилозирующего спондилита, гнойного гидраденита, псориаза и обыкновенных угрей.

24. Связывающий элемент по любому из пп. 1-12 для применения в лечении, профилактике или задержке прогрессии заболевания, опосредованного ФНО-альфа.

25. Связывающий элемент по п.24, где заболеванием, опосредованным ФНО-альфа, является пролиферативная диабетическая ретинопатия, подагрический артрит, острый подагрический артрит и хронический подагрический артрит, синдром Шницлера, системный ювенильный идиопатический артрит, ревматоидный артрит, крапивница, васкулит, диабет 1-го типа, диабет 2-го типа, рецидивирующий многоочаговый остеомиелит, рецидивирующий полихондрит, криопирин-ассоциированный периодический синдром (КАПС), болезнь Бехчета, семейная средиземноморская лихорадка, хроническая обструктивная болезнь легких, ревматическая полимиалгия, NALP3-мутации, гангренозная пиодермия, хроническая идиопатическая крапивница, остеоартроз, влажная форма возрастной макулодистрофии, синдром сухого глаза, псориаз, синовит-акне-пустулез-гиперостоз-остеит синдром, синдром активации макрофагов, периодическая болезнь, аденит, фарингит, синдром афтозных язв, болезнь Стилла взрослых, дефицит мевалонаткиназы, увеит, воспалительное заболевание кишечника, атеросклероз, ФНО-рецептор-ассоциированный периодический синдром (TRAPS), анкилозирующий спондилит, гнойный гидраденит, псориаз и/или обыкновенные угри.

26. Связывающий элемент по любому из пп. 1-12:

(i) для применения в качестве лекарственного средства, в особенности при лечении заболевания, опосредованного ФНО-альфа;

(ii) для применения в диагностике;

(iii) для применения в косметике; и/или

(iv) для обнаружения.

27. Способ получения связывающего элемента по любому из пп. 1-12, включающий:

(i) культивирование клетки-хозяина по п.16, что обеспечивает экспрессию связывающего элемента;

(ii) выделение связывающего элемента; и

(iii) необязательно, очистку связывающего элемента.

28. Способ получения связывающего элемента по любому из пп. 1-12, включающий:

(a) контакт бесклеточной системы экспрессии с матрицей продукции нуклеиновой кислоты, причем матрица продукции нуклеиновой кислоты кодирует связывающий элемент по любому из пп. 1-12;

(b) обеспечение протекания транскрипции и трансляции матрицы продукции нуклеиновой кислоты, что обеспечивает образование реакционной смеси;

(c) выделение связывающего элемента из реакционной смеси; и

(d) необязательно, очистку связывающего элемента.

29. Способ получения связывающего элемента по любому из пп. 1-12, где получение связывающего элемента включает стадию химического синтеза.

30. Способ по п.28 или 29, где способ включает стадию химического синтеза.

31. Способ обнаружения присутствия ФНО-альфа в биологическом образце, включающий:

(i) контакт биологического образца со связывающим элементом по любому из пп. 1-12 при условиях, обеспечивающих специфичное связывание связывающего элемента с ФНО-альфа, и

(ii) обнаружение, образовался ли комплекс между связывающим элементом и ФНО-альфа.

32. Способ по п.31, являющийся способом in vitro или способом in vivo.

33. Способ по п.31 или 32, где биологический образец имеет человеческое происхождение.

34. Способ по любому из пп. 31-33, где биологический образец является по меньшей мере одним из пробы крови, пробы мочи, пробы спинномозговой жидкости, биоптата и пробы лимфы.

35. Способ по любому из пп. 31-34, где способ является способом отбора пациентов, соответствующих критериям терапии связывающим элементом по любому из пп.1-13.

36. Набор, включающий связывающий элемент по любому из пп. 1-12 вместе с упакованной комбинацией реактивов и инструкций, для применения в лечении, профилактике или задержки прогрессии заболевания, опосредованного ФНО-альфа.



 

Похожие патенты:
Изобретение относится к области иммунологии. Предложены варианты применения выделенного антитела или его антигенсвязывающего участка, специфичного к B7-H1, в лечении рака.

Изобретение относится к биотехнологии. Описан полипептид для нацеливания на выделяющийся фосфатидилсерин (PtdS) клеточной мембраны, который включает: (а) домен гамма-карбоксиглутаминовой кислоты белка S, представленный в SEQ ID NO: 1, или последовательности, по меньшей мере на 95% гомологичной ей, который не содержит домен протеазы или гормон-связывающий домен; и (б) белок S EGF домена.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая выделенное гуманизированное антитело или его фрагмент, которое специфически связывается с IL-13 (варианты), фармацевтическую композицию для лечения заболевания, связанного с IL-13, применение терапевтически эффективного количества антитела или его фрагмента для получения лекарственного средства для лечения заболевания, связанного с IL-13, применение антитела или его фрагмента для получения лекарственного средства для лечения, подавления или профилактики заболевания, связанного IL-13, у млекопитающего, применение антитела или его фрагмента для получения лекарственного средства, которое используется для подавления ответа, опосредованного TH-2, применение антитела или его фрагмента для подавления ответа, опосредованного TH-2, выделеную молекулу нуклеиновой кислоты, вектор экспрессии, выделенную клетку-хозяин для получения вышеуказанного антитела или его фрагмента.

Настоящее изобретение относится к иммунологии. Предложены антитела, специфично связывающиеся с эпитопом в домене Кунитца 2 (К2), и их антигенсвязывающие фрагменты.

Настоящее изобретение относится к области иммунологии. Предложены выделенное антитело к RGMa и его антигенсвязывающий фрагмент.

Изобретение относится к биотехнологии и медицине, а именно к способу лечения и/или предупреждения кожных инфекций, ассоциированных с IL-4R-связанными заболеваниями. Способ лечения или предупреждения тяжести кожной инфекции, выбранной из группы, состоящей из импетиго, целлюлита, инфекционного дерматита, герпетической экземы, фолликулита, инфицированного волдыря, микоза, отрубевидного лишая, инфекции, вызываемой Staphylococcus aureus, и инфекции, вызываемой Streptococcus, предусматривает введение нуждающемуся в этом субъекту фармацевтической композиции, содержащей терапевтически эффективное количество антагониста IL-4R, где у субъекта атопический дерматит.

Настоящее изобретение относится к области биотехнологии, конкретно к каркасным структурам на основе FnIII-домена тенасцина-3 (Tn3). Изобретение позволяет получить каркасную структуру, способную специфически связываться с CD40L и обладающую повышенной аффинностью в отношении мишени в сравнении с известными аналогами.

Группа изобретений относится к биотехнологии и медицине, а именно к новому пептидному ингибитору PI3Kγ для лечения патологий дыхательной системы. Предложены слитый пептид, ингибирующий киназонезависимую функцию PI3Kγ, комбинированный препарат для последовательного, одновременного или раздельного применения для лечения бронхообструктивных заболеваний и фармацевтическая композиция для лечения респираторных заболеваний.

Изобретение относится к биотехнологии. Описан способ снижения риска и/или профилактики острого эпизода vWF-зависимого заболевания у человека, нуждающегося в этом, включающий этапы: (i) измерение активности ADAMTS13 у указанного человека; (ii) сравнение указанной активности ADAMTS13 со стандартной активностью ADAMTS13; и (iii) если указанная активность ADAMTS13 ниже 30%, имея такое значение, как 20%, 15%, 10% или 5% от указанной стандартной активности ADAMTS13, то введение указанному человеку дозы 5-40 мг, предпочтительно 10 мг, полипептида, включающего по меньшей мере один иммуноглобулиновый одиночный вариабельный домен (ISVD) против фактора фон Виллебранда (vWF), где указанный полипептид содержит или состоит из SEQ ID NO: 1-19.

Изобретение относится к области биотехнологии, конкретно к получению мутеинов фактора дифференцировки роста (GDF15) и их конъюгатов, и может быть использовано в медицине.
Изобретение относится к области иммунологии. Предложены варианты применения выделенного антитела или его антигенсвязывающего участка, специфичного к B7-H1, в лечении рака.

Изобретение относится к биотехнологии. Описан полипептид для нацеливания на выделяющийся фосфатидилсерин (PtdS) клеточной мембраны, который включает: (а) домен гамма-карбоксиглутаминовой кислоты белка S, представленный в SEQ ID NO: 1, или последовательности, по меньшей мере на 95% гомологичной ей, который не содержит домен протеазы или гормон-связывающий домен; и (б) белок S EGF домена.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая выделенное гуманизированное антитело или его фрагмент, которое специфически связывается с IL-13 (варианты), фармацевтическую композицию для лечения заболевания, связанного с IL-13, применение терапевтически эффективного количества антитела или его фрагмента для получения лекарственного средства для лечения заболевания, связанного с IL-13, применение антитела или его фрагмента для получения лекарственного средства для лечения, подавления или профилактики заболевания, связанного IL-13, у млекопитающего, применение антитела или его фрагмента для получения лекарственного средства, которое используется для подавления ответа, опосредованного TH-2, применение антитела или его фрагмента для подавления ответа, опосредованного TH-2, выделеную молекулу нуклеиновой кислоты, вектор экспрессии, выделенную клетку-хозяин для получения вышеуказанного антитела или его фрагмента.

Группа изобретений относится к области биотехнологии. Предложены способы получения содержащего две цепи полипептида, в частности содержащего тяжелую цепь и легкую цепь полуантитела, в частности полуантитела против ИЛ-13, а также против ИЛ-17 в прокариотической клетке-хозяине, а также способы получения биспецифического антитела, содержащего способное связывать первый антиген, в частности связывать ИЛ-13, первое полуантитело и способное связывать второй антиген, в частности связывать ИЛ-17, второе полуантитело.

Изобретение относится к биотехнологии и медицине, а именно к способу лечения и/или предупреждения кожных инфекций, ассоциированных с IL-4R-связанными заболеваниями. Способ лечения или предупреждения тяжести кожной инфекции, выбранной из группы, состоящей из импетиго, целлюлита, инфекционного дерматита, герпетической экземы, фолликулита, инфицированного волдыря, микоза, отрубевидного лишая, инфекции, вызываемой Staphylococcus aureus, и инфекции, вызываемой Streptococcus, предусматривает введение нуждающемуся в этом субъекту фармацевтической композиции, содержащей терапевтически эффективное количество антагониста IL-4R, где у субъекта атопический дерматит.

Настоящее изобретение относится к области биотехнологии, конкретно к каркасным структурам на основе FnIII-домена тенасцина-3 (Tn3). Изобретение позволяет получить каркасную структуру, способную специфически связываться с CD40L и обладающую повышенной аффинностью в отношении мишени в сравнении с известными аналогами.

Настоящее изобретение относится к иммунологии. Предложена полипептидная конструкция, способная специфически связывать фактор некроза опухолей альфа (TNF-альфа), содержащая два-четыре антагонистических однодоменных антитела, направленных против TNF-альфа, и одно однодоменное антитело, направленное против сывороточного белка.

Изобретение относится к иммунологии. Предложено неконкурентное в отношении нейрегулина (NRG) аллостерическое антитело против человеческого HER3 и его фрагмент, а также кодирующая нуклеиновая кислота, вектор, клетка-хозяин, фармацевтическая композиция и способ лечения рака.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая линкерное звено, содержащее центральную сердцевину, связывающие ветви и, необязательно, соединяющую ветвь (варианты).

Настоящее изобретение относится к области биотехнологии, а именно к применению антитела к HSV и фармацевтической композиции для местного нанесения при лечении острой инфекции слизистой или эпидермальной ткани у индивидуума.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая выделенное гуманизированное антитело или его фрагмент, которое специфически связывается с IL-13 (варианты), фармацевтическую композицию для лечения заболевания, связанного с IL-13, применение терапевтически эффективного количества антитела или его фрагмента для получения лекарственного средства для лечения заболевания, связанного с IL-13, применение антитела или его фрагмента для получения лекарственного средства для лечения, подавления или профилактики заболевания, связанного IL-13, у млекопитающего, применение антитела или его фрагмента для получения лекарственного средства, которое используется для подавления ответа, опосредованного TH-2, применение антитела или его фрагмента для подавления ответа, опосредованного TH-2, выделеную молекулу нуклеиновой кислоты, вектор экспрессии, выделенную клетку-хозяин для получения вышеуказанного антитела или его фрагмента.

Изобретение относится к биотехнологии. Описан связывающий элемент, обладающий специфичностью связывания к ФНО-альфа, включающий: вариабельные последовательности CDR-H1, CDR-H2 и CDR-H3 тяжелой цепи, представленные в SEQ ID No: 6, 7 и 8; и вариабельные последовательности CDR-L1, CDR-L2 и CDR-L3 легкой цепи, представленные в SEQ ID No: 3, 4 и 5. Также представлена выделенная молекула нуклеиновой кислоты, включающая последовательность, кодирующую связывающий элемент. Представлен способ получений указанного связывающего элемента. Кроме того, представлен соответствующий вектор экспрессии и клетка-хозяин, композиции. Изобретение может использоваться в лечении воспалительных и других заболеваний, а также в диагностике. Представлен способ лечения заболевания, опосредованного ФНО-альфа и способ обнаружения присутствия ФНО-альфа в биологическом образце. 14 н. и 22 з.п. ф-лы, 4 ил., 4 табл., 9 пр.

Наверх