Способ прогнозирования риска возникновения рака или диагностирования рака у женщины

Группа изобретений относится к медицине и касается набора для определения проэнкефалина и фрагментов проэнкефалина в образце, содержащего две связывающие молекулы, которые связываются с двумя различными областями в области проэнкефалина, состоящей из аминокислот 133-140 (LKELLETG, SEQ ID NO: 22) и аминокислот 152-159 (SDNEEEVS, SEQ ID NO: 23), где каждая связывающая молекула является антителом, которое связывается только с одной из указанных областей в области проэнкефалина, и где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот. Группа изобретений также касается применения указанного набора для прогнозирования риска возникновения рака, выбранного из рака молочной железы или рака легких у женщины, которая не страдает раком, и для стратификации указанных женщин на группы риска. Группа изобретений обеспечивает прогнозирование риска возникновения рака, выбранного из рака молочной железы или рака легких у женщины, которая не страдает раком, и стратификацию указанных женщин на группы риска. 3 н. и 2 з.п. ф-лы, 1 пр., 3 ил., 10 табл.

 

Объектом настоящего изобретения является способ прогнозирования риска возникновения рака у женщины, которая не страдает раком, или альтернативно этому диагностирования рака у женщины, заключающийся в том, что:

• определяют уровень проэнкефалина (PENK) или его фрагментов, включая Leu-энкефалин и Met-энкефалин, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины, и

• устанавливают корреляцию между указанным уровнем проэнкефалина или его фрагментов и риском возникновения рака, при этом пониженный уровень является прогностическим критерием повышенного риска возникновения рака, или альтернативно этому диагностируют рак, при этом пониженный уровень коррелирует с диагнозом рака.

Met-энкефалин, который представляет собой состоящий из 5 аминокислот пептид, выведенный из предшественника энкефалина (пре-проэнкефалина), который обозначают также как «опиоидный фактор роста» (OGF), высвобождается вместе с фрагментами проэнкефалина. Зрелый пептид связывается с различными опиоидными рецепторами (Koneru и др., 2009). Установлено, что энкефалин (OGF) обладает целым рядом физиологических функций. В ЦНС он осуществляет понижающую регуляцию пути передачи болевого сигнала, ассоциированного с субстанцией P, он выполняет функцию цитокина (Plotnikoff и др., 1997). Родственные проэнкефалину пептиды обладают антибиотическими действиями (Goumon и др., 1998). Проэнкефалин и энкефалин обладают противоопухолевой активностью и действуют в качестве проапоптозных агентов (Tavish и др., 2007, Donahue и др., 2011, Zagon и др., 2009).

Применение вазоактивных пептидов для прогнозирования рисков возникновения рака у мужчин описано у Belting и др., Cancer, Epidemiology, Biomarkes & Prevention. Были проведены измерения уровней MR-про-ANP, MR-про-ADM и копептина в плазме натощак у индивидуумов, принимавших участие в проводившемся университетом г. Мальмё исследовании по изучению диеты и рака (Malmö Diet and Cancer Study), которые не страдали раком до проводившегося в период с 1991 по 1994 г. обследования для определения исходного уровня (1768 мужчин и 2293 женщины). Авторы установили, что у женщин не было выявлено связи между биомаркерами и возникновением рака.

В основу настоящего изобретения была положена задача исследовать прогностический и диагностический потенциал PENK для прогнозирования возникновения рака и прогнозирования риска рецидива рака. Для этой цели в ходе указанного выше шведского проспективного группового исследования (Malmö Diet and Cancer Study) проводили измерения уровней стабильных фрагментов проэнкефалина (Ernst и др., 2006) в плазме натощак и соотносили исходный уровень указанного биомаркера с возникновением рака молочной железы в течение последующего 15-летнего периода наблюдения.

При создании изобретения неожиданно было установлено, что для женщин проэнкефалин является эффективным и высоко значимым биомаркером, позволяющим прогнозировать риск возникновения рака у женщины, не страдающей раком, или альтернативно этому диагностировать рак у женщины.

Таким образом, объектом настоящего изобретения является способ прогнозирования возникновения рака у женщины, которая не страдает раком, или альтернативно этому диагностирования рака у женщины, заключающийся в том, что:

• определяют уровень проэнкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины, и

• устанавливают корреляцию между указанным уровнем проэнкефалина или его фрагментов и риском возникновения рака, при этом пониженный уровень является прогностическим критерием повышенного риска возникновения рака, или альтернативно этому диагностируют рак, при этом пониженный уровень коррелирует с диагнозом рака.

Примерами видов рака могут служить виды, выбранные из группы, включающей рак молочной железы, рак легкого, рак поджелудочной железы и рак ободочной кишки.

Следует иметь в виду, что в контексте настоящего описания понятие «фрагменты проэнкефалина» включает также Leu-энкефалин и Met-энкефалин.

В конкретном варианте осуществления изобретения указанный рак представляет собой рак молочной железы. В другом конкретном варианте осуществления изобретения указанный рак представляет собой рак легкого.

Таким образом, объектом настоящего изобретения является определение чувствительности женщины к возникновению рака, например, рака молочной железы, рака легкого и т.д.

Данные, полученные в настоящем исследовании, позволили выявить также корреляцию между риском возникновения рака у мужчин и уровнем про-энкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанного мужчины; однако оказалось, что указанная корреляция, установленная на основе имевшегося набора данных, не являлась статистически значимой, хотя и у мужчин была выявлена выраженная тенденция к повышенному риску возникновения рака при пониженных уровнях PENK. Таким образом, способ, предлагаемый в изобретении, имеет ценность также и для мужчин, однако выявленный в проведенном при создании изобретения исследовании эффект для мужчин оказался не таким выраженным, как для женщин. Это может быть обусловлено, прежде всего, тем, что в мужской популяции имелось небольшое количество случаев рака.

Кроме того, данные, полученные при создании настоящего изобретения, позволили выявить также корреляцию между риском возникновения рака у женщин и уровнем Pro-энкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины, в том случае, когда указанный рак не представляет собой рак легкого или рак молочной железы. Однако вследствие небольшого количества случаев в этой конкретной популяции, указанная корреляция, установленная на основе имевшегося набора данных, не была статистически значимой. Тенденция, хотя она и не была значимой, тем не менее, была выраженной. Существование такой корреляции, выявленной на основе полученных данных, также и в случае других видов рака является весьма вероятной, поскольку известно, что энкефалин, фрагмент PENK, обладает проапоптозным действием. На основе известных из существующего уровня техники сведений оказалось неожиданным, что проэнкефалин или его фрагменты могут служить в качестве прогностических критериев рака. На основе полученных при создании настоящего изобретения данных, которые являются статистически высоко достоверными для рака молочной железы и рака легкого, можно ожидать, и это является правдоподобным, что они могут служить в качестве прогностического критерия также и для других типов рака.

В контексте настоящего описания понятие «индивидуум» относится к живому человеку или организму кроме человека. Предпочтительно в контексте настоящего описания индивидуум представляет собой человека.

Понятие «пониженный уровень» означает уровень, находящийся ниже определенного порогового уровня.

Общую воду организма можно выбирать из группы, включающей кровь, сыворотку, плазму, мочу, спинномозговую жидкость (СМЖ) и слюну.

В одном из вариантов осуществления изобретения у указанной женщины ни разу не диагностировали рак до момента времени взятия у указанной женщины образца общей воды организма.

В другом варианте осуществления изобретения у указанной женщины был ранее диагностирован рак и он был излечен ко времени взятия у указанной женщины образца общей воды организма, и у нее определяют риск рецидива возникновения рака или альтернативно этому прогнозируют рецидив рака.

Проэнкефалин имеет следующую последовательность:

SEQ ID NO: 1 (проэнкефалин (1-243))

ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGF MRF

Фрагменты проэнкефалина, которые можно определять в общей воде организма, можно выбирать, например, из группы следующих фрагментов:

SEQ ID NO: 2 (синэнкефалин, проэнкефалин 1-73)

ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLA

SEQ ID NO: 3 (Met-энкефалин)

YGGFM

SEQ ID NO: 4 (Leu-энкефалин)

YGGFL

SEQ ID NO: 5 (проэнкефалин 90-109)

MDELYPMEPEEEANGSEILA

SEQ ID NO: 6 (проэнкефалин 119-159, фрагмент срединной области проэнкефалина, MRPENK)

DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVS

SEQ ID NO: 7 (Met-энкефалин-Arg-Gly-Leu)

YGGFMRGL

SEQ ID NO: 8 (проэнкефалин 172-183)

SPQLEDEAKELQ

SEQ ID NO: 9 (проэнкефалин 193-203)

VGRPEWWMDYQ

SEQ ID NO: 10 (проэнкефалин 213-234)

FAEALPSDEEGESYSKEVPEME

SEQ ID NO: 11 (проэнкефалин 213-241)

FAEALPSDEEGESYSKEVPEMEKRYGGF M

SEQ ID NO: 12 (Met-энкефалин-Arg-Phe)

YGGFMRF

Определение уровня проэнкефалина, включая Leu-энкефалин и Met-энкефалин, или их фрагментов можно осуществлять посредством определения иммунореактивности в отношении проэнкефалина или его фрагментов, включая Leu-энкефалин и Met-энкефалин. В зависимости от области связывания связывающая молекула, которую применяют для определения проэнкефалина или его фрагментов, включая Leu-энкефалин и Met-энкефалин, может связываться с более чем одной из указанных выше молекул. Это должно быть очевидно специалисту в данной области.

Таким образом, согласно настоящему изобретению определяют уровень иммунореактивного аналита с использованием по меньшей мере одной связывающей молекулы, которая связывается с областью в аминокислотной последовательности любого из вышеуказанных пептидов и пептидных фрагментов (т.е. проэнкефалина (PENK) и его фрагментов, имеющих любую из последовательностей 1-12), в общей воде организма, взятой у указанного индивидуума, и устанавливают имеющую клиническое значение корреляцию согласно конкретным вариантам осуществления изобретения.

В более конкретном варианте способа, предлагаемого в настоящем изобретении, определяют уровень MRPENK (SEQ ID NO: 6: проэнкефалин 119-159, т.е. фрагмент срединной области проэнкефалина, MRPENK). В более конкретном варианте осуществления изобретения определяют уровень иммунореактивного аналита с использованием по меньшей мере одной связывающей молекулы, которая связывается с MR-PENK, и устанавливают имеющую клиническое значение корреляцию согласно конкретным вариантам осуществления изобретения.

Определение уровня проэнкефалина или его фрагментов, включая Leu-энкефалин и Met-энкефалин, или их фрагментов, можно осуществлять посредством определения иммунореактивности в отношении проэнкефалина или его фрагментов, включая Leu-энкефалин и Met-энкефалин. В зависимости от области связывания связывающая молекула, которую применяют для определения проэнкефалина, включая Leu-энкефалин и Met-энкефалин, или их фрагментов, может связываться с более чем одной из указанных выше молекул. Это должно быть очевидно специалисту в данной области. В другом варианте осуществления изобретения фрагмент не представляет собой Leu-энкефалин или Met-энкефалин. В другом варианте осуществления изобретения определяют иммунореактивность в отношении проэнкефалина или его фрагментов за исключением Leu-энкефалина и Met-энкефалина.

В более конкретном варианте способа, предлагаемого в настоящем изобретении, определяют уровень MRPENK (SEQ ID NO: 6 (проэнкефалин 119-159, фрагмент срединной области проэнкефалина, MRPENK, DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVS).

Альтернативно этому уровень любого из указанных выше аналитов можно определять с помощью других аналитических методов, например, с помощью масс-спектроскопии.

В конкретном варианте осуществления изобретения уровень проэнкефалина или его фрагментов измеряют с помощью иммуноанализа с использованием антител или фрагментов антител, которые связываются с проэнкефалином или его фрагментами. Иммуноанализ, который можно применять для определения уровня проэнкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, может включать стадии, описанные в примере 2. Все пороговые значения и величины должны рассматриваться в контексте теста и калибровки, которые применяли в примере 2. Специалисту в данной области должно быть известно, что абсолютная величина порогового значения может зависеть от применяемой калибровки. Это означает, что все величины и пороговые значения, представленные в настоящем описании, следует рассматривать в контексте использованной в настоящем описании калибровки (пример 2).

Согласно изобретению диагностическую связывающую молекулу, которая связывается с проэнкефалином, выбирают из группы, включающей антитела, например, IgG, как правило, полноразмерный иммуноглобулин, или фрагменты антител, содержащие по меньшей мере вариабельный (Fv) домен тяжелой и/или легкой цепи, такие, например, как химически сшитые антитела (антигенсвязывающие фрагменты), включая (но, не ограничиваясь только ими) Fab-фрагменты, включая миниантитела в виде Fab, антитело в виде одноцепочечного Fab, одновалентное антитело в виде Fab с эпитопными метками, например, Fab-V5SЧ2; двухвалентный Fab (мини-антитело), димеризованный с помощью CH3-домена; двухвалентный Fab или многовалентный Fab, например, образованный посредством мультимеризации с помощью гетерологичного домена, например, посредством димеризации dHLX-доменов, например, Fab-dHLX-FSЧ2; F(ab')2-фрагменты, scFv-фрагменты, мультимеризованные многовалентные и/или мультиспецифические scFv-фрагменты, двухвалентные и/или биспецифические диабоди, BITE® (биспецифический активатор T-клеток), трифункциональные антитела, многовалентные антитела, например, класса, отличного от G-класса; однодоменные антитела, например, наноантитела, выведенные из верблюжьих или рыбьих иммуноглобулинов.

В конкретном варианте осуществления изобретения уровень проэнкефалина или его фрагментов измеряют с помощью анализа с использованием связывающих молекул, выбранных из группы, включающей аптамеры, не-Ig-каркасы, которые связываются с проэнкефалином или его фрагментами, что будет более подробно описано ниже.

Связывающая молекула, которую можно применять для определения уровня проэнкефалина или его фрагментов, характеризуется константой аффинности к проэнкефалину, составляющей по меньшей мере 107M-1, предпочтительно 108M-1, предпочтительно константа аффинности превышает 109M-1, наиболее предпочтительно превышает 1010M-1. Специалисту в данной области известно, что для компенсации пониженной аффинности можно рассматривать применение соединений в более высокой дозе, и этот подход не выходит за рамки объема изобретения. Аффинность связывания можно определять с помощью метода Biacore, доступного в виде сервисного анализа, например, на сайте фирмы Biaffin, Кассель, Германия (http://www.biaffin.com/de/).

Контрольный образец человеческого проэнкефалина можно получать от фирмы ICI-Diagnostics, Берлин, Германия (http://www.ici-diagnostics.com/). При проведении анализа калибровку можно осуществлять с использованием синтетического (для экспериментов, проведенных при создании настоящего изобретения, применяли синтетический MRPENK, SEQ ID NO: 6) или рекомбинантного проэнкефалина или его фрагментов.

Пороговое значение для определения риска возникновения рака молочной железы у женщины или диагностирования рака молочной железы у женщины согласно способам, предлагаемым в настоящем изобретении, составляет менее 100 пмолей PENK/л, предпочтительно менее 50 пмолей/л, более предпочтительно менее 40,4 пмоля/л. В конкретном варианте осуществления изобретения указанное пороговое значение составляет примерно 40,4 пмоля/л. Указанные пороговые значения соответствуют значениям, определенным с использованием указанного выше метода калибровки. Если уровень PENK находится ниже указанного порогового значения, то это означает, что индивидуум имеет повышенный риск возникновения рака или уже имеет рак.

В одном из вариантов осуществления изобретения указанный способ осуществляют более одного раза для мониторинга риска возникновения рака молочной железы у женщины или для мониторинга процесса лечения. В одном из конкретных вариантов осуществления изобретения указанный мониторинг осуществляют для того, чтобы оценивать ответ указанной женщины на предпринятые профилактические и/или терапевтические меры.

В одном из вариантов осуществления изобретения способ применяют для стратификации указанных женщин на группы риска.

Объектом настоящего изобретения является также способ прогнозирования риска возникновения рака у женщины или идентификации женщины, имеющей повышенный риск возникновения рака, согласно одному из предыдущих вариантов осуществления изобретения, в котором применяют уровень проэнкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины, либо индивидуально, либо в сочетании с другими пригодными для прогнозирования лабораторными или клиническими параметрами, для прогнозирования риска возникновения у индивидуума нежелательного явления с помощью способа, который можно выбирать из следующих альтернатив:

• сравнение медианы уровня проэнкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины, и предварительно определенного уровня в совокупности образцов, взятых из популяции «здоровых» или «по-видимому, здоровых» индивидуумов,

• сравнение квантиля уровня проэнкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины, и предварительно определенного уровня в совокупности образцов, взятых из популяции «здоровых» или «по-видимому, здоровых» индивидуумов,

• расчет на основе анализа пропорциональных рисков Кокса или расчетов коэффициентов риска, таких как NRI (чистый коэффициент переклассификации, Net Reclassification Index) или IDI (интегральный индекс дискриминации, Integrated Discrimination Index).

В одном из вариантов осуществления изобретения объектом изобретения является также способ прогнозирования риска возникновения рака у женщины или идентификации женщины, имеющей повышенный риск возникновения рака, по одному из предыдущих вариантов осуществления изобретения, в котором уровень проэнкефалина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины, применяют либо индивидуально, либо в сочетании с другим пригодным для прогнозирования биомаркером. Таким пригодным биомаркером может служить пронейротензин и его фрагменты, состоящие по меньшей мере из 5 аминокислот.

В более конкретном варианте способа, предлагаемого в настоящем изобретении, определяют уровень пронейротензина 1-117 в дополнение к определению проэнкефалина или его фрагментов.

Таким образом, объектом настоящего изобретения является также способ прогнозирования риска возникновения рака у женщины, которая не страдает раком, или альтернативно этому диагностирования рака у женщины, заключающийся в том, что:

определяют уровень проэнкефалина или его фрагментов, включая Leu-энкефалин и Met-энкефалин, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины; и

определяют уровень пронейротензина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, в общей воде организма, взятой у указанной женщины; и

устанавливают корреляцию между указанным уровнем проэнкефалина или его фрагментов и пронейротензина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, с риском возникновения рака, при этом пониженный уровень проэнкефалина является прогностическим критерием повышенного риска возникновения рака, или альтернативно этому диагностируют рак, при этом пониженный уровень коррелирует с диагнозом рака, и при этом повышенный уровень пронейротензина является прогностическим критерием повышенного риска возникновения рака, или альтернативно этому диагностируют рак, при этом повышенный уровень коррелирует с диагнозом рака.

SEQ ID NO: 13 (пронейротензин 1-147)

SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVIKRK IPYILKRQLY ENKPRRPYIL KRDSYYY

SEQ ID NO: 14 (пронейротензин 1-125 (большой нейромедин N))

SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVI KR KIPYIL

SEQ ID NO: 15 (нейромедин N)

KIPYIL

SEQ ID NO: 16 (нейротензин)

pyroQLYENKPRRP YIL

SEQ ID NO: 17 (пронейротензин 1-117)

SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVI

SEQ ID NO: 18 (пронейротензин 1-132)

SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVIKRK IPYILKRQLY EN

SEQ ID NO: 19 (пронейротензин 120-140)

KIPYILKRQL YENKPRRPYI L

SEQ ID NO: 20 (пронейротензин 120-147)

KIPYILKRQL YENKPRRPYIL KRDSYYY

SEQ ID NO: 21 (пронейротензин 128-147)

QLYENKPRRP YILKRDSYYY

В конкретном варианте осуществления изобретения уровень пронейротензина измеряют с помощью иммуноанализа. Более конкретно, применяют иммуноанализ, описанный у Ernst и др. (Peptides, (27), 2006, сс. 1787-1793). Иммуноанализ, который можно применять для определения уровня пронейротензина или его фрагментов, состоящих по меньшей мере из 5 аминокислот, может включать стадии, описанные в примере 2. Все пороговые значения и величины должны рассматриваться в контексте теста и калибровки, которые применяли в примере 2. Специалисту в данной области должно быть известно, что абсолютная величина порогового значения может зависеть от применяемой калибровки. Это означает, что все величины и пороговые значения, представленные в настоящем описании, следует рассматривать в контексте использованной в настоящем описании калибровки (пример 2). Человеческий пронейротензин-калибратор можно получать от фирмы ICI-Diagnostics, Берлин, Германия. Альтернативно этому анализ можно калибровать также с использованием синтетического или рекомбинантного P-NT 1-117 или его фрагментов (см. также Ernst и др., 2006).

Связывающая молекула, которую можно применять для определения уровня пронейротензина (P-NT) или его фрагментов, характеризуется константой аффиности к пронейротензину, составляющей по меньшей мере 107M-1, предпочтительно 108M-1, предпочтительно константа аффинности превышает 109M-1, наиболее предпочтительно превышает 1010M-1. Специалисту в данной области известно, что для компенсации пониженной аффинности можно рассматривать применение соединений в более высокой дозе, и этот подход не выходит за рамки объема изобретения. Аффинность связывания можно определять с помощью метода Biacore, доступного в виде сервисного анализа, например, на сайте фирмы Biaffin, Кассель, Германия (http://www.biaffin.com/de/). Пороговое значение для определения риска возникновения рака молочной железы у женщины или диагностирования рака молочной железы у женщины согласно способам, предлагаемым в настоящем изобретении, составляет более 78 пмолей P-NT/л, предпочтительно 100 пмолей/л, более предпочтительно 150 пмолей/л. В конкретном варианте осуществления изобретения указанное пороговое значение составляет примерно 100 пмолей/л. Указанные пороговые значения соответствуют значениям, определенным с использованием указанного выше метода калибровки. Если уровень P-NT превышает указанное пороговое значение, то это означает, что индивидуум имеет повышенный риск возникновения рака или уже имеет рак.

В одном из вариантов осуществления изобретения указанный способ осуществляют более одного раза для мониторинга риска возникновения рака молочной железы у женщины или для мониторинга процесса лечения. В одном из конкретных вариантов осуществления изобретения указанный мониторинг осуществляют для того, чтобы оценивать ответ указанной женщины на предпринятые профилактические и/или терапевтические меры.

В одном из вариантов осуществления изобретения способ применяют для стратификации указанных женщин на группы риска.

В одном из вариантов осуществления изобретения рак выбирают из группы, включающей рак молочной железы и рак легкого.

Кроме того, объектом изобретения является анализ для определения проэнкефалина и фрагментов проэнкефалина в образце, в котором применяют две связывающие молекулы, которые связываются с двумя различными областями в области проэнкефалина, которая включает аминокислоты 133-140 (LKELLETG, SEQ ID NO: 22) и аминокислоты 152-159 (SDNEEEVS, SEQ ID NO: 23), где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот.

В одном из вариантов анализа для определения проэнкефалина или фрагментов проэнкефалина в образце согласно настоящему изобретению чувствительность указанного анализа позволяет осуществлять количественную оценку проэнкефалина или фрагментов проэнкефалина у здоровых индивидуумов, и она составляет < 15 пмолей/л, предпочтительно < 10 пмолей/л и более предпочтительно < 6 пмолей/л.

В одном из вариантов анализа для определения проэнкефалина или фрагментов проэнкефалина в образце согласно настоящему изобретению указанная связывающая молекула характеризуется аффинностью связывания со своим партнером по связыванию, составляющей по меньшей мере 107M-1, предпочтительно 108M-1, предпочтительно константа аффинности составляет менее 109M-1, наиболее предпочтительно менее 1010M-1. Специалисту в данной области известно, что для компенсации пониженной аффинности можно рассматривать применение соединений в более высокой дозе, и этот подход не выходит за рамки объема изобретения.

В одном из вариантов анализов для определения согласно настоящему изобретению проэнкефалина или фрагментов проэнкефалина в образце такой анализ представляет собой сэндвич-анализ, предпочтительно полностью автоматический анализ. Он может представлять собой полностью автоматический или выполняемый вручную ELISA. Он может представлять собой так называемый POC-тест (анализ по месту лечения). Примерами автоматических или полностью автоматических анализов являются анализы, которые можно применять с использованием одной из следующих систем: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, Biomerieux Vidas®, Alere Triage®. Примеры форматов тестов представлены выше.

В одном из вариантов анализов для определения согласно настоящему изобретению проэнкефалина или фрагментов проэнкефалина в образце по меньшей мере одну из указанных двух связывающих молекул метят для целей обнаружения. Примеры меток представлены выше.

В одном из вариантов анализов для определения согласно настоящему изобретению проэнкефалина или фрагментов проэнкефалина в образце по меньшей мере одну из указанных двух связывающих молекул связывают с твердой фазой. Примеры твердых фаз представлены выше.

В одном из вариантов анализов для определения согласно настоящему изобретению проэнкефалина или фрагментов проэнкефалина в образце указанную метку выбирают из группы, включающей хемилюминисцентную метку, ферментную метку, флуоресцентную метку, метку, представляющую собой радиоактивный йод.

Другим объектом настоящего изобретение является набор, содержащий систему анализа, предлагаемого в настоящем изобретении, где компоненты указанной системы анализа могут содержаться в одном или нескольких контейнерах.

Примеры

Пример 1

Создание антител

Пептиды

Пептиды синтезировали на фирме JPT Technologies, Берлин, Германия.

Пептиды/конъюгаты для иммунизации:

Пептиды, предназначенные для иммунизации, синтезировали (фирма JPT Technologies, Берлин, Германия) с включением дополнительного N-концевого остатка цистеина для конъюгации пептидов с бычьим сывороточным альбумином (БСА). Пептиды ковалентно сшивали с БСА с использованием сульфо-SMCC (фирма Perbio-science, Бонн, Германия). Процедуру сочетания осуществляли согласно руководству фирмы Perbio.

Таблица 1:

Пептид для иммунизации Последовательность проэнкефалина
(C)DAEEDD 119-125
(C)EEDDSLANSSDLLK 121-134
(C)LKELLETG 133-140
(C)TGDNRERSHHQDGSDNE 139-155
(C)SDNEEEVS 152-159

Антитела создавали согласно следующему методу:

Мышь линии BALB/c иммунизировали путем введения 100 мкг конъюгата пептид-БСА в дни 0 и 14 (эмульгированного в 100 мкл полного адъюванта Фрейнда) и 50 мкг в дни 21 и 28 (в 100 мкл неполного адъюванта Фрейнда). За три дня до осуществления эксперимента по слиянию животному вводили 50 мкг конъюгата, растворенного в 100 мкг физиологического раствора, путем одной внутрибрюшинной и одной внутривенной инъекции.

Осуществляли слияние спленоцитов иммунизированной мыши с клетками миеломы линии SP2/0 с использованием 1 мкл 50% полиэтиленгликоля в течение 30 с при 37єC. После отмывки клетки высевали в 96-луночные планшеты для клеточных культур. Гибридные клоны отбирали путем выращивания в среде ГАТ (питательная среда RPMI 1640, дополненная 20% сыворотки плода коровы и ГАТ-добавкой (гипоксантин, аминоптерин, тимидин)). Через две недели среду ГАТ заменяли средой ГТ и после осуществления трех пересевов возвращались к стандартной среде для клеточных культур.

Через три недели после осуществления слияния проводили первичный скрининг супернатантов клеточной культуры в отношении антигенспецифических антител IgG-типа. Позитивные по данным теста микрокультуры переносили в 24-луночные планшеты для размножения. После повторного тестирования осуществляли клонирование и повторное клонирование отобранных культур с применением метода серийных разведений и определяли изотипы (Lane R.D. «A short-duration polyethylene glycol fusiontechnique for increasing production of monoclonal antibody-secreting hybridomas», J. Immunol. Meth. 81, 1985, сс. 223-228; Ziegler B. и др., «Glutamate decarboxylase (GAD) is not detectable on the surface of rat islet cells examined by cytofluorometry and complement-dependent antibody-mediated cytotoxicity of monoclonal GAD antibodies», Horm. Metab. Res. 28, 1996, сс. 11-15).

Получение моноклональных антител

Антитела получали согласно стандартным методам получения антител (Marx и др., Monoclonal Antibody Production, ATLA 25, 1997, с. 121) и очищали с помощью хроматографии на белке A. Чистота антител составляла > 95% по данным электрофоретического анализа на геле в присутствии ДСН.

Мечение антител и их применение для сенсибилизации

Все антитела метили с использованием сложного эфира акридиния согласно следующей процедуре:

Меченое соединение (метка): 100 мкг (100 мкл) антитела (1 мг/мл в ЗФР, pH 7,4), смешивали с 10 мкл сложного NHS-эфира акридиния (1 мг/мл в ацетонитриле, фирма InVent GmbH, Германия) (EP 0353971) и инкубировали в течение 20 мин при комнатной температуре. Меченое антитело очищали методом ЖХВР с помощью гель-фильтрации на Bio-Sil SEC 400-5 (фирма Bio-Rad Laboratories, Inc., США). Очищенное меченое антитело разводили в 300 ммолей/л фосфата калия, 100 ммолей/л NaCl, 10 ммолей/л Na-ЭДТК, 5 г/л бычьего сывороточного альбумина, pH 7,0. Конечная концентрация меченого соединения соответствовала примерно 800000 относительным световым единицам (RLU) (примерно 20 нг меченого антитела) на 200 мкл. Хемилюминисценцию сложного эфира акридиния измеряли с помощью устройства AutoLumat LB 953 (фирма Berthold Technologies GmbH & Co. KG).

Антитело на твердой фазе (применяемое для сенсибилизации антитело):

Твердая фаза: Полистироловые пробирки (фирма Greiner Bio-One International AG, Австрия) сенсибилизировали (в течение 18 ч при комнатной температуре) антителом (1,5 мкг антитела на 0,3 мл буфера, содержащего 100 ммолей/л NaCl, 50 ммолей/л Трис/HCl, pH 7,8). После блокирования с помощью 5% бычьего сывороточного альбумина, пробирки промывали ЗФР, pH 7,4 и сушили в вакууме.

Специфичность антител

Перекрестные реактивности антител представлены в таблице 2

Таблица 2:

Пептид для иммунизации Последовательность пре-проэнкефалина Обозначение антитела
(C)DAEEDD 119-125 NT-MRPENK
(C)EEDDSLANSSDLLK 121-134 NM-MRPENK
(C)LKELLETG 133-140 NR-MRPENK
(C)TGDNRERSHHQDGSDNE 139-155 NC-MRPENK
(C)SDNEEEVS 152-159 CT-MRPENK

Перекрестные реактивности антител определяли следующим образом: вносили с помощью пипетки по 1 мкг пептида в 300 мкл ЗФР, pH 7,4 в полистироловые пробирки и инкубировали в течение 1 ч при комнатной температуре. После инкубации пробирки 5-кратно промывали (используя каждый раз по 1 мл) 5% БСА в ЗФР, pH 7,4. Добавляли каждое из меченых антител (300 мкл в ЗФР, pH 7,4, 800000 RLU/300 мкл) и инкубировали в течение 2 ч при комнатной температуре. После 5-кратной промывки (используя каждый раз по 1 мл промывочного раствора (20 ммолей/л ЗФР, pH 7,4, 0,1% Тритон X 100)), количественно оценивали оставшуюся люминисценцию (от меченого антитела) с помощью люминометра AutoLumat Luminumeter 953. MRPENK-пептид применяли в качестве референс-молекулы (100%).

Таблица 3:

Антитело DAEE
DD
EEDDSLANSS
DLLK
LKELLE
TG
TGDNRERSHH
QDGSDNE
SDNEEE
VS
MRPENK
SEQ ID NO: 6
NT-MRPENK 121 10 <1 <1 <1 100
NM-MRPENK <1 98 <1 <1 <1 100
NR-MRPENK <1 <1 <105 <1 <1 100
NC-MRPENK <1 <1 <1 115 <1 100
CT-MRPENK <1 <1 <1 <1 95 100

Связывание всех антител с пептидом MRPENK было сопоставимо со связыванием пептидов, которые применяли для иммунизации. За исключением антитела NT-MRPENK (10%-ная перекрестная реактивность с EEDDSLANSSDLLK), ни одно из антител не обладало перекрестной реактивностью с MR-PENK-пептидами, которые не применяли для иммунизации индивидуальным антителом.

Иммуноанализ проэнкефалина:

С помощью пипетки вносили по 50 мкл образца (или калибратора) в сенсибилизированные пробирки, после добавления меченого антитела (200 мкл) пробирки инкубировали в течение 2 ч при 18-25єC. Несвязанную метку удаляли путем 5-кратной промывки (используя каждый раз по 1 мл) промывочным раствором (20 ммолей/л ЗФР, pH 7,4, 0,1% Тритон X-100). Связанное с пробиркой меченое антитело оценивали с использованием люминометра 953. Применяли MRPENK в фиксированной концентрации 1000 пмолей/л. Величины отношения сигнала (RLU при 1000 пмолей MRPENK/1) к шуму (RLU без MRPENK) для различных комбинаций антител представлены в таблице 4. Все антитела были способны образовывать сэндвич-комплекс с любым другим антителом. Неожиданно было установлено, что наиболее высокое отношение сигнала к шуму (наиболее высокая чувствительность) достигалось при объединении антитела MR-MRPENK и антитела CT-MRPENK. Поэтому при создании изобретения в дальнейших исследованиях применяли указанную комбинацию антител для осуществления MRPENK-иммуноанализа. Антител MR-MRPENK применяли в качестве сенсибилизирующего пробирку антитела, а антитело CT-MRPENK применяли в качестве меченого антитела.

Таблица 4:

Антитело на твердой фазе NT-MRPENK NM-MRPENK NR-MRPENK NC-MRPENK CT-MRPENK
Меченое антитело
NT-MRPENK / 27 212 232 <1
NM-MRPENK 36 / 451 487 <1
NR-MRPENK 175 306 / 536 1050
NC-MRPENK 329 577 542 / <1
CT-MRPENK <1 615 1117 516 /

Калибровка:

При проведении анализа калибровку осуществляли с использованием разведений синтетического MRPENK, разведенного в растворе, содержащем 20мМ K24, 6мМ ЭДТК, 0,5% БСА, 50мкМ амастин, 100мкМ леупептин, pH 8,0. Содержащую проэнкефалин контрольную плазму получали от фирмы ICI-diagnostics, Берлин, Германия.

На фиг. 1 представлена типичная кривая зависимости сигнала от дозы проэнкефалина. Стандартная кривая для проэнкефалина.

Чувствительность анализа составляла 5,5 пмолей/л для 20 определений 0-калибратора (без добавления MRPENK) + 2SD).

Исследование популяции

Методы

При создании изобретения измеряли уровни (исходные уровни) проэнкефалина в образцах плазмы, взятых натощак у 2559 женщин из популяции, на которой в университете г. Мальмё проводили исследования по изучению диеты и рака (MDCS) в 1991-1994 г.г. (возраст 58 ± 6 лет, 59% женщин). Применяли многовариантный (включавший все традиционные сердечно-сосудистые факторы риска, факторы риска диабета, а при анализах рака также наследственные факторы рака) анализ с использованием моделей пропорциональных рисков Кокса для установления взаимосвязи между исходным уровнем PENK (увеличение коэффициента риска на каждое стандартное отклонение log-трансформированного уровня PENK) и временем возникновения первого события для каждой из изучаемых конечных точек в течение последующего периода наблюдения, медиана которого составляла более 12 лет. Сведения о конечных точках получали от Шведского национального регистра выписки из госпиталей, Шведского регистра инфарктов миокарда, Регистра сердечных приступов университета Мальмё и Шведского регистра рака. Было дано разрешение на получение сведений о конечных точках от указанных регистров и оно было признано корректным (см. также Belting и др., Cancer Epidemiol Biomarkers Prev; 1–10. 2012 AACR).

Клинические характеристики женщин, принимавших участие в исследовании

Таблица 5:

Описательная статистика
N Среднее значение Ст. отклонение
Возраст в момент отбора для участия в MDCS 2559 57,554 5,9403
Систолическое кровяное давление (мм. рт. столба) 2559 140,50 19,311
Диастолическое кровяное давление (мм. рт. столба) 2559 85,65 9,117
Индекс массы тела (ИМТ, вес/кг Ч кг) 2559 25,5196 4,19083
WAIST (индекс талии-бедер, см) 2559 76,99 10,245
Глюкоза (моли/л) 2559 5,0418 1,21798
Триглицериды (моли/л) 2559 1,2245 0,58404
Липопротеины высокой плотности (моли/л) 2559 1,5123 0,36949
Липопротеины низкой плотности (моли/л) 2559 4,2016 1,04762
П-инсулин 2512 7,223 5,4223

На фиг. 2 представлено распределение частоты встречаемости уровней проэнкефалина в популяции женщин:

Среднее значение составляло 47,2 пмолей/л, стандартное отклонение составляло 1,2 пмоля/л. По оси x отложен натуральный логарифм (LN) концентрации PENK. Все результаты находились в пределах точности измерений, наименьшая концентрация PENK составляла 9 пмолей/л. Эти результаты свидетельствуют о пригодности применявшегося анализа (чувствительность анализа составляла 5,5 пмолей/л).

PENK и прогноз рака молочной железы

При создании изобретения оценивали взаимосвязь между проэнкефалином и раком молочной железы (таблица 6). Была выявлена выраженная взаимосвязь между проэнкефалином и раком молочной железы у женщин. В полностью скорректированной модели каждое увеличение на величину SD уровня проэнкефалина было ассоциировано со снижением риска на 28,6% или каждое уменьшение на величину SD уровня проэнкефалина (revPENK) было ассоциировано у повышением на 40% риска возникновения в будущем рака молочной железы (таблица 5), и при сравнении верхнего и нижнего квартилей уровней проэнкефалина было выявлено более чем 3-кратное различие в риске возникновения рака молочной железы (см. таблицу 7 и фиг. 3).

Таблица 6

Переменные, входящие в уравнениеD

Коэфф. регрессии
(B)
Стандартная ошибка (SE) Критерий Вальда Число степеней свободы
(df)
Значимость (Sig.) exp(B) 95,0% CI для exp(B)
Нижняя граница Верхняя граница
Возраст 0,007 0,016 0,228 1 0,633 1,007 0,977 1,039
Пол 0a
ИМТ_B 0,026 0,025 1,139 1 0,286 1,027 0,978 1,077
Сахарный диабет_B -0,242 0,407 0,352 1 0,553 0,785 0,354 1,744
ЛПВП_B 0,044 0,252 0,031 1 0,860 1,045 0,638 1,714
ЛПНП_B -0,001 0,090 0,000 1 0,988 0,999 0,837 1,191
Курение в рассматриваемый период времени 0,330 0,195 2,886 1 0,089 1,392 0,950 2,037
HER_CANCER_0 0,034 0,176 0,038 1 0,846 1,035 0,733 1,461
LNINS -0,288 0,197 2,127 1 0,145 0,750 0,509 1,104
Z-балл LN PENK у женщин, не имеющих рака -0,337 0,082 16,858 1 0,000 0,714 0,608 0,839

Таблица 7:

Результаты многовариантного анализа на основе моделей пропорционального риска Кокса взаимосвязи между исходным уровнем проэнкефалина и возникновением рака молочной железы

Рак молочной железы
HR на 1 SD P-значение Квартиль 4 Квартиль 3 Квартиль 2 Квартиль 1 P-значение
для тенденции
Женщины (2140/135) 1,40
(13-1,6)
<0,001 1,0 (ref) 1,50
(0,81-2,1)
2,7(1,7-3,4) 3,6
(2,7-4,9)
<0,001

На фиг. 3 представлены графики Каплана-Мейера, иллюстрирующие кумулятивный диагноз рака молочной железы у женщин, входящих в следующие группы: квартиль (Q) 1 (уровень ниже 40,4 пмолей/л), квартиль 2 (40,4-47,1 пмоля/л), квартиль 3 (47,2-54,1 пмоля/л), квартиль 4 (выше 54,1 пмоля/л). Пониженный уровень PENK свидетельствует о повышенном риске развития рака молочной железы в долговременной перспективе. Поскольку все женщины с историей рака на момент начала исследования (момент сбора образцов) были исключены, то уровень проэнкефалина являлся очень эффективным прогностическим критерием развития в будущем рака молочной железы. Кроме того, следует отметить, что для женщин из группы Q 1 риск развития рака молочной железы был в 3,6 раза больше, чем для женщин из группы Q 4.

Комбинация проэнкефалина и пронейротензина

Поскольку в современных исследованиях было продемонстрировано, что пронейротензин является очень эффективным прогностическим маркером рака молочной железы, то при создании изобретения применяли комбинацию обоих биомаркеров для прогнозирования рака молочной железы.

Примеры

Анализ пронейротензина

Антитела создавали согласно описанному выше методу. Создавали предназначенное для мечения антитело (LA) к P-NT 1-19 (H-CSDSEEEMKALEADFLTNMH (SEQ ID NO: 24)) и предназначенное для твердой фазы (SPA) антитело к пептиду P-NT 44-62 (CNLNSPAEETGEVHEEELVA (SEQ ID NO: 25)).

Иммуноанализ для количественной оценки человеческого пронейротензина

Применяемая технология представляла собой люминисцентный сэндвич-иммуноанализ в сенсибилизированной пробирке с использованием мечения сложным эфиром акридиния.

Меченое соединение (метка): 100 мкг (100 мкл) LA (1 мг/мл в ЗФР, pH 7,4), смешивали с 10 мкл сложного NHS-эфира акридиния (1 мг/мл в ацетонитриле, фирма InVent GmbH, Германия) (EP 0353971) и инкубировали в течение 20 мин при комнатной температуре. Меченое LA очищали с помощью ЖХВР-гель-фильтрации на Bio-Sil SEC 400-5 (фирма Bio-Rad Laboratories, Inc., США). Очищенное LA разводили в 300 ммолей/л фосфата калия, 100 ммолей/л NaCl, 10 ммолей/л Na-ЭДТК, 5 г/л бычьего сывороточного альбумина, pH 7,0. Конечная концентрация меченого соединения составляла примерно 800000 относительных световых единиц (RLU) (примерно 20 нг меченого антитела) на 200 мкл. Хемилюминисценцию сложного эфира акридиния измеряли с помощью устройства AutoLumat LB 953 (фирма Berthold Technologies GmbH & Co. KG).

Твердая фаза: Полистироловые пробирки (фирма Greiner Bio-One International AG, Австрия) сенсибилизировали (в течение 18 ч при комнатной температуре) SPA (1,5 мкг SPA на 0,3 мл буфера, содержащего 100 ммолей/л NaCl, 50 ммолей/л Трис/HCl, pH 7,8). После блокирования с помощью 5% бычьего сывороточного альбумина, пробирки промывали ЗФР, pH 7,4 и сушили в вакууме.

Калибровка:

При проведении анализа калибровку осуществляли с использованием разведений человеческой сыворотки, содержащей пронейротензин. Пул человеческой сыворотки с высокой иммунореактивностью пронейротензина (фирма InVent Diagostika, Хеннингсдорф, Германия) разводили лошадиной сывороткой (фирма Biochrom AG, Германия) (стандарты для анализа).

Стандарты калибровали с использованием в качестве калибратора человеческого пронейротензина (фирма ICI-Diagnostics, Берлин, Германия). Альтернативно этому анализ можно калибровать с использованием синтетического или рекомбинантного P-NT 1-117 или его фрагментов (см. также Ernst и др., 2006).

Иммуноанализ ProNT:

С помощью пипетки вносили по 50 мкл образца (или калибратора) в сенсибилизированные SPA пробирки, после добавления меченого LA (200 мкл) пробирки инкубировали в течение 16-22 ч при 18-25єC. Несвязанную метку удаляли путем 5-кратной промывки (используя каждый раз по 1 мл) промывочным раствором (20 ммолей/л ЗФР, pH 7,4, 0,1% Тритон X-100). Связанное с пробиркой LA оценивали с использованием люминометра 953. Результаты рассчитывали с использованием калибровочной кривой.

Анализ женской популяции с использованием комбинации проэнкефалина и PNT:

Не было выявлено значимой корреляции между проэнкефалином и пронейротензином (p= 0,56). С помощью комбинированной модели с использованием обоих биомаркеров было установлено, что они оба являются независимыми друг от друга в отношении прогнозирования рака молочной железы.

В полностью скорректированной модели каждое увеличение на величину SD уровня PNT было ассоциировано с увеличением на 49,9% риска возникновения в будущем рака молочной железы. При создании изобретения неожиданно было установлено, что после добавления PNT в уравнение PENK становился даже более сильным критерием, чем без PNT, и каждое увеличение на величину SD уровня проэнкефалина было ассоциировано со снижением риска на 30,8% или каждое уменьшение на величину SD уровня проэнкефалина (revPENK) было ассоциировано с повышением на 44,5% риска возникновения в будущем рака молочной железы (таблица 8).

Таблица 8: Анализ прогноза возникновения рака молочной железы с использованием комбинации PNT и PENK

Коэфф. регрессии B Стандартная ошибка
(SE)
Критерий Вальда Число степеней свободы (df) Значимость (Sig.) exp(B) 95,0% CI для exp(B)
Верхняя граница Нижняя граница
Возраст -0,003 0,019 0,020 1 0,888 0,997 0,960 1,036
Курение в рассматриваемый период времени 0,434 0,204 4,505 1 0,034 1,543 1,034 2,304
ИМТ_B 0,001 0,027 0,001 1 0,979 1,001 0,948 1,056
Скорость клубочковой фильтрации по формуле Кокрофта-Голда с коррекцией на площадь поверхности тела (GFR-CG-BSA-корр.) -0,005 0,008 0,357 1 0,550 0,995 0,979 1,011
Заместительная гормональная терапия (HRT) в рассматриваемый период времени 0,730 -,201 13,146 1 0,000 2,075 1,399 3,079
P-NT 0,405 0,091 19,731 1 0,000 1,499 1,254 1,793
PENK -0,368 0,088 17,416 0,000 0,692 0,582 0,823

Сравнение наибольшего и наименьшего квартилей PNT дает 2,56-кратную разницу в риске развития рака молочной железы, а сравнение уровней проэнкефалина, соответствующих верхним значениям наименьшего и наибольшего квартилей PNT (rev обозначает обратное расположение квартилей, т.е. Q1=Q4, Q2=Q3, Q3=Q2, Q4=Q1)), независимо дает 3,6-кратную разницу в риске (таблица 9).

Сравнение комбинации наибольшего квартиля PNT и наименьшего квартиля проэнкефалина с наименьшим квартилем PNT и наибольшим квартилем проэнкефалина свидетельствует об объединенном риске, составляющем 6,17 (см. фиг. 3).

В таблице 9 представлены результаты анализа с использованием комбинации PNT и PENK для прогнозирования возникновения рака молочной железы.

Таблица 9

Коэфф. регрессии
B
Стандартная ошибка
(SE)
Критерий Вальда Число степеней свободы
(df)
Значимость (Sig.) exp(B) 95,0% CI
Нижняя граница
Возраст -0,022 0,018 1,468 1 0,226 0,978 0,943
Курение в рассматриваемый период времени 0,391 0,200 3,808 1 0,051 1,478 0,998
Заместительная гормональная терапия (HRT) в рассматриваемый период времени 0,652 0,195 11,145 1 0,001 1,920 1,309
ИМТ_B 0,012 0,025 0,247 1 0,619 1,012 0,964
GFR-CG-BSA-корр. -0,012 0,008 2,279 1 0,131 0,988 0,972
NLN-PNT 13,898 3 0,003
NLN-PNT(1) 0,353 0,301 1,378 1 0,241 1,424 0,789
NLN-PNT(2) 0,604 0,286 4,452 1 0,035 1,830 1,044
NLN-PNT(3) 0,942 0,269 12,260 1 0,000 2,566 1,514
Q_PENK_rev 23,361 3 0,000
Q_PENK_rev(1) 0,410 0,331 1,534 1 0,215 1,507 0,787
Q_PENK_rev(2) 0,979 0,305 10,299 1 0,001 2,663 1,464
Q_PENK_rev(3) 1,284 0,300 18,315 1 0,000 3,610 2,005

Женщин с наименьшим уровнем проэнкефалина (1-й квартиль) и наибольшим уровнем пронейротензина (4-й квартиль) объединяли в одну группу (группа 3). В этой группы высокого риска примерно у 19,02% женщин развился рак молочной железы в течение последующих 15 лет.

В группу 2 объединяли женщин с уровнем пронейротензина, соответствующим 3-му квартилю, и уровнем проэнкефалина, соответствующим 2-му квартилю, плюс женщин с уровнем пронейротензина, соответствующим 2-му квартилю, и уровнем проэнкефалина, соответствующим 3-му квартилю. В этой группе среднего риска примерно у 7,48% женщин развился рак молочной железы в течение последующих 15 лет.

В группу 1 объединяли женщин с уровнем пронейротензина, соответствующим 1-му квартилю, и уровнем проэнкефалина, соответствующим 4-му квартилю. В этой группе низкого риска примерно у 3,08% женщин развился рак молочной железы в течение последующих 15 лет. Коэффициент риска при сравнении группы 1 и группы 3 составлял примерно 6,17.

Рак легкого

Проэнкефалин позволяет прогнозировать также возникновение рака легкого у женщин.

У 40 женщин развился рак в течение периода наблюдения. Не было выявлено различия в уровне проэнкефалина у курящих и некурящих женщин (p=0,44). Как и следовало ожидать, курение является эффективным прогностическим маркером риска возникновения рака легкого (p<0,0001). При создании изобретения неожиданно было установлено, что, хотя курение входило в качестве параметра в уравнение, низкий уровень проэнкефалина свидетельствовал о 3,2-кратном повышении риска развития рака легкого (таблица 10a и 10б).

Таблицы 10a и 10б: Применение PENK для прогнозирования возникновения рака легкого у женщин. Женщин распределяли на группы по тертилям (см. таблицу 10a) и затем проводили анализ касательно развития рака легкого (см. таблицу 10б). rev обозначает наибольший тертиль (тертиль 3), rev (1) обозначает тертиль 2 и rev(2) обозначает наименьший тертиль (тертиль 1).

Таблица 10a:

Группы процентилей PENK (пмоли/л) Медиана Минимум Максимум
1 37,80000 9,000 42,800
2 47,20000 42,900 51,300
3 58,30000 51,400 518,100
Всего 47,25000 9,000 518,100

Таблица 10б:

Коэфф. регрессии
B
Стандартная ошибка
(SE)
Критерий
Вальда
Число степеней свободы
(df)
Значимость (Sig.) Exp(B)
Возраст 0,45 0,040 1,251 1 0,263 1,046
Курение в рассматриваемый период времени 1,897 0,427 19,761 1 0,000 6,667
ИМТ_B -0,34 0,063 0,287 1 0,592 0,967
GFR-CG-BSA-корр. -0,24 0,019 1,592 1 0,207 0,976
T_PENK у женщин rev 6,698 2 0,035
T_PENK у женщин rev(1) 0,208 0,580 0,128 1 0,721 1,231
T_PENK у женщин rev(2) 1,168 0,511 5,220 1 0,022 3,214

Описание чертежей

На чертежах показано:

На фиг. 1 – типичная кривая зависимости сигнала от дозы проэнкефалина. Стандартная кривая для проэнкефалина;

На фиг. 2 – распределение частоты встречаемости уровней проэнкефалин в популяции женщин;

На фиг. 3 – графики Каплана-Мейера, иллюстрирующие кумулятивный диагноз рака молочной железы у женщин из групп, входящих в квартиль (Q) 1 (уровень ниже 40,4 пмолей/л), квартиль 2 (40,4-47,1 пмолей/л), квартиль 3 (47,2-54,1 пмоля/л), квартиль 4 (уровень выше 54,1 пмоля/л). Пониженный уровень PENK свидетельствует о наличии в долговременной перспективе повышенного риска развития рака молочной железы. Поскольку все женщины с историей рака на момент начала исследования (момент сбора образцов) были исключены, то уровень проэнкефалина оказался очень эффективным прогностическим критерием развития в будущем рака молочной железы. Кроме того, следует отметить, что для женщин из группы Q 1 риск развития рака молочной железы был в 3,6 раза больше, чем для женщин из группы Q 4.

1. Набор для определения проэнкефалина и фрагментов проэнкефалина в образце, содержащий две связывающие молекулы, которые связываются с двумя различными областями в области проэнкефалина, состоящей из аминокислот 133-140 (LKELLETG, SEQ ID NO: 22) и аминокислот 152-159 (SDNEEEVS, SEQ ID NO: 23), где каждая связывающая молекула является антителом, которое связывается только с одной из указанных областей в области проэнкефалина, и где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот.

2. Набор по п. 1, где указанный набор обеспечивает чувствительность, достаточную для количественного определения проэнкефалина или фрагментов проэнкефалина у здоровых индивидуумов и обеспечивает чувствительность аналитического метода, составляющую <15 пмолей/л.

3. Применение набора по одному из пп. 1 или 2 для прогнозирования риска возникновения рака, выбранного из рака молочной железы или рака легких у женщины, которая не страдает раком, и для стратификации указанных женщин на группы риска.

4. Применение набора по одному из пп. 1 или 2 для прогнозирования риска возникновения рака, выбранного из рака молочной железы или рака легких у женщины, которая не страдает раком, и для стратификации указанных женщин в группу, которую следует подвергать терапии с использованием опиоидного фактора роста (OGF).

5. Набор по п. 1 или 2, в котором уровень проэнкефалина или фрагментов проэнкефалина используют для прогнозирования риска возникновения рака молочной железы или рака легких у женщины, которая не страдает раком.



 

Похожие патенты:

Изобретение относится к пищевой промышленности, в частности к производству чая, и может быть использовано при анализе черного, зеленого и других видов чая. Способ определения антиокислительной активности чая включает взаимодействие разбавленного экстракта чая, полученного в режиме дегустационного заваривания, с реагентом-окислителем - 2,6-дихлорфенолиндофенолятом натрия, определение величины изменения оптической плотности реакционного раствора колориметрическим методом при длине волны 500-520 нм, расчет антиокислительной активности чая в пересчете на кверцетин по предложенной формуле.

Настоящее изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.

Изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.
Изобретение относится к медицине, в частности к лабораторной диагностике, ревматологии, ортопедии и травматологии, и может быть использовано для диагностики молекулярных фенотипов остеоартрита.
Изобретение относится к области медицины, в частности к онкологии. Предложен способ комбинированного лечения немелкоклеточного рака легкого (НМРЛ) IB - III стадии.

Изобретение относится к онкологии и неврологии. Способ ранней молекулярно-биологической иммуноспецифической диагностики злокачественных заболеваний (ЗНО) или бокового амиотрофического склероза (БАС) включает в себя иммунофенотипирование мембранных антигенов гемопоэтической стволовой клетки (ГСК) обследуемого субъекта с последующим картированием и профилированием основных белковых маркеров мембранной поверхности (БММП) ГСК этого субъекта и сравнительный анализ показателей экспрессии белков полученного профиля (исследуемого профиля) с аналогичными параметрами протеомного профиля БММП ГСК (нормального профиля), если в результате сравнительного анализа исследуемого и нормального профилей устанавливают гиперэкспрессию CD81+ маркера и гипоэкспрессию CD 38+, CD33+, CD71+, CD90+, CD56+, CD19+, CD28+, CD300+ и CD2+ маркеров в исследуемом профиле по сравнению с нормальным профилем, то диагностируют онкоспецифический профиль БММП ГСК у обследуемого субъекта; если в результате сравнительного анализа исследуемого и нормального профилей устанавливают гипоэкспрессию HLA DR+, CD38+, CD13+, CD71+, CD117+, CD90+, CD50+, CD19+ маркеров и гиперэкспрессию CD56+, CD61+, CD2+, CD7+ и CD81+ маркеров в исследуемом профиле по сравнению с нормальным профилем, то диагностируют БАС-специфический профиль БММП ГСК у обследуемого субъекта.

Изобретение относится к областям биотехнологии, молекулярной биологии и медицинской микробиологии. Описан набор олигонуклеотидных праймеров для реакции петлевой изотермической амплификации (LAMP), который позволяет амплифицировать специфические для бактерий вида Francisella tularensis фрагменты ДНК из целевого гена, имеющего нуклеотидную последовательность SEQ ID №1.

Изобретение относится к областям биотехнологии, молекулярной биологии и медицинской микробиологии. Описан набор олигонуклеотидных праймеров для реакции петлевой изотермической амплификации (LAMP), который позволяет амплифицировать специфические для бактерий вида Francisella tularensis фрагменты ДНК из целевого гена, имеющего нуклеотидную последовательность SEQ ID NO: 1.

Изобретение относится к области информационно-измерительной техники. Предложено устройство для определения содержания воды в потоке нефтепродукта, включающее отрезок трубы, усилитель и первичный преобразователь.

Изобретение относится к аналитической химии растворов и может быть использовано для определения искусственных ароматизаторов в спиртосодержащих растворах. Способ определения искусственных ароматизаторов в спиртосодержащих растворах включает пробоотбор, определение наличия искусственных ароматизаторов, при котором пробу раствора помещают в герметично закрытый бюкс, выдерживают не менее 15 мин, получают равновесную газовую фазу, которую инжектируют в ячейку детектирования с установленными в ней двумя пьезокварцевыми резонаторами (пьезосенсорами) объемных акустических волн, на электроды одного из которых нанесена тонкая пленка из раствора дициклогексана-18-краун-6 (18К6) в этаноле, а другого - поливинилпирролидона (ПВП) в ацетоне, фиксируют изменение частоты колебания ΔF каждого пьезосенсора в течение не менее 60 с, определяют максимальное значение ΔF(18К6) на пьезосенсоре с пленкой 18К6 и ΔF(ПВП) - с пленкой ПВП, вычисляют параметр эффективности сорбции легколетучих веществ А, как отношение ΔF(18К6)/ ΔF(ПВП), решение о наличии искусственного ароматизатора в спиртосодержащем растворе принимают по результату сравнения параметра А с заданным значением.

Настоящее изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.

Настоящее изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.

Изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.

Изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.

Изобретение относится к патологической анатомии и может быть использовано для полуколичественной визуальной оценки синтеза регуляторного белка PDCD4 в гистологических срезах ткани иммуногистохимическим методом с детекцией в ядре и цитоплазме.

Изобретение относится к медицине, а именно к онкологии, и может быть использовано для скрининга рака молочной железы и предрасположенности к нему. Проводят маммографию и УЗИ.

Изобретение относится к медицине, а именно к онкологии, и может быть использовано для скрининга рака молочной железы и предрасположенности к нему. Проводят маммографию и УЗИ.

Изобретение относится к области медицины. Предложен способ молекулярно-генетической диагностики наследственных форм рака молочной железы.

Изобретение относится к области медицины. Предложен способ молекулярно-генетической диагностики наследственных форм рака молочной железы.

Изобретение относится к медицине, а именно к онкодиагностике, и может быть использовано для обнаружения неопластического перерождения клеток, вызываемого вирусом папилломы человека (ВПЧ) у женщин, проходящих скрининг на рак шейки матки.

Группа изобретений относится к медицине и касается набора для определения проэнкефалина и фрагментов проэнкефалина в образце, содержащего две связывающие молекулы, которые связываются с двумя различными областями в области проэнкефалина, состоящей из аминокислот 133-140 и аминокислот 152-159, где каждая связывающая молекула является антителом, которое связывается только с одной из указанных областей в области проэнкефалина, и где каждая из указанных областей содержит по меньшей мере 4 или 5 аминокислот. Группа изобретений также касается применения указанного набора для прогнозирования риска возникновения рака, выбранного из рака молочной железы или рака легких у женщины, которая не страдает раком, и для стратификации указанных женщин на группы риска. Группа изобретений обеспечивает прогнозирование риска возникновения рака, выбранного из рака молочной железы или рака легких у женщины, которая не страдает раком, и стратификацию указанных женщин на группы риска. 3 н. и 2 з.п. ф-лы, 1 пр., 3 ил., 10 табл.

Наверх