Патент ru2708144

Авторы патента:


Изобретение относится к биотехнологии. Описана изолированная молекула нуклеиновой кислоты, содержащая i) нуклеотидную последовательность, кодирующую полипептид, обладающий активностью синтазы каннабихроменовой кислоты с последовательностью SEQ ID NO: 2 или 6, или полипептид, имеющий по меньшей мере на 96% идентичную SEQ ID NO: 2 или 6 последовательность, или ii) нуклеотидную последовательность, идентичную, по меньшей мере, более чем на 96% последовательности SEQ ID NO: 1, 5 или 8, или 9 и кодирующую полипептид, обладающий активностью синтазы каннабихроменовой кислоты. Представлены экспрессирующая система in vitro и экспрессирующий конструкт, содержащий такую изолированную молекулу нуклеиновой кислоты. Также описан изолированный полипептид, обладающий активностью синтазы каннабихроменовой кислоты, содержащий аминокислотную последовательность, идентичную SEQ ID NO: 2 или 6, целиком или ее фрагменту по меньшей мере на 96%. Полипептиды можно использовать in vivo или in vitro для производства каннабиноидных соединений. 9 н. и 13 з.п. ф-лы, 4 ил., 2 табл., 4 пр.

 

Родственные заявки

По настоящей заявке по Договору о патентной кооперации, согласно 35 USC §119, испрашивается приоритет предварительной патентной заявки США № 62/018,128, поданной 27 июня 2014 года, содержание которой полностью включено в настоящее описание посредством ссылки.

Область техники, к которой относится изобретение

Настоящее изобретение относится к энзиму синтазы каннабихроменовой кислоты (CBCAS) из конопли, нуклеотидной последовательности, кодирующей реагенты на основе энзима CBCAS, и способам производства каннабиноидов и/или изменений при производстве каннабиноидов.

Введение

Cannabis sativa L. (конопля, пенька, марихуана) – это одно из самых старых и наиболее многоцелевых одомашненных растений, которые сегодня используются в качестве источника медицинских, пищевых, косметических и промышленных продуктов. Она также хорошо известна благодаря её использованию в качестве запрещенного наркотика, благодаря наличию в её составе психотропных каннабиноидов (например, Δ9-тетрагидроканнабинол, ТГК). Растительные каннабиноиды и другие наркотики, которые действуют посредством каннбиноидных рецепторов млекопитающих, исследуются в качестве фармацевтических наркотиков, и/или используются при лечении различных состояний, таких как хроническая боль, невропатическая боль при рассеянном склерозе, анорексии, тошноте, слабости и спазмах онкологии/СПИД (Ware et al., 2010; Pertwee, 2005).

Существует более 80 каннабиноидов, известных благодаря конопле (Elsohly и Slade, 2005). Основные кислотные каннабиноиды – это Δ9-тетрагидроканнабиноловая кислота (ТГКК), каннабидиоловая кислота (КБДК) и каннабихроменовая кислота (КБХК). Тепло или длительное хранение приводит к декарбоксилированию кислотных каннабиноидов (например, ТГКК образует ТГК, КБДК образует каннабидиол (КБД), а КБХК образует каннабихромен (КБХ)).

Биосинтетический путь метаболизма каннабиноида становится более понятным на молекулярном и энзимном уровне. Первый энзим – это гексаноил-СоА (Stout et al., 2013). Гексаноил-СоА используется в качестве субстрата при реакции с вовлечением двух энзимов, тетракетид синтазы и циклазы оливетоловой кислоты, которые действуют вместе с синтезом оливетоловой кислоты (Gagne et al., 2012). Оливетоловая кислота геранилируется при помощи энзима ароматической пренилтрансферазы для образования каннабигероловой кислоты (КБГК) (Fellermeier и Zenk, 1998), промежуточная точка ветвления, с конвертацией посредством энзимов оксидоциклазы в ТГКК, КБДК или КБХК. Синтаза ТГКК и синтаза КБДК были клонированы и описаны (Sirikantaramas et al., 2005; Taura et al., 2007). Про синтазу КБХК кодирования гена не сообщалось.

Про последовательность генома Cannabis sativa сообщил van Bakel et al. (2011). Однако, не была идентифицирована последовательность для синтазы КБХК.

Генетические свидетельства предполагают, что хотя синтаза ТГКК и синтазы КБДК могут быть аллельными в одном и том же локусе, синтаза КБХК отвязана от этих других энзимов (de Meijer et al., 2009, de Meijer et al., 2003).

Kojoma et al. (2006) сообщил о полиморфизмах ДНК в гене синтазы ТГКК в Cannabis sativa «наркотического типа» и «волоконного типа».

Каннабиноиды – это ценные натуральные продукты растительного происхождения. Энзимы кодирования генов биосинтеза каннабиноида будут полезны при метаболическом конструировании разновидностей конопли, которые содержат ультранизкие уровни ТГК и других каннабиноидов. Такие гены могут также оказаться полезны для производства фармацевтических препаратов на основе каннабиноидов, производства энзимов для катализации этапов формирования каннабиноидов, или для воссоздания биосинтеза каннабиноида в других организмах, таких как бактерии или дрожжи.

Сущность изобретения

Один аспект настоящего изобретения относится к представлению изолированной и/или очищенной молекулы нуклеиновой кислоты, содержащей: i) нуклеотидную последовательность, имеющую, по меньшей мере, более чем, или примерно, на 96% идентичность последовательности относительно SEQ ID NO: 1 или 5; ii) нуклеотидную последовательность, имеющую, по меньшей мере, более чем, или примерно, на 78% идентичность последовательности относительно SEQ ID NO: 1, 5, или 8 или 9, с кодированием полипептида с активностью синтазы каннабихроменовой кислоты; iii) дополнение i) или ii): или фрагмент более, чем, по меньшей мере, или примерно 15 перекрывающихся нуклеотидов согласно i), ii) или iii).

Также, в соответствии со вторым аспектом, представлены праймеры и зонды, содержащие нуклеотидные последовательности, имеющие по меньшей мере, более чем, или примерно на 96% идентичность последовательности относительно фрагмента SEQ ID NO: 1, 5 или 8 или 9, или их дополнения.

В соответствии с ещё одним аспектом, представлена молекула нуклеиновой кислоты, кодирующая полипептид, с наличием по меньшей мере, более чем, или примерно на 95% идентичность последовательности относительно SEQ ID NO: 2 или 6, в качестве опции с использованием кодона с оптимизацией для экспрессии в организме, отличном от конопли.

В одном варианте осуществления, молекула нуклеиновой кислоты содержит нуклеотидную последовательность, имеющую последовательность SEQ ID NO: 1, 5, 8 или 9.

В ещё одном аспекте представлен изолированный и/или очищенный полипептид, содержащий аминокислотную последовательность, имеющую по меньшей мере, более чем, или примерно на 95% идентичность последовательности относительно SEQ ID NO: 2 или 6.

Также в ещё одном аспекте представлена молекула нуклеиновой кислоты, описанная здесь, связанная с гетерологичной сигнальной последовательностью или меткой. В соответствии с одним вариантом осуществления, молекула нуклеиновой кислоты содержит нуклеотидную последовательность, кодирующую полипептид, с аминокислотной последовательностью, имеющую по меньшей мере, более чем, или примерно на 95% идентичность последовательности относительно SEQ ID NO: 2 или 6, связанную с гетерологичной сигнальной последовательностью или меткой.

Также в ещё одном аспекте представлено антитело или его связующий фрагмент, который связывает конкретно эпитоп аминокислотной последовательности, в том виде, как это описано здесь, в SEQ ID NO: 2 или 6, или его фрагмент.

Ещё один аспект включает в себя молекулу нуклеиновой кислоты, содержащую: i) нуклеотидную последовательность, имеющую по меньшей мере примерно на 96% идентичность последовательности относительно SEQ ID NO: 1 или 5 или её дополнение; или ii) нуклеотидную последовательность, имеющую по меньшей мере, более чем, или примерно на 78% идентичность последовательности относительно SEQ ID NO: 1, 5, 8 или 9, с кодированием полипептида, с активностью синтазы каннабихроменовой кислоты; с функциональным соединением с гетерологичной последовательностью нуклеиновой кислоты, в том виде, как это подходит экспрессии в клетке или организме.

Также представлена векторная конструкция, содержащая: i) нуклеотидную последовательность, имеющую по меньшей мере примерно на 96% идентичность последовательности относительно SEQ ID NO: 1 или 5, или её дополнение; или ii) нуклеотидную последовательность, имеющую по меньшей мере, более чем, или примерно на 78% идентичность последовательности относительно SEQ ID NO: 1, 5, 8 или 9, с кодированием полипептида, имеющего активность синтазы каннабихроменовой кислоты; с функциональным соединением с гетерологичной аминокислотной последовательностью, в том виде, как это подходит для экспрессии в клетке или организме.

Ещё один аспект включает в себя клетку или организм, содержащий нуклеиновую кислоту, содержащую: нуклеотидную последовательность, имеющую по меньшей мере примерно на 96% идентичность последовательности относительно SEQ ID NO: 1 или 5, или нуклеотидную последовательность, имеющую по меньшей мере, более чем, или примерно на 78% идентичность последовательности относительно SEQ ID NO: 1, 5, 8 или 9, с кодированием полипептида с активностью синтазы каннабихроменовой кислоты, и/или экспрессией рекомбинантного полипептида, содержащего аминокислотную последовательность, имеющую по меньшей мере примерно на 95% идентичность последовательности относительно SEQ ID NO: 2 или 6.

Дополнительный аспект включает в себя композицию, содержащую изолированную нуклеиновую кислоту, изолированный полипептид, векторную конструкцию, клетку или антитела, или фрагмент сего, в том виде, как это описано здесь.

В дополнительном аспекте представлен способ изменения уровней каннабиноидных соединений в организме, клетке или ткани, указанный способ содержит экспрессию или сверхэкспрессию молекулы нуклеиновой кислоты или полипептида, в соответствии с настоящим изобретением, в организме, клетке или ткани.

В ещё одном аспекте, представлен способ изменения уровней каннабиноидных соединений в организме, клетке или ткани, указанный способ содержит введение молекулы нуклеиновой кислоты или векторной конструкции, в соответствии с настоящим изобретением, или фрагмента сего, для выключения и/или уменьшения экспрессии CBCAS в организме, клетке или ткани.

Синтаза каннабихроменовой кислоты и нуклеотидная последовательность, кодирующая этот энзим, теперь идентифицированы и охарактеризованы. Нуклеотидная последовательность может использоваться для создания, посредством селекции или генной инженерии, растений конопли, которые перепроизводят или недопроизводят каннабиноидные соединения или их смеси. Праймеры и зонды, содержащие фрагмент нуклеотидной последовательности (например, по меньшей мере 15 нуклеотидов длиной) SEQ ID NO: 1 и 5 можно использовать для идентификации мутантов или вариантов в синтазе каннабихроменовой кислоты. Эта нуклеотидная последовательность синтазы каннабихроменовой кислоты может также экспрессировать, сама по себе или в сочетании с молекулами нуклеиновой кислоты, с кодированием других энзимов в при метаболизме каннабиноида, для конструирования биосинтеза каннабиноида в других растениях или в микроорганизмах (например, дрожжи, бактерии, грибы) или иных прокариотических или эукариотических организмов. В дополнение, отключение экспрессии этого гена в конопле можно использовать для блокировки биосинтеза каннабиноида, тем самым понизив выработку каннабиноидов.

Дополнительные признаки будут описаны или станут очевидными в процессе дальнейшего подробного описания.

Краткое описание чертежей

Для лучшего понимания изобретения, варианты его осуществления будут описаны подробно на примерах, со ссылкой на сопроводительные чертежи, на которых:

Фигура 1 показывает предложенный путь метаболизма, ведущий к основным типам каннабиноида у Cannabis sativa. Аббревиатуры: синтаза ТГКК – это синтаза Δ9-тетрагидроканнабиноловой кислоты, синтаза КБДК – это синтаза каннабидиоловой кислоты, а синтаза КБХК – это синтаза каннабихроменовой кислоты.

Фигура 2 показывает HPLC-хроматограммы подлинных каннабиноидных стандартов и продукты реакции CBCAS. А. Стандарт КБГК (время выдержки 6.8 мин). В. Стандарт КБХК (время выдержки 9.9 мин). Вкладка – это ультрафиолетовый спектр стандарта КБХК. С. Продукт реакции CBCAS, с показом того, что рекомбинантный энзим производит КБХК (время выдержки 9.9 мин). Вкладка – это ультрафиолетовый спектр стандарта КБХК, при создании посредством такой реакции. D. Реакция с прокипяченным энзимом. При такой реакции не производится КБХК.

Фигура 3 показывает SDS-PAGE гель, или очищенную рекомбинантную CBCAS, с экспрессией в Pichia pastoris. Панель А – это протеиновая лесенка. Панель В показывает очищенную CBCAS. Панель С показывает очищенную CBCAS, дегликозилированную посредством Endo Hf. Верхняя полоса показывает Endo Hf (70 кДа), нижняя полоса показывает дегликозилированную CBCAS (63 кДа). Панель D показывает только Endo Hf.

Фигура 4 показывает оптимальные условия для активности CBCAS. Панель А показывает буферный эффект и буферный pH при производстве КБХК. Значения выражены, как полученная фракция КБХК (КБХК А265 nm / (КБГК А265 nm + КБХК А265 nm) * 100). Панель В показывает эффект от температуры инкубации на производство КБХК. Панель С показывает эффект от добавки на производство КБХК.

Подробное описание

Здесь описывается полинуклеотид из Cannabis sativa, который кодирует синтазу каннабихроменовой кислоты (CBCAS), и кодированный полипептид. Описаны способы использования указанной CBCAS, в том числе посредством разведения растений, мутагенеза или генной инженерии, а также способы создания рекомбинантных клеток, и рекомбинантных организмов, таких как рекомбинантные растения, такие как растения конопли с улучшенным содержанием КБХК, равно как и бесклеточные системы. В дополнение, описаны способы инактивирования или заглушения CBCAS, например, в клетке и/или растении конопли, в качестве опции для блокировки и/или уменьшения биосинтеза КБХК и содержания КБХК клетки или растения конопли. Некоторые варианты осуществления описывают использование указанной КБХК в сочетании с нуклеиновыми кислотами с кодированием других энзимов на пути метаболизма каннабиноида.

Как это описано здесь, последовательность генома конопли (van Bakel et al., 2011) анализировалась на гены с высокой степенью подобия синтазе ТГКК с использованием анализа BLAST, что приводило к идентификации гена с 96% подобия нуклеотида относительно синтазы ТГКК. Основываясь на последующей биохимической характеристике, идентифицированный ген был назван синтаза каннабихроменовой кислоты Cannabis sativa (CBCAS).

Последовательность CBCAS c ДНК представлена в SEQ ID NO: 1. SEQ ID NO: 1 включает в себя расчетную сигнальную последовательность, которая кодируется нуклеотидами 1 – 84.

Соответствующая аминокислотная последовательность открытой рамки считывания CBCAS представлена в SEQ ID NO: 2. SEQ ID NO: 2 включает в себя расчетную сигнальную последовательность, которая имеется у аминокислот 1-28 в SEQ ID NO: 6 не включает в себя расчетную сигнальную последовательность.

Вариант осуществления представляет изолированную нуклеиновую кислоту, которая кодирует полипептид, с кодированием посредством SEQ ID NO: 2 или 6, или фрагмент.

В соответствии с одним вариантом осуществления, изолированная или очищенная нуклеиновая кислота удаляется из всех или части нуклеотидов, которые кодируют сигнальную последовательность, например, нуклеотиды 4-84 в SEQ ID NO: 1, как это показано для SEQ ID NO: 5.

Кодон 5' ATG (и/или дополнительные кодоны, в качестве опции 1-50 дополнительных кодонов, в качестве опции 27 дополнительных кодонов можно заменить на другую последовательность нуклеиновой кислоты, например, для введения последовательности с кодированием 5' гетерологичная доля, например, метка или сигнальная последовательность, например, сигнальная последовательность фактора альфа-соответствия.

В соответствии с одним вариантом осуществления, изолированный или очищенный полипептид удаляется из всей или части сигнальной последовательности, например, аминокислоты 1-28, или всей или части 2-28 в SEQ ID NO: 2, как это показано в SEQ ID NO: 6.

Метионин 5' и/или дополнительные аминокислоты на конце 5' (например, до 50 дополнительных аминокислот) можно заменить на другую аминокислотную последовательность, такую, как 5' гетерологичная доля, такую как метку или сигнальную последовательность, например, сигнальная последовательность фактора альфа-соответствия.

Другие сигнальные последовательности могут включать в себя, например, сигнальную последовательность α-амилазы из Aspergillus niger, сигнальную последовательность глюкоамилазы из Aspergillus awamori, сигнальную последовательность серумальбумина от Homo sapiens, сигнальную последовательность инулиназы от Kluyveromcyes maxianus, сигнальную последовательность инвертазы от Saccharomyces cerevisiae, сигнальную последовательность белка-убийцы от Saccharomyces cerevisiae, или сигнальную последовательность лизоцима от Gallus gallus.

Сигнальная последовательность CBCAS также может изменяться при добавлении остатков аргинина или замене аминокислот остатками аргинина.

SEQ ID NO: 8 или 9 обеспечивают последовательности нуклеиновой кислоты с оптимизацией по кодону, с оптимизацией для E.coli и дрожжей, соответственно. Таким образом, в соответствии с одним вариантом осуществления, такая последовательность – это последовательность с оптимизацией по кодону. Последовательности с оптимизацией по кодону делят примерно 78% и 79% идентичности последовательности с SEQ ID NO: 1, с кодированием SEQ ID NO: 2. В соответствии с одним вариантом осуществления, такие оптимизированные последовательности удаляются из всех или части нуклеотидов соответствующей расчётной сигнальной последовательности. В соответствии с одним вариантом осуществления, сигнальная последовательность меняется на другую сигнальную последовательность или удаляется с кодоном запуска метионина.

Некоторые варианты осуществления относятся к изолированной или очищенной молекуле нуклеиновой кислоты, имеющей по меньшей мере или примерно на 78%, по меньшей мере или примерно на 80%, по меньшей мере или примерно на 81%, по меньшей мере или примерно на 82%, по меньшей мере или примерно на 83%, по меньшей мере или примерно на 84%, по меньшей мере или примерно на 85%, по меньшей мере или примерно на 86%, по меньшей мере или примерно на 87%, по меньшей мере или примерно на 88%, по меньшей мере или примерно на 89%, по меньшей мере или примерно на 90%, по меньшей мере или примерно на 91%, по меньшей мере или примерно на 92%, по меньшей мере или примерно на 93%, по меньшей мере или примерно на 94%, по меньшей мере или примерно на 95%, по меньшей мере или примерно на 96%, по меньшей мере или примерно на 97%, по меньшей мере или примерно на 98%, по меньшей мере или примерно на 99% идентичность последовательности относительно SEQ ID NO: 1, 5, 8 и/или 9. В конкретных вариантах осуществления, изолированная или очищенная молекула нуклеиновой кислоты – это последовательность дегенерации кодона SEQ ID NO: 1, 5, 8 или 9. В одном варианте осуществления, молекула нуклеиновой кислоты имеет активность синтазы каннабихроменовой кислоты.

Фрагменты вышеупомянутых последовательностей, включающие в себя фрагменты SEQ ID NO: 1, 5, 8 и 9, и последовательности с по меньшей мере или примерно на 78% или более идентичности последовательности, подразумеваются также. В некоторых вариантах осуществления, молекула нуклеиновой кислоты содержит по меньшей мере и/или до или примерно 15, по меньшей мере и/или до или примерно 20, по меньшей мере и/или до или примерно 25, по меньшей мере и/или до или примерно 30, по меньшей мере и/или до или примерно 40, по меньшей мере и/или до или примерно 50, по меньшей мере и/или до или примерно 60, по меньшей мере и/или до или примерно 70, по меньшей мере и/или до или примерно 80, по меньшей мере и/или до или примерно 90, по меньшей мере и/или до или примерно 100, по меньшей мере или до или примерно 200, по меньшей мере или до или примерно 300, по меньшей мере или до или примерно 400, по меньшей мере или до или примерно 500, по меньшей мере или до или примерно 600, по меньшей мере или до или примерно 700, по меньшей мере или до или примерно 800, по меньшей мере или до или примерно 900, по меньшей мере или до или примерно 1000, по меньшей мере или до или примерно 1100, по меньшей мере или до или примерно 1200, по меньшей мере или до или примерно 1300, по меньшей мере или до или примерно 1400, по меньшей мере или до или примерно 1500 перекрывающихся нуклеотидов из SEQ ID NO: 1, 5, 8 или 9, или последовательность с по меньшей мере или примерно 78% или более, например, примерно на 96% идентичность последовательностей сего. Например, молекула нуклеиновой кислоты может быть от 15 перекрывающихся нуклеотидов до 1500 перекрывающихся нуклеотидов, или иметь любой диапазон или количество нуклеотидов между этими значениями.

Дополнительно имеются молекулы нуклеиновой кислоты, которые гибридизируют до вышеописанных последовательностей. Условия гибридизации могут строго оговаривать, что гибридизация возникнет, если имеет место по меньшей мере примерно на 96% или примерно на 97% идентичность последовательностей с молекулой нуклеиновой кислоты в SEQ ID NO: 1 или 5. Такие жёсткие условия могут включать в себя те, что используются для известных Южных гибридизаций, таких как, например, инкубация в течение ночи при 42°С в растворе, имеющем 50% формамида, 5х SSC (150 мМ NaCl, 15 мМ тринатриевого цитрата), 50 мМ фосфата натрия (pH 7.6), 5х раствор Денхардта, 10% сульфата декстрана и 20 мг/мл денатурированного среза ДНК спермы лосося, при промывке подложки гибридизации в 0.1х SSC при 65°С. Другие известные условия гибридизации хорошо известны специалистам в данной области техники и описаны в Sambrook et al., Molecular Cloning: A Laboratory Manual, Third Edition, Cold Spring Harbor, N.Y. (2001).

Как будет понятно специалисту в данной области техники, изменения в последовательности нуклеиновой кислоты не обязательно меняют аминокислотную последовательность закодированного полипептида. Специалисты в данной области техники поймут, что изменения в идентичностях нуклеотидов в конкретной последовательности нуклеиновой кислоты, которые меняют аминокислотную последовательность закодированного полипептида, могут привести к пониженной или повышенной эффективности генов, и что, в некоторых применениях (например, анти-смысловых, косупрессии или RNAi) можно использовать частичные последовательности. Способы, которыми можно варьировать или укорачивать нуклеотидную последовательность, известны специалистам в данной области техники, равно как и способы проверки эффективности измененных последовательностей. В соответствии с некоторыми вариантами осуществления, эффективность можно легко проверить, например, посредством традиционной газовой хроматографии. Все такие вариации последовательностей нуклеиновой кислоты, таким образом, считаются частью настоящего изобретения.

Как будет понятно специалисту в данной области техники, длина молекулы нуклеиновой кислоты, описанной ранее, будет зависеть от предполагаемого использования. Например, если предполагается использование в качестве праймера или зонда, например, для ПЦР-амплификации или для отбора библиотеки, длина молекулы нуклеиновой кислоты будет меньше полной длины последовательности, например, фрагмент, например, примерно 15 до примерно 50 нуклеотидов, в качестве опции по меньшей мере примерно 15 нуклеотидов SEQ ID NO: 1, 5, 8 или 9 и/или его дополнение, в качестве опции по меньшей мере примерно 17 нуклеотидов SEQ ID NO: 1, 5, 8 или 9 или его дополнение, в качестве опции по меньшей мере примерно 19 нуклеотидов SEQ ID NO: 1, 5, 8 или 9 или его дополнение, в качестве опции по меньшей мере примерно 21 нуклеотид SEQ ID NO: 1, 5, 8 или 9 или его дополнение, в качестве опции по меньшей мере примерно 23 нуклеотидов SEQ ID NO: 1, 5, 8 или 9 или его дополнение, в качестве опции по меньшей мере примерно 25 нуклеотидов SEQ ID NO: 1, 5, 8 или 9 и/или его дополнение. В этих вариантах осуществления, праймеры или зонды могут быть практически идентичны высококонсервативной области последовательности нуклеиновой кислоты, или могут быть практически идентичны либо 5' или 3' концу последовательности ДНК. В некоторых случаях, такие праймеры или зонды могут использовать универсальные основы в некоторых позициях таким образом, чтобы быть «практически идентичными», но при этом обеспечивать гибкость при распознавании последовательности. Следует отметить, что подходящие условия гибридизации праймера и зонда хорошо известны специалистам в данной области техники.

В одном варианте осуществления, молекула нуклеиновой кислоты может использоваться, как праймер, и, например, содержит последовательность SEQ ID NO: 3 или 4.

В одном варианте осуществления, нуклеиновая кислота является сопряженной с гетерологичной долей, и/или содержит гетерологичную долю, такую как уникальный хвост, метку очистки или детектируемую метку.

Уникальный хвост может быть конкретной последовательностью нуклеиновой кислоты.

Нуклеиновая кислота может, например, иметь концевые метки (5' или 3'), или же метка может быть инкорпорирована произвольно во время синтеза.

Также в ещё одном варианте осуществления представлена изолированная полинуклеотидная молекула, содержащая i) молекулу нуклеиновой кислоты, содержащую по меньшей мере 15 нуклеотидов SEQ ID NO: 1, 5, 8 или 9 (то есть фрагмент SEQ ID NO: 1, 5, 8 или 5=9), или нуклеиновая кислота, содержащая 15 нуклеотидов, и имеющая по меньшей мере 96%, по меньшей мере 97%, по меньшей мере 98%, или по меньшей мере 99% идентичность относительно SEQ ID NO: 1, 5, 8 или 9; и ii) гетерологичную долю. В одном варианте осуществления, молекула нуклеиновой кислоты кодирует полипептид с энзимной активностью.

В одном варианте осуществления, гетерологичная доля – это гетерологичная нуклеиновая кислота, которая кодирует гетерологичный полипептид, и молекула полинуклеотида кодирует слитый полипептид.

Некоторые варианты осуществления относятся к изолированному или очищенному полипептиду, имеющему по меньшей мере примерно 96%, по меньшей мере примерно 97%, по меньшей мере примерно 98%, или по меньшей мере примерно 99% идентичность аминокислотной последовательности, как это установлено в SEQ ID NO: 2 или 6.

Фрагменты SEQ ID NO: 2 или 6 подразумеваются также. В некоторых вариантах осуществления, полипептид содержит по меньшей мере и/или до примерно 5, по меньшей мере и/или до или примерно 10, по меньшей мере и/или до или примерно 15, по меньшей мере и/или до или примерно 20, по меньшей мере и/или до или примерно 25, по меньшей мере и/или до или примерно 30, по меньшей мере и/или до или примерно 40, по меньшей мере и/или до или примерно 50, по меньшей мере и/или до или примерно 60, по меньшей мере и/или до или примерно 70, по меньшей мере и/или до или примерно 80, по меньшей мере и/или до или примерно 90, по меньшей мере и/или до или примерно 100, по меньшей мере и/или до или примерно 150, по меньшей мере и/или до или примерно 200, по меньшей мере и/или до или примерно 250, по меньшей мере и/или до или примерно 300, по меньшей мере и/или до или примерно 350, по меньшей мере и/или до или примерно 400, по меньшей мере и/или до или примерно 450, по меньшей мере и/или до или примерно 500 перекрывающихся аминокислот из SEQ ID NO: 2 или 6.

В соответствии с одним вариантом осуществления, фрагмент имеет по меньшей мере примерно 96%, по меньшей мере примерно 97%, по меньшей мере примерно 98%, по меньшей мере примерно 99% идентичность аминокислотной последовательности, как это определено в SEQ ID NO: 2 или 6.

В соответствии с одним вариантом осуществления, изолированный полипептид дифференциально гликозилирован, не гликозилирован (то есть лишен N и/или О-связанного гликозилирования) и/или дегликозилирован в сравнении с CBCAS, произведенной коноплей. Например, изолированный полипептид может быть дегликозилирован с использованием химических или энзимных способов, например, посредством обработки при помощи Endo Hf или смеси энзима дегликозилирования. Изолированный полипептид, например, дифференциально гликозилирован благодаря экспрессии в дрожжах или иной системе экспрессии.

Другие варианты осуществления относятся к изолированному или очищенному композиционному полипептиду, содержащему: i) полипептид, содержащий по меньшей мере 5 аминокислотных остатков из SEQ ID NO: 2 или 6, и в качестве опции имеющий по меньшей мере, более чем, или примерно на 96%, по меньшей мере, более чем, или примерно на 97%, по меньшей мере, более чем, или примерно на 98%, по меньшей мере, более чем, или примерно на 99% идентичность относительно аминокислотной последовательности, как установлено в SEQ ID NO: 2 или 6; и ii) гетерологичную долю.

В одном варианте осуществления, гетерологичная доля – это гетерологичный полипептид, и композиционный полипептид – это слитый полипептид. Например, гетерологичный полипептид может быть сигнальной последовательностью, такой как сигнальная последовательность фактора альфа-соответствия.

В соответствии с одним вариантом осуществления, слитый полипептид в качестве опции содержит пептидный линкер, с присоединением к пептиду, с содержанием частично или полностью SEQ ID NO: 2 или 6, и гетерологичный полипептид.

В соответствии с одним вариантом осуществления, гетерологичная доля – это детектируемая метка или маркер.

Детектируемая метка предпочтительно способна вырабатывать, явно или неявно, детектируемый сигнал. Например, метка может быть непроницаемой для излучения, или быть радиоактивным изотопом, таким как 3Н, 14С, 32Р (в том числе, например, радиоактивные фосфаты), 35S, 123I, 125I, 131I; биотин, флуоресцентным (флуорофорным) или хемилюминесцентным (хромофорным) соединением, таким как флуоресцинизотиоцианат, родамин или люциферин; энзим, такой как щелочная фосфатаза, бета-галактозидаза или пероксидаза хрена; визуализирующий агент; или ион металла.

В ещё одном варианте осуществления, детектируемый сигнал детектируется неявно, например, с использованием вторичного антитела.

В соответствии с одним вариантом осуществления, маркер выбирается из His-маркера, HA-маркера, FLAG-маркера, Avi-маркера, маркера кальмодулина, маркера полиглутамина, Myc-маркера, S-маркера, SBP-маркера, стреп-маркера, V5-маркера, GFP-маркера, GST-маркера и тиоредоксин-маркера.

Ещё один аспект включает в себя антитело, которое специфически связывает CBCAS, например, как это показано в SEQ ID NO: 2 или 6.

В различных аспектах, антитело – это очищенное или изолированное антитело. «Очищенное» или «изолированное» означает, что у данного антитела или его фрагмента – и такового, удаленного из природы (изолированного из сыворотки крови), и синтезированного (полученного рекомбинантным средством) – была повышена «чистота», при этом «чистота» - это относительный термин, не «абсолютная чистота». В некоторых аспектах, очищенное антитело свободно на 60%, предпочтительно по меньшей мере примерно на 75%, и более предпочтительно по меньшей мере примерно на 90% от других компонентов, с которыми оно обычно ассоциировано, или ассоциировано после синтеза.

Дополнительный аспект настоящего изобретения включает в себя композицию, содержащую нуклеиновую кислоту, конструкцию, полипептид, антитело или его фрагмент, и/или клетку, описанные здесь. Композиция может содержать, например, подходящий носитель, разбавитель или добавку. Например, при том, что композиция содержит антитело или его фрагмент, подходящим носителем может быть белок, такой, как BSA.

В одном варианте осуществления, композиция содержит изолированную нуклеиновую кислоту, изолированную конструкцию, изолированный полипептид, изолированное антитело или его фрагмент, и/или изолированную клетку, описанные здесь, в качестве опции, в сочетании с подходящим носителем, разбавителем или добавкой.

В соответствии с одним вариантом осуществления, композиция – это очищенный экстракт, например, рекомбинантной клетки или рекомбинантного организма, в том виде, как это описано здесь, такой как рекомбинантный растительный экстракт, содержащий повышенный уровень одного или более каннабиноидов и/или CBCAS. В соответствии с одним вариантом осуществления, такой рекомбинантный растительный экстракт содержит повышенный уровень одного или более каннабиноидов, например, КБХК или КБХ. Соответственно, аспект включает в себя каннабиноид, или композицию, содержащую каннабиноид, такой как КБХК или КБХ, полученные в соответствии со способом, или системой, описанными здесь.

В соответствии с одним вариантом осуществления, такой очищенный экстракт содержит супернатант культуры или культуру рекомбинантного организма, например, культуру клеток рекомбинантных дрожжей, при этом CBCAS секретирована в такой супернатант культуры.

Также, в ещё одном аспекте, имеется система ферментации, содержащая рекомбинантный организм или клетку, например, клетку рекомбинантных дрожжей. Система может содержать КБГК и/или иные субстраты в сочетании с одним или более энзимами, или клетки с экспрессией одного или более энзимов в метаболическом пути каннабиноида.

Некоторые варианты осуществления относятся к конструкции, или системе экспрессии in vitro, включающим в себя изолированную или очищенную молекулу нуклеиновой кислоты, имеющую по меньшей мере, более чем, или примерно на 78%, или по меньшей мере, более чем, или примерно на 96% идентичности последовательности относительно SEQ ID NO: 1, 5, 8 или 9, в качестве опции с содержанием гетерологичной доли. Соответственно, представлен способ для приготовления конструкции, или системы экспрессии in vitro, с наличием такой последовательности, или её фрагмента, для введения последовательности или частичной последовательности, со смысловой или анти-смысловой ориентацией, или дополнения, в клетку.

В том виде, как это используется здесь, «вектор» относится к нуклеиновой кислоте, используемой для переноса нуклеиновой кислоты (часто рекомбинантной) в клетку-хозяина.

В том виде, как это используется здесь, «конструкция» относится к искусственно созданной нуклеиновой кислоте, содержащей вектор доставки и нужный полинуклеотид, например, вектор, содержащий описанный здесь полинуклеотид. Нужный полинуклеотид можно клонировать в нужный вектор для создания конструкции.

В соответствии с одним вариантом осуществления, вектор – это вектор экспрессии. Возможные векторы экспрессии включают в себя, но не ограничиваясь таковыми, космиды, плазмиды, или модифицированные вирусы (например, ретровирусы с дефективной репликацией, аденовирусы и аденоассоциированные вирусы), до тех пор, пока такой вектор совместим с используемой клеткой-хозяином. Векторы экспрессии «подходят для трансформации клетки-хозяина», что означает, что векторы экспрессии содержат молекулу нуклеиновой кислоты такого применения, и регуляторные последовательности, выбранные на основе клеток-хозяев, использованных для экспрессии, с функциональной связью с молекулой нуклеиновой кислоты. Предполагается, что функциональная связь означает то, что нуклеиновая кислота связана с регуляторными последовательностями таким образом, чтобы разрешалась экспрессия нуклеиновой кислоты.

В некоторых вариантах осуществления, изолированные и/или очищенные молекулы нуклеиновой кислоты, полинуклеотиды или векторы, конструкции или системы экспрессии in vitro, содержащие эти изолированные и/или очищенные молекулы нуклеиновой кислоты, могут использоваться для создания трансгенных или рекомбинантных организмов или рекомбинантных клеток (то есть в качестве опции клеток рекомбинантных организмов), которые вырабатывают полипептиды с активностью синтазы каннабихроменовой кислоты и/или модулированных уровней полипептидов с активностью синтазы каннабихроменовой кислоты.

Поэтому один вариант осуществления относится к рекомбинантному организму, клетке-хозяину или зародышевой ткани (например, зерно) организма, содержащим молекулу нуклеиновой кислоты, имеющую по меньшей мере 15 перекрывающихся нуклеотидов из SEQ ID NO: 1 и 5, и, в качестве опции, по меньшей мере примерно на 96% идентичность последовательности относительно SEQ ID NO: 1 или 5, и/или конструкции, содержащей указанную изолированную и/или очищенную молекулу нуклеиновой кислоты.

В одном варианте осуществления, рекомбинантный организм, клетка и/или зародышевая ткань экспрессирует полипептид, имеющий по меньшей мере и/или до примерно 150, примерно 175, примерно 200, примерно 225, или примерно 250 аминокислот полипептидной последовательности и, в качестве опции, по меньшей мере на 96% идентичность последовательности относительно того, как это указано в SEQ ID NO: 2 или 6.

Рекомбинантные векторы экспрессии могут также содержать последовательности нуклеиновой кислоты, которые кодируют гетерологичные полипептиды (то есть слитые фрагменты), с вырабатыванием слитого полипептида, когда нужная нуклеиновая кислота, кодирующая полипептид, вводится в вектор в рамке. Гетерологичный полипептид может предполагать повышенную экспрессию рекомбинантного белка; повышенную растворимость рекомбинантного белка; и/или помощь в очистке целевого рекомбинантного белка, путем воздействия в качестве лиганда при аффинной очистке. Например, может быть добавлен участок протеолитического расщепления между целевым рекомбинантным белком для того, чтобы позволить отделение рекомбинантного белка от слитой доли после очистки слитого полипептида. Типичные слитые векторы экспрессии включают в себя pGEX (Amrad Corp., Мельбурн, Австралия), pMal (New England Biolabs, Беверли, (Массачусетс) и pRIT5 (Pharmacia, Пискатауэй, Нью-Джерси), которые сливают глутатион-S-трансферазу (GST), мальтозо-Е-связывающий белок, или белок А, соответственно, с рекомбинантным белком.

Предпочтительно, рекомбинантный организм – это рекомбинантное растение, рекомбинантный многоклеточный микроорганизм или рекомбинантное насекомое. Растения предпочтительны из рода Cannabis, например, Cannabis sativa L., Cannabis indica Lam. и Cannabis ruderalis Janisch, особенно Cannabis sativa. Предпочтительные микроорганизмы – это бактерии (например, Escherichia coli) или дрожжи (например, Saccharomyces cerevisiae, Pichia pastoris). Одноклеточные микроорганизмы могут считаться организмами или клетками, в том числе клетками-хозяевами. Предпочтительное насекомое – Spodoptera frugiperda.

Растения конопли, содержащие нуклеотидную последовательность CBCAS могут быть созданы посредством известных способов трансформации растений, например, трансформация посредством агробактерий, трансформация посредством бомбардировки частицами, пыльцевая трубка или трансформация протопласта. При этих методологических подходах, нужный ген инкорпорируется в геном целевого организма. Например, тканевая культура и трансформация пеньки посредством агробактерии описана у Feeney и Punja, 2003.

Рекомбинантные векторы экспрессии можно вводить в клетку-хозяина для получения трансформированной клетки-хозяина. Прокариотические и/или эукариотические клетки можно трансформировать посредством нуклеиновой кислоты при помощи, например, электропорации или трансформации посредством хлорида кальция. Например, нуклеиновая кислота может вводиться в клетки млекопитающих при помощи традиционных техник, таких как кальций-фосфатная или кальций-хлоридная копресипитация, трасфекция посредством диэтиламиноэтилдекстрана, липофекция, способы посредством вирусов, электропорация или микроинъекция. Подходящие способы для трансформирования и трансфекции клеток можно найти у Sambrook et al. (Molecular Cloning: A Laboratory Manual, 3rd Edition, Cold Spring Harbor Laboratory Press, 2001) и в других лабораторных пособиях.

Подходящие клетки-хозяева включают в себя целый ряд эукариотических и прокариотических клеток. Например, нуклеиновые кислоты и белки, в соответствии с настоящим изобретением, могут экспрессироваться в клетки растений, клетки дрожжей или клетки млекопитающих. Клетки растений предпочтительны из рода Cannabis, например, Cannabis sativa L., Cannabis indica Lam., и Cannabis ruderalis Janisch, особенно Cannabis sativa. Предпочтительные микроорганизмы – это бактерии (например, Escherichia coli) или дрожжи (например, Saccharomyces cerevisiae, Pichia pastoris). Предпочтительные клетки насекомого – Spodoptera frugiperda.

Соответственно, вариант осуществления включает в себя рекомбинантную клетку, и в предпочтительном варианте осуществления такая рекомбинантная клетка – это рекомбинантная растительная клетка. В другом предпочтительном варианте осуществления, рекомбинантная клетка – это дрожжевая рекомбинантная клетка.

Другие подходящие клетки-хозяева описаны у Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1991). В дополнение, белки, в соответствии с настоящим изобретением, могут экспрессироваться в прокариотические клетки, такие как Escherichia coli (Zhang et al., Science 303(5656): 371-3 (2004)). В дополнение, может использоваться система экспрессии на основе псевомонад, например, флуоресцентные псевдомонады (патентная заявка США № US 2005/0186666).

Соответственно, здесь также представлена рекомбинантная клетка, содержащая молекулу нуклеиновой кислоты или полинуклеотид, в соответствии с настоящим изобретением. В соответствии с одним вариантом осуществления, молекула нуклеиновой кислоты дает в результате повышенный уровень синтазы каннабихроменовой кислоты.

Рекомбинантные организмы, клетки и зародышевые ткани, описанные здесь, могут иметь измененные уровни каннабиноидных соединений. Со ссылкой на фигуру 1, специалисты в данной области техники поймут, что экспрессия или сверхэкспрессия молекулы нуклеиновой кислоты приведет к эспрессии или сверхэкспрессии энзима синтазы каннабихроменовой кислоты, что может привести к повышенной выработке каннабиноидных соединений, таких как каннабихроменовая кислота и каннабихромен. Подавление синтазы каннабихроменовой кислоты в организме, клетке или ткани даст в результате недостаточную экспрессию синтазы каннабихроменовой кислоты, что может привести к накоплению более высоких количеств каннабигероловой кислоты, каннабигерола, Δ9-тетрагидроканнабиноловой кислоты, Δ9-тетрагидроканнабинола, каннабидиоловой кислоты и каннабидиола, или вариантов этих соединений с метиловыми или пропиловыми боковыми цепочками. Зародышевые ткани могут включать в себя зерна, эмбрионы или их части, содержащие изолированную нуклеиновую кислоту и/или полипептид.

Экспрессия или сверхэкспрессия молекулы нуклеиновой кислоты может осуществляться в сочетании с экспрессией или сверхэкспрессией одной или более нуклеиновых кислот, которые кодируют один или более других энзимом на метаболическом пути при биосинтезе каннабиноида. Некоторые примеры других нуклеиновых кислот включают в себя: нуклеиновые кислоты, которые кодируют гексаноил-СоА синтетазу, тетракетид синтазу, циклазу оливетоловой кислоты, синтазу ТГКК, синтазу КБДК и/или ароматическую пренилтрансферазу (то есть CsPT1).

Экспрессия или сверхэкспрессия энзима синтазы каннабихроменовой кислоты, в соответствии с настоящим изобретением, в сравнении с контрольным, с нормальными уровнями энзима для того же ряда, с выращиванием при подобных или идентичных условиях приведет к повышенным уровням каннабиноидных соединений, например, примерно 1- примерно 20%, примерно 2- примерно 20%, примерно 5- примерно 20%, примерно 10- примерно 20%, примерно 15- примерно 20%, примерно 1- примерно 15%, примерно 1- примерно 10%, примерно 2- примерно 15%, примерно 2- примерно 10%, примерно 5- примерно 15%, или примерно 10- примерно 15% (в весовом отношении).

Соответственно, ещё один аспект включает в себя способ изменения уровней каннабиноидных соединений в организме, клетке или ткани, указанный способ содержит использование молекулы нуклеиновой кислоты, в соответствии с настоящим изобретением, или фрагмента таковой, для подавления и/или уменьшения экспрессии CBCAS в организме, клетке или ткани.

В соответствии с одним вариантом осуществления, КБХК или КБХ можно изменить и/или создать в клетке или организме, который производит КБГК, или в клетках и организмах, вырабатывающих КБХК и/или КБХ, выработка КБХК и/или КБХ может быть повышена, посредством создания рекомбинантных клеток с экспрессией CBCAS.

Ещё один аспект включает в себя способ in vitro производства КБХК, содержащий: контакт КБГК с CBCAS в растворе или иммобилизованном состоянии при подходящих условиях и в течение подходящего времени для производства КБХК и/или КБХ; и изолирование и/или очистку КБХК и/или КБХ.

Контакт может, например, быть достигнут посредством смешивания КБГК с рекомбинантной CBCAS в растворе и/или в иммобилизованном состоянии, при условиях и в течение времени, подходящего для преобразования по меньшей мере примерно на 10%, по меньшей мере примерно на 20%, по меньшей мере примерно на 30%, по меньшей мере примерно на 40%, по меньшей мере примерно на 50%, по меньшей мере примерно на 60%, по меньшей мере примерно на 70%, по меньшей мере примерно на 80%, по меньшей мере примерно на 90%, или по меньшей мере примерно на 100% КБГК в КБХК.

Раствор в качестве опции содержит MES (морфолиноэтансульфоновая кислота), цитратный или фосфатный буфер, с pH раствора в качестве опции между примерно pH 4 и примерно pH 6.5, или в качестве опции примерно pH 4, примерно pH 4.5, примерно pH 5, примерно pH 5.5, примерно pH 6, или примерно pH 6.5.

Анализ in vitro в качестве опции осуществляется при температуре между 35°С и 50°С, или при любой температуре в этом промежутке (например, любое приращение 0.1°С между примерно 35°С и примерно 50°С), в качестве опции при примерно 35°С, примерно 40°С, примерно 45°С или примерно 50°С.

CBCAS можно иммобилизовать, например, до сферы или столба смолы и использовать, например, а системах in vitro.

Каннабихромен (КБХ), декарбоксилированный продукт КБХК, не способствует в значительной степени воздействию марихуаны на психику, но показывает ТГК-подобную активность в тетрадной модели на мышах при высоких концентрациях (DeLong et al., 2011). В дополнение, сообщалось о том, что КБХ вызывает многочисленные фармакологические и биологические эффекты, в том числе анальгезию (Davis и Hatoum, 1983) и антиноцицепцию (Maione et al., 2011) и обладает противовоспалительным (DeLong et al. 2011; Wirth et al., 1980; Izzo et al. 2012), антигрибковым (Elsohly и Turner, 1982), антибиотическим (Elsohly и Turner, 1982), и противоопухолевым (Ligresti et al., 2006) действием.

Дополнительный аспект включает в себя способ производства КБХК и/или КБХ и/или увеличения производства КБХК и/или КБХ, способ содержит:

i) введение в клетку или организм, производящий КБГК, вектора, содержащего нуклеиновую кислоту, содержащую SEQ ID NO: 1, 5, 8 или 9, или фрагмент с сохранением активности CBCAS, в качестве опции имеющих по меньшей мере или примерно на 78% или более в качестве опции на 96% идентичность последовательности относительно SEQ ID NO: 1, 5, 8 или 9 для производства рекомбинантной клетки или рекомбинантного организма;

ii) культивирование рекомбинантной клетки и/или выращивание рекомбинантного организма при условиях, которые позволяют экспрессию нуклеиновой кислоты; и, в качестве опции;

iii) изолирование и/или очистка КБХК и/или КБХ.

Рекомбинантная клетка способна к экспрессии транзиентно, индуцибельно и/или стабильно.

В соответствии с одним вариантом осуществления, способ содержит нагрев и/или хранение КБХК для производства КБХ. Хранение и/или нагрев КБХК повышает декарбоксилирование до КБХ. Например, было показано, что термическое декарбоксилирование ТГКК и КБДК возникают при температурах >94°С (Veress et al., 1990). Соответственно, в соответствии с одним вариантом осуществления, КБХК нагревают по меньшей мере до 94°С, в качестве опции по меньшей мере или примерно в течение 20 минут, по меньшей мере или примерно в течение 30 минут, по меньшей мере или примерно в течение 40 минут, по меньшей мере или примерно в течение 50 минут, или по меньшей мере или примерно в течение 60 минут или дольше. В ещё одном варианте осуществления, КБХК нагревают по меньшей мере до 105°С, в качестве опции по меньшей мере или примерно в течение 10 минут, по меньшей мере или примерно в течение 20 минут, по меньшей мере или примерно в течение 30 минут, по меньшей мере или примерно в течение 40 минут, по меньшей мере или примерно в течение 50 минут, или по меньшей мере или примерно в течение 60 минут или дольше. В ещё одном варианте осуществления, КБХК нагревают по меньшей мере до 120°С, в качестве опции по меньшей мере или примерно в течение 10 минут, по меньшей мере или примерно в течение 15 минут, по меньшей мере или примерно в течение 20 минут, по меньшей мере или примерно в течение 25 минут, по меньшей мере или примерно в течение 30 минут, по меньшей мере или примерно в течение 35 минут, по меньшей мере или примерно в течение 40 минут, по меньшей мере или примерно в течение 45 минут, по меньшей мере или примерно в течение 50 минут. В ещё одном варианте осуществления, КБХК нагревают по меньшей мере до 140°С, в качестве опции по меньшей мере или примерно в течение 5 минут, по меньшей мере или примерно в течение 10 минут, по меньшей мере или примерно в течение 15 минут, по меньшей мере или примерно в течение 20 минут, или по меньшей мере или примерно в течение 25 минут. В ещё одном варианте осуществления, температура являет собой любое приращение с шагом 0.1°С между примерно 94°С и примерно 150°С, а время нагрева являет собой любое приращение с шагом 1 минута между примерно 3 и примерно 90 минут.

В соответствии с одним вариантом осуществления, нейтральные и кислотные каннабиноиды изолируются и/или очищаются. В соответствии с одним вариантом осуществления, нейтральные каннабиноиды изолируются и/или очищаются. В соответствии с одним вариантом осуществления, кислотные каннабиноиды изолируются и/или очищаются.

Ещё один аспект включает в себя способ производства КБХ и/или повышения производства КБХ, способ содержит:

i) введение в клетку или организм, производящий КБГК, вектора, содержащего нуклеиновую кислоту, содержащую SEQ ID NO: 1, 5, 8 или 9, или фрагмент с сохранением активности CBCAS, в качестве опции имеющих по меньшей мере или примерно на 96% идентичность последовательности относительно SEQ ID NO: 1, 5, 8 или 9 для производства рекомбинантной клетки или рекомбинантного организма;

ii) культивирование рекомбинантной клетки и/или выращивание рекомбинантного организма при условиях, которые позволяют экспрессию нуклеиновой кислоты;

iii) изолирование КБХК; и

iv) нагрев и/или хранение КБХК для производства КБХ.

В соответствии с одним вариантом осуществления, клетка – это растительная клетка. В соответствии с одним вариантом осуществления, растительная клетка – это клетка конопли. В ещё одном варианте осуществления, клетка – это клетка не конопли.

У растений конопли повышенное производство каннабиноидов или понижение/удаление каннабиноидов может быть достигнуто посредством выведения и селекции, а также при помощи генной инженерии с использованием генов, кодирующих энзимы метаболизма биосинтеза каннабиноида, например, ген синтазы КБХК, в соответствии с настоящим изобретением. В дополнение, путь метаболизма биосинтеза, с каннабиноидами в результате, может быть передан бактериям, дрожжам, грибкам или иным гетерологичным организмам, или же посредством in vitro биокатализаторов, для производства каннабиноидов без необходимости в растении конопли.

В соответствии с одним вариантом осуществления, организм – это растение. В соответствии с одним вариантом осуществления, растение – это растение конопли.

Изолирование и клонирование нуклеиновой кислоты хорошо известно. Подобным образом, изолированный ген можно вставить в вектор и передать в клетку при помощи традиционных технологий. Молекулы нуклеиновой кислоты можно передать в клетку и/или организм. Специалисты в данной области техники знают, что существует ряд способов, посредством которых гены, векторы и конструкции можно ввести в клетку и/или организм, и сочетание техник трансформации и культивирования клеток успешно встроено в эффективные стратегии создания рекомбинантных клеток и/или организмов. Эти способы, которые можно использовать здесь, описаны в других источниках (Potrykus, 1991; Vasil, 1994; Walden и Wingender, 1995; Songstad et al., 1995), и они известны специалистам в данной области техники. Подходящие векторы хорошо известны специалистам в данной области техники, и обычно описаны по техническим ссылкам, таким как Pouwels et al., (1986). В частности, подходящие векторы включают в себя векторы Ti-плазмид. Например, специалисты в данной области техники наверняка знают, что в дополнение к трансформации Arabidopsis посредством Agrobacterium при помощи вакуумной инфильтрации (Bechtold et al., 1993), или раневой инокуляции (Katavic et al., 1994), в той же степени возможно трансформировать иные виды растений, с использованием трансформации посредством Ti-плазмид Agrobacterium (например, гипокотиль (DeBlock et al., 1989) или раневой инфекции котиледонных черешков (Moloney et al., 1989), бомбардировки частицами/биолистическими способами (Sanford et al., 1987; Nehra. et al., 1994; Becker et al., 1994), или посредством способов трансформации протопласта, с помощью полиэтилен-гликоля (Rhodes et al., 1988; Shimamoto et al., 1989).

В соответствии с одним вариантом осуществления, рекомбинантная клетка или организм – это генетически модифицированная клетка или генетически модифицированный организм. В соответствии с одним вариантом осуществления, рекомбинантная клетка или организм содержит эписому, содержащую изолированный полинуклеотид.

Рекомбинантный вектор экспрессии, в дополнение к наличию молекулы нуклеиновой кислоты или полинуклеотида в том виде, как это описано здесь, может содержать регуляторные последовательности для транскрипции и трансляции введенной молекулы нуклеиновой кислоты.

Подходящие регуляторные последовательности могут быть получены из целого ряда источников, в том числе генов бактерий, грибков, вирусов, млекопитающих или насекомых (например, см. регуляторные последовательности, описанные у Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990)). Выбор подходящих регуляторных последовательностей зависит от выбранной клетки-хозяина, как это описано далее, и может быть осуществлен специалистом в данной области техники. Примеры таких регуляторных последовательностей включают в себя: транскрипционный промотор и энхансер или связующая последовательность полимеразы РНК, рибосомная связующая последовательность, с включением сигнала инициирования трансляции. В дополнение, в зависимости от выбранной клетки-хозяина и задействованного вектора, другие последовательности, такие как источник репликации, дополнительные участки ограничения ДНК, энхансеры и последовательности, предоставляющие индуцибельность транскрипции, могут быть инкорпорированы в вектор экспрессии.

Также для специалистов в данной области техники будет очевидно, как это описано и в других источниках (Meyer, 1995; Datla et al., 1997), что можно использовать промоторы для направления любой намеренной повышающей или понижающей регуляции генетически модифицированной экспрессии с использованием конститутивных промоторов (то есть тех, которые основаны на CaMV35S), или посредством использования промоторов, которые могут нацелить экспрессию гена в конкретные клетки, ткани (например, промотор напина для экспрессии генетически модифицированных генов при развитии котиледонов зерна), органов (например, корни, листья), до конкретной стадии развития, или в ответ на конкретный внешний стимул (например, тепловой шок).

Промоторы для использования, в соответствии с настоящим изобретением, могут быть индуцибельными, конститутивными, или специфическими для ткани, или иметь различные сочетания таких характеристик. Полезные промоторы включают в себя, но не ограничиваясь таковыми, конститутивные промоторы, такие как вирус CERV, промотор вируса мозаики цветной капусты (CaMV) 35S, или, в частности, промотор вируса мозаики цветной капусты с двойным усовершенствованием, содержащий два промотора CaMV 35S в тандеме (также называется промотор “Double 35S”). В соответствии с одним вариантом осуществления, промотор – это промотор, активный в односемядольных растениях, например, APX, SCP1, PGD1, R1G1B, или промотор EIF5. При некоторых обстоятельствах, может оказаться предпочтительно использовать ткане-специфический или регулируемый в развитии промотор вместо конститутивного промотора. Ткане-специфический промотор допускает сверхэкспрессию в определенных тканях, не затрагивая экспрессию в других тканях.

Промотор и регуляторные области терминации будут функциональны в клетке-хозяине и могут быть гетерологичными (то есть не возникающими естественным образом) или гомологичными (полученными из видов растения-хозяина) относительно клетки и гена. Подходящие промоторы, которые можно использовать, описаны выше.

Регуляторная область терминации может быть выведена из области 3' гена, из которой был получен промотор, или из другого гена. Подходящие области терминации, которые можно использовать, хорошо известны специалистам в данной области техники, и включают в себя терминатор синтазы нопалина Agrobacterium tumefaciens (Tnos), терминатор синтазы маннопина A. tumifaciens (Tmas) и терминатор CaMV 35S (T35S). Особенно предпочтительные области терминации для использования здесь включают в себя область терминации малой субчастицы карбоксилазы бифосфата рибулозы гороха (TrbcS) или область терминации Tnos. Такие генные конструкции удобно отслеживать на предмет активности посредством трансформации в растении-хозяине при помощи Agrobacterium, с наблюдением изменения уровней каннабиноида.

Рекомбинантные конструкции экспрессии, в соответствии с настоящим изобретением, могут также содержать выбираемый маркерный ген, который способствует выбору клеток-хозяев, с трансформированием или трансфекцией при помощи применимой рекомбинантной молекулы. Примеры выбираемых маркерных генов – это гены, кодирующие белок, например, G418 и гигромицин, которые обеспечивают устойчивость к конкретным препаратам, β-галактозидазе, хлорамфеникол ацетилтрансферазе, люциферазе светляка, или иммуноглобулину или его участку, такому как Fc-участку иммуноглобулина, в качестве опции IgG. Транскрипция выбираемого маркерного гена отслеживается по изменениям в концентрации белка выбираемого маркера, такого, как β-галактозидаза, хлорамфеникол ацетилтрансфераза, или люцифераза светляка. Если выбираемый маркерный ген кодирует белок, предоставляющий антибиотическую устойчивость, например, устойчивость к неомицину, можно выбрать клетки-трансформанты с G418. Клетки, в которые инкорпорирован выбираемый маркерный ген, выживут, тогда как другие клетки умрут. Это делает возможным визуализировать и выполнить анализ на экспрессию рекомбинантной конструкции применимой экспрессии, и в частности, определить эффект мутации на экспрессию и фенотип. Понятно, что выбираемые маркеры можно вводить на отдельном векторе от нужной нуклеиновой кислоты.

Молекула нуклеиновой кислоты или её фрагменты можно использовать для блокирования биосинтеза каннабиноида в организмах, которые в обычных условиях производят каннабиноидные соединения. Подавление с использованием молекулы нуклеиновой кислоты, в том виде, как это описано здесь, может быть осуществлено рядом способов, которые известны специалистам в данной области техники, например, техники РНК-интерференции (RNAi), техники искусственной микро-РНК, техники индуцированного вирусом подавления гена (VIGS), антисмысловые техники, техники смысловой косупрессии, и техники направленного мутагенеза.

Техники RNAi задействуют стабильную трансформацию с использованием конструкций плазмид РНК-интерференции (RNAi) (Helliwell и Waterhouse, 2005). Такие плазмиды составлены из фрагмента целевого гена, который должен быть подавлен в структуре инвертированных повторов. Инвертированные повторы разделены спейсером, часто интроном. Конструкция RNAi, под действием подходящего промотора, например, промотор вируса мозаики цветной капусты (CaMV) 35S, интегрирована в геном растения, и последующая транскрипция модифицированного гена приводит к молекуле РНК, которая складывается обратно на себя с образованием двухспиральной шпилечной РНК. Такая структура двухспиральной шпилечной РНК распознается растением и нарезается на малые РНК (примерно 21 нуклеотид длиной), которые называются малые интерферирующие РНК (siRNA). Такие siRNA ассоциируются с белковым комплексом (RISC), что приводит к прямой деградации мРНК для целевого гена.

Техники искусственной микро-РНК (amiRNA) используют путь микро-РНК (miRNA) для подавления эндогенных генов в растениях и других эукариотах (Schwab et al, 2006; Alvarez et al, 2006). При таком способе, фрагменты гена, который нужно подавить, длиной примерно 21 нуклеотид вводятся в ген pre-miRNA для образования конструкции pre-amiRNA. Такая конструкция pre-amiRNA переносится в геном организма с использованием способов трансформации, очевидных для специалистов в данной области техники. После транскрипции pre-amiRNA, получают amiRNA, которые направлены на гены, которые делят нуклеотидную идентичность с последовательностью amiRNA с 21 нуклеотидами.

В техниках подавления RNAi два фактора могут повлиять на выбор длины фрагмента. Чем короче фрагмент, тем менее часто можно достичь эффективного подавления, но очень длинные шпильки повышают шанс рекомбинации в штаммах бактериального хозяина. Эффективность подавления также оказывается зависимой от генов, и может отражать доступность целевого mRNA или относительную распространенность целевого mRNA и высокополимерной РНК (hpRNA) в клетках, в которых такой ген активен. Длина фрагмента между примерно 100 и примерно 800 bp, предпочтительно между примерно 300 и примерно 600 bp, обычно является подходящей для максимизации полученной эффективности подавления. Ещё одно соображение относится к целевой части гена. 5' UTR, область кодирования, и 3’ UTR – это фрагменты, которые можно использовать с одинаково хорошими результатами. Поскольку механизм подавления зависит от гомологии последовательности, имеется потенциал для перекрестного подавления родственных последовательностей mRNA. Когда это нежелательно, необходимо выбрать область с низкой идентичностью последовательностей относительно других последовательностей, такую как 5’ или 3’ UTR. Правило избегания подавления кросс-гомологий предполагает использование последовательностей, которые не имеют блоков идентичности последовательностей более, чем примерно 20 оснований между конструкцией и нецелевыми генными последовательностями. Многие из этих же принципов относятся к выбору целевых областей при разработке искусственных микро-РНК.

Техники индуцированного вирусом подавления гена (VIGS) – это вариант техник RNAi с использованием эндогенных антивирусных защит растений. Инфицирование растений рекомбинантными вирусами VIGS с фрагментами ДНК хозяина приводит к пост-транскрипционному генному подавлению целевого гена. В соответствии с одним вариантом осуществления, можно использовать систему VIGS на основе вируса погремковости табака (TRV).

Антисмысловые техники предполагают введение в растение антисмыслового олигонуклеотида, который свяжет информационную рибонуклеиновую кислоту (mRNA), при производстве посредством нужного гена. «Антисмысловой» олигонуклеотид имеет последовательность оснований, дополняющую относительно информационной рибонуклеиновой кислоты (mRNA), которая называется «смысловая» последовательность. Активность смыслового сегмента mRNA блокируется посредством антисмыслового сегмента mRNA, тем самым эффективно инактивируется экспрессия гена. Применение антисмысла при подавлении гена в растениях описано более подробно у Stam et al., 2000.

Техники смысловой ко-супрессии предполагают введение сильно экспрессированного смыслового модифицированного гена в растение, что в результате дает пониженную экспрессию и модифицированного гена и эндогенного гена (Depicker et al., 1997). Эффект зависит от идентичности последовательностей между модифицированным геном и эндогенным геном.

Техники направленного мутагенеза, например, методика TILLING (Поиск Индуцированных Локальных Нарушений в Геномах) и «удаление гена» с использованием бомбардировки быстрыми нейтронами, можно использовать для отключения функции гена в организме (Henikoff et all., 2004, Li et al., 2001). Методика TILLING предполагает обработку идиоплазмы или отдельных клеток посредством мутагена для вызова точечных мутаций, которые затем обнаруживаются в нужных генах с использованием чувствительного способа обнаружения одно-нуклеотидной мутации. Обнаружение нужных мутаций (например, мутаций, ведущих к инактивированию продукта гена, представляющего интерес) может быть осуществлено, например, при помощи способов секвенирования. Например, можно приготовить олигонуклеотидные праймеры, полученные из нужного гена, и использовать PCR для усиления областей генов, представляющих интерес, из организмов в мутировавшей популяции. Усиленные мутировавшие гены могут быть нормализованы до генов дикого типа, для обнаружения несоответствий между мутировавшими генами и генами дикого типа. Обнаруженные различия можно отследить назад до организма, который имел мутировавший ген, тем самым выяснив, какой мутировавший организм будет иметь нужную экспрессию (то есть подавление гена, представляющего интерес). Эти организмы затем можно выращивать для производства популяции, имеющей нужную экспрессию. TILLING может предоставить аллельные последовательности, которые включают в себя миссенс-мутации и мутации выключения гена, с появлением пониженной экспрессии целевого гена. TILLING представляется, как возможный подход к отключению гена, который не предполагает введение модифицированных генов, и таким образом может быть более приемлемым для потребителей. Бомбардировка быстрыми нейтронами вызывает мутации, например, удаления, в геномах организма, которые также можно выявить с использованием PCR подобным образом, используемому при TILLING.

Термины

Для облегчения понимания различных вариантов осуществления настоящего изобретения, представлены следующие разъяснения специфических терминов.

В том виде, как это используется здесь, термин «примерно» понимается специалистами в данной области техники, и может меняться в некоторой степени, в зависимости от контекста, в котором он используется. Если имеет место использование этого термина, которое непонятно для специалистов в данной области техники, в том контексте, в котором оно использовано, «примерно» будет означать плюс или минус 10% от конкретного термина.

Антитело: в том виде, как это используется здесь, термин «антитело» включает в себя моноклональные антитела, поликлональные антитела и гибридные антитела. Антитело может быть из рекомбинантных источников и/или произведено генетически модифицированными животными.

Связующий фрагмент антитела: термин «связующий фрагмент антитела», в том виде, как это используется здесь, включает в себя Fab, Fab', F(ab')2, scFv, dsFv, ds-scFv, димеры, миниантитела, диатела, и их мультимеры, и фрагменты биспецифических антител. Антитела могут быть фрагментированы с использованием традиционных техник. Например, фрагменты F(ab')2 могут вырабатываться при помощи обработки антитела пепсином. Полученный фрагмент F(ab')2 можно обработать для уменьшения дисульфидных мостиков для получения фрагментов Fab’. Папаиновая гидролизация может привести к образованию фрагментов Fab. Fab, Fab' и F(ab')2, scFv, dsFv, ds-scFv, димеры, миниантитела, диатела, фрагменты биспецифических антител и другие фрагменты также можно синтезировать при помощи рекомбинантных техник.

Антитела бывают моноспецифическими, биспецифичными, триспецифичными, или обладать большей мультиспецифичностью. Мультиспецифичные антитела могут иммуноспецифично привязываться к различным эпитопам синтазы каннабихроменовой кислоты и/или твердому материалу подложки.

Антитела могут быть любого животного происхождения, в том числе от птиц и млекопитающих (например, человеческими, крысиными, ослиными, овечьими, кроличьими, козлиными, морских свинок, верблюжьими, лошадиными или куриными).

Антитела можно приготовить с использованием способов, которые известны специалистам в данной области техники. Например, обратитесь к Kohler et al. (1975) Nature 256:495-497; Kozbor et al. (1985) J. Immunol. Methods, 81:31-42; Cote et al. (1983) Proc Natl Acad Sci., 80:2026-2030; and Cole et al. (1984) Mol Cell Biol., 62:109-120, для приготовления моноклональных антител; Huse et al. (1989) Science, 246:1275-1281, для приготовления моноклональных фрагментов Fab; и к Pound (1998) Immunochemical Protocols, Humana Press, Totowa, N.J., для приготовления фагмид или B-лимфоцитных иммуноглобулиновых библиотек для идентификации антител.

Кодоновая дегенерация: известно, что настоящее описание охватывает дегенерацию кодона в том виде, как это будет понятно для специалистов в данной области техники, и как это проиллюстрировано в Таблице 1. Кодон-оптимизированные последовательности представлены в Примере 8.

Таблица 1 – Кодоновые дегенерации
Аминокислота Кодоны
Ala/A GCT, GCC, GCA, GCG
Arg/R CGT, CGC, CGA, CGG, AGA, AGG
Asn/N AAT, AAC
Asp/D GAT, GAC
Cys/C TGT, TGC
Gln/Q CAA, CAG
Glu/E GAA, GAG
Gly/G GGT, GGC, GGA, GGG
His/H CAT, CAC
Ile/I ATT, ATC, ATA
Leu/L TTA, TTG, CTT, CTC, CTA, CTG
Lys/K AAA, AAG
Met/M ATG
Phe/F TTT, TTC
Pro/P CCT, CCC, CCA, CCG
Ser/S TCT, TCC, TCA, TCG, AGT, AGC
Thr/T ACT, ACC, ACA, ACG
Trp/W TGG
Tyr/Y TAT, TAC
Val/V GTT, GTC, GTA, GTG
START ATG
STOP TAG, TGA, TAA

Консервативные замещения: В дополнение, специалисты в данной области техники поймут, что консервативные замещения можно осуществлять в аминокислотной последовательности полипептида без нарушения структуры или функции полипептида. Консервативные аминокислотные замещения осуществляются специалистом в данной области техники при помощи замещения аминокислот с подобными гидрофобностью, полярностью, длиной R-цепочки, одной на другую. В дополнение, при сравнении выстроенных последовательностей гомологичных белков от разных особей, можно идентифицировать консервативные аминокислотные замещения посредством локализации аминокислотных остатков, которые мутировали между особями без изменения основных функций закодированных белков. Таблица 2 дает примерный список консервативных замещений.

Таблица 2 – Консервативные замещения
Тип аминокислоты Замещаемые аминокислоты
Гидрофильная Ala, Pro, Gly, Glu, Asp, Gln, Asn, Ser, Thr
Сульфгидрильная Cys
Алифатическая Val, Ile, Leu, Met
Основная Lys, Arg, His
Ароматическая Phe, Tyr, Trp

Комплементарная нуклеотидная последовательность:«комплементарная нуклеотидная последовательность» последовательности понимается, как означающая любую молекулу нуклеиновой кислоты, нуклеотиды которой комплементарны таковым последовательности, в соответствии с настоящим изобретением, и ориентация которых противоположна (антипараллельная последовательность).

Степень или процентное отношение гомологии последовательности: термин «степень или процентное отношение гомологии последовательности» относится к степени или процентному отношению идентичности последовательностей между двумя последовательностями после оптимального выстраивания. Процентное отношение идентичности последовательностей (или степень идентичности) определяется при помощи сравнения двух оптимально выстроенных последовательностей в окне сравнения, где участок пептида или полинуклеотидной последовательности в окне сравнения может содержать добавления или удаления (то есть промежутки), в сравнении с эталонной последовательностью (которая не содержит добавлений или удалений) для оптимального выстраивания двух последовательностей. Процент рассчитывается посредством определения числа позиций с образованием идентичного аминокислотного остатка или основания нуклеиновой кислоты в обеих последовательностях, для получения числа совпадающих позиций, с делением такого числа совпадающих позиций на общее число позиций в сравнительном окне, и умножением результата на 100 для получения процентного соотношения идентичности последовательностей.

Слитая молекула: термин «слитая молекула» относится к связыванию пептидной последовательности, с получением из внеклеточного домена или доменов полипептида с активностью синтазы каннабихроменовой кислоты (SEQ ID NO: 2 или 6) со слитым партнером, и может быть прямым или непрямым связыванием посредством ковалентной или нековалентной связи. Слитый партнер может быть связан либо с N-концом или С-концом пептидной последовательности с получением от синтазы каннабихроменовой кислоты (SEQ ID NO: 2 или 6).

Гомологичная изолированная и/или очищенная последовательность: «гомологичная изолированная и/или очищенная последовательность» означает изолированную и/или очищенную последовательность с процентным соотношением идентичности с основаниями нуклеотидной последовательности, или аминокислот полипептидной последовательности по меньшей мере примерно на 95%, примерно на 96%, примерно на 97%, примерно на 98%, примерно на 99%, примерно на 99.5%, примерно на 99.6%, или примерно на 99.7%. Это процентное соотношение является сугубо статистическим, и можно распределить различия между двумя нуклеотидными последовательностями произвольно и по всей их длине. Идентичность последовательностей можно определить, например, при помощи компьютерных программ, предназначенных для осуществления одиночного и множественного выравнивания последовательностей. Специалисты в данной области техники понимают, что это описание охватывает кодоновую дегенерацию. Дополнительно, специалистам в данной области техники будет понятно, что консервативные замещения можно осуществлять в аминокислотной последовательности полипептида без нарушения структуры или функции полипептида. Консервативные аминокислотные замещения осуществляются специалистом в данной области техники при помощи замещения аминокислот с подобными гидрофобностью, полярностью, длиной R-цепочки, одной на другую. В дополнение, при сравнении выстроенных последовательностей гомологичных белков от разных особей, можно идентифицировать консервативные аминокислотные замещения посредством локализации аминокислотных остатков, которые мутировали между особями без изменения основных функций закодированных белков.

Увеличение, уменьшение, модулирование, изменение и т.п. Специалисты в данной области техники понимают, что такие термины относятся к сравнению с подобным рядом, выращенным при подобных условиях, но без модифицирования, приводящего к увеличению, уменьшению, модулированию или изменению. В некоторых случаях, это может быть нетрансформированный контроль, ложно-трансформированный контроль, или вектор-трансформированный контроль.

Изолированный: Специалисты в данной области техники понимают, что «изолированный» относится к примерным полипептидам или нуклеиновым кислотам, которые, «изолированы» от их естественного окружения, в том числе, но не ограничиваясь таковыми, вирусам, белкам, гликопротеином, пептидным производным или фрагментам полинуклеотидов. Например, термин «изолированная молекула нуклеиновой кислоты» здесь относится к нуклеиновой кислоте, практически свободной от клеточного материала или культурной среды при производстве при помощи техники рекомбинантной ДНК, или химических прекурсоров, или иных химикатов при химическом синтезе. Изолированная нуклеиновая кислота также практически свободна от последовательностей, которые обычно примыкают по бокам к нуклеиновой кислоте (то есть последовательности, расположенные на концах 5' и 3' нуклеиновой кислоты), от которых нуклеиновая кислота извлекается.

Система экспрессии in vitro: термин «система экспрессии in vitro» в том виде, как это описано здесь, относится к реагентам и компонентам (например, в комплекте) и/или растворам, содержащим указанные реагенты и компоненты для рекомбинантной белковой экспрессии, при этом система экспрессии in vitro свободна от клеток и в качестве опции включает в себя достаточные для трансляции экстракты целых клеток и/или другие реагенты или компоненты машинной трансляции, в качестве опции, в растворе, указанные реагенты и компоненты в качестве опции включают в себя полимеразу РНК, один или несколько регуляторных белковых факторов, один или несколько транскрипционных факторов и тРНК, в качестве опции дополненная ко-факторами и нуклеотидами, и нужный специфический генный шаблон. Также охватываются системы экспрессии на химической основе, в качестве опции использующие аминокислоты, возникающие не естественным путем.

В соответствии с одним вариантом осуществления, система экспрессии in vitro содержит вектор, в качестве опции с промотором 5' Т7 вниз по потоку от которого вводится изолированный полинуклеотид.

Полинуклеотид или молекула нуклеиновой кислоты: «Полинуклеотид или молекула нуклеиновой кислоты» означает формы с двойной спиралью или с одной спиралью, в виде мономера или димера (так называемый тандем), и продукты транскрипции таковых, а также комплементарные последовательности нуклеиновой кислоты. Пинуклеотиды и молекулы нуклеиновой кислоты включают в себя последовательность нуклеозида или нуклеотидные мономеры, состоящие из возникших естественным образом оснований, сахаров, и меж-сахарные (остовные) сцепления. Термин также включает в себя модифицированные или замещенные последовательности, содержащие не возникающие естественным образом мономеры или их участки. Последовательности нуклеиновой кислоты, в соответствии с настоящим изобретением, могут быть последовательностями дезоксирибонуклеиновой кислоты (ДНК) или последовательностями рибонуклеиновой кислоты (РНК) и могут включать в себя возникающие естественным образом основания, в том числе аденин, гуанин, цитозин, тимидин и урацил. Последовательности также могут содержать модифицированные основания. Примеры таких модифицированных оснований включают в себя аза- и деаза- аденин, гуанин, цитозин, тимидин и урацил; и ксантин и гипоксантин. В соответствии с одним вариантом осуществления, полинуклеотид или молекула нуклеиновой кислоты – это комплементарная ДНК.

Белок или полипептид: «Белок или полипептид» означает последовательность аминокислотных остатков, с кодированием при помощи молекулы нуклеиновой кислоты. В контексте настоящего описания, полипептид, в соответствии с настоящим изобретением, может в одном из вариантов осуществления включать в себя различные структурные формы первичного белка. Например, полипептид, в соответствии с настоящим изобретением, может быть в форме кислотных или основных солей, или в нейтральной форме. В дополнение, отдельные аминокислотные остатки могут модифицироваться посредством оксидации или редукции. Белки и полипептиды, в соответствии с настоящим изобретением, могут также включать в себя усечения, аналоги и гомологи белков и полипептидов в том виде, как это описано здесь, и иметь практически ту же функцию, что и белки или полипептиды, в соответствии с настоящим изобретением, такие, как имеющие активность синтазы каннабихроменовой кислоты.

Идентичность последовательностей: Две аминокислотных или нуклеотидных последовательности считаются «идентичными», если последовательность аминокислотных или нуклеотидных остатков в этих двух последовательностях одна и та же при выравнивании для максимального соответствия, как это описано далее. Сравнения последовательностей между двумя (или более) пептидами или полинуклеотидами обычно осуществляют посредством сравнения последовательностей двух оптимально выравненных последовательности по сегменту или в «окне сравнения» для идентификации и сравнения локальных областей подобия последовательностей. Оптимальное выравнивание последовательностей для сравнения можно осуществить посредством алгоритма локальной гомологии, в том виде, как это описано у Smith и Waterman, Ad. App. Math 2: 482 (1981), посредством алгоритма выравнивания гомологии, описанного у Needleman and Wunsch, J. Mol. Biol. 48: 443 (1970), посредством способа поиска подобия, описанного у Pearson и Lipman, Proc. Natl. Acad. Sci. (U.S.A.) 85: 2444 (1988), посредством компьютерной реализации этих алгоритмов (GAP, BESTFIT, FASTA, и TFASTA в программном пакете Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), или посредством визуальной инспекции.

Определение идентичности последовательностей, данное выше – это определение, которое используют специалисты в данной области техники. Само по себе определение не требует помощи какого-либо алгоритма, указанные алгоритмы полезны только для достижения оптимального выравнивания последовательностей, а не для вычисления идентичности последовательностей.

Из определения, данного выше, следует, что имеется хорошо заданное и только одно значение идентичности последовательностей между двумя сравниваемыми последовательностями, значение соответствует значению, полученному при наилучшем или оптимальном выравнивании.

Его фрагмент: В том виде, как это используется здесь, термин «его фрагмент» на взаимозаменяемой основе с термином «часть» относится к последовательности нуклеиновой кислоты или аминокислотной последовательности, содержащей примерно до 3, примерно 5, примерно 10, примерно 15, примерно 25, примерно 50, примерно 100, примерно 250, или примерно 500 перекрывающихся остатков представляющей интерес нуклеотидной или аминокислотной последовательности, например, содержит примерно до 3, примерно 5, примерно 10, примерно 15, примерно 25, примерно 50, примерно 100, примерно 200, примерно 250, примерно 300, примерно 400, примерно 500, примерно 600, примерно 700, примерно 800, примерно 900, примерно 1000, примерно 1100, примерно 1200, примерно 1300, примерно 1400, или примерно 1500 нуклеотидов соответственно SEQ ID NO: 1 или содержит примерно до 3, примерно 5, примерно 10, примерно 15, примерно 25, примерно 50, примерно 100, примерно 200, примерно 250, примерно 300, примерно 400, или примерно 500 аминокислот соответственно SEQ ID NO: 2.

Строгая гибридизация: Гибридизация в условиях строгости нуклеотидной последовательности означает гибридизацию в условиях температуры и ионной силы, выбранных таким образом, чтобы разрешить поддержку гибридизации между двумя фрагментами комплементарных молекул нуклеиновой кислоты. Гомологи гена CBCAS, описанные здесь, полученные из других организмов, например, растений, можно получить посредством тестирования соответствующих библиотек, которые включают в себя гомологи, при этом тестирование осуществляют с нуклеотидной последовательностью конкретного гена CBCAS, в том виде, как это описано здесь, или его частями или зондами, или с идентификацией посредством поиска гомологии последовательности с использованием программ поиска при выравнивании последовательности, таких как BLAST, FASTA.

Термины «трансформирован при помощи», «трансфицированный при помощи», «трансформация» и «трансфекция» охватывают введение нуклеиновой кислоты (например, конструкции) в клетку посредством одной из многих техник, известных специалистам в данной области техники.

Односпиральная молекула нуклеиновой кислоты «комплементарна» относительно другой односпиральной молекулы нуклеиновой кислоты, когда имеется пара оснований с возможностью гибридизации с другой молекулой нуклеиновой кислоты целиком, или её участком, с образованием двойной спирали (двуспиральной молекулы нуклеиновой кислоты), основанной на способности гуанина (G) гибридизироваться с цитозином (С) и аденином (А) для гибридизации с тимином (Т) или уридином (U).

При понимании объёма настоящего изобретения термин «содержащий» и его производные, в том виде как это используется здесь, являются терминами, не имеющими ограничительного характера, которые указывают на наличие обозначенных признаков, элементов, компонентов, групп, целых чисел, и/или этапов, но не исключают наличия других необозначенных признаков, элементов, компонентов, групп, целых чисел, и/или этапов. Вышеупомянутое также относится к словам, имеющим похожие значения, таким как термины «включающий в себя», «имеющий» и их производные. Наконец, термины степени, такие как «существенно», «примерно» и «приблизительно», в том виде как это используется здесь, означается разумное количество отклонения модифицированного термина таким образом, что конечный результат меняется незначительно. Эти термины степени должны подразумеваться как включающие в себя отклонения, по меньшей мере на ±10% от модифицированного термина, и если такое отклонение не отменяет значение слова, которое оно модифицирует.

При понимании объёма настоящего изобретения термин «состоящий» и его производные, в том виде как это используется здесь, является термином, не имеющим ограничительного характера, который указывает на наличие обозначенных признаков, элементов, компонентов, групп, целых чисел, и/или этапов, но не исключают наличия других необозначенных признаков, элементов, компонентов, групп, целых чисел, и/или этапов.

Цитирование численных диапазонов по конечным точкам здесь включает в себя все числа и дроби, находящиеся в пределах такого диапазона (то есть, примерно 1 до примерно 5 включает в себя 1, 1.5, 2, 2.75, 3, 3.90, 4 и 5). Также необходимо понимать, что все эти числа и дроби могут изменяться при использовании термина «примерно». В дополнение, необходимо понимать, что определенные и неопределенные артикли включают в себя множественное число, если только из содержания явным образом не следует иное.

В дополнение, определения и варианты осуществления, описанные в конкретных разделах, считаются применимыми и к другим вариантам осуществления, описанным здесь, для которых они подходят, как это будет понятно специалистам в данной области техники. Например, в нижеследующих параграфах различные аспекты настоящего изобретения описаны более подробно. Каждый аспект, описанный таким образом, может сочетаться с любым другим аспектом или аспектами, если явно не указано иное. В частности, любой признак, указанный как предпочтительный или преимущественный, может сочетаться с любым другим признаком или признаками, указанными как предпочтительные или преимущественные. Вышеприведенное описание в общем виде описывает настоящую заявку. Более полное понимание может быть получено путем обращения к нижеследующим конкретным примерам. Эти примеры описываются исключительно для цели иллюстрации и не несут в себе ограничений относительно объёма заявки. Изменение в форме и замена эквивалентами возможны в том виде, как это может оказаться целесообразным по обстоятельствам. При том, что в настоящем описании были использованы конкретные термины, такие термины предназначены в описательном смысле, а не для целей ограничения.

Все общедоступные документы, упомянутые здесь, в том числе, но не ограничиваясь таковыми, патенты США, включены в настоящее описание посредством ссылки.

Нижеследующие, не имеющие ограничительного характера примеры из настоящего описания являются иллюстративными.

Примеры:

Пример 1: Идентификация синтазы КБХК в геноме конопли.

Последовательность генома конопли (van Bakel et al., 2011) анализировали, используя BLAST анализ, на присутствие генов с высоким уровнем сходства с синтазой ТГКК. Это привело к идентификации гена, в котором 96% нуклеотидов сходны с синтазой ТГКК. На основе последующих биохимических характеристик, авторы назвали этот ген Cannabis sativa синтазой каннабихроменовой кислоты (CBCAS).

Последовательность кДНК Cannabis sativa синтазы каннабихроменовой кислоты (CBCAS) - 1635 bp представлены в SEQ ID NO: 1. Подчеркнутая последовательность относится к последовательности, удаленной в SEQ ID NO: 5. SEQ ID NO: 1 может содержать полную последовательность или с удалением повторов 3 в подчеркнутой последовательности и/или первого ATG, чтобы поддерживать кодирование рамки.

atgaattgctcaacattctccttttggtttgtttgcaaaataatatttttctttctctcattcaatatccaaatttcaatagctaatcctcaagaaaacttccttaaatgcttctcggaatatattcctaacaatccagcaaatccaaaattcatatacactcaacacgaccaattgtatatgtctgtcctgaattcgacaatacaaaatcttagattcacctctgatacaaccccaaaaccactcgttattgtcactccttcaaatgtctcccatatccaggccagtattctctgctccaagaaagttggtttgcagattcgaactcgaagcggtggccatgatgctgagggtttgtcctacatatctcaagtcccatttgctatagtagacttgagaaacatgcatacggtcaaagtagatattcatagccaaactgcgtgggttgaagccggagctacccttggagaagtttattattggatcaatgagatgaatgagaattttagttttcctggtgggtattgccctactgttggcgtaggtggacactttagtggaggaggctatggagcattgatgcgaaattatggccttgcggctgataatatcattgatgcacacttagtcaatgttgatggaaaagttctagatcgaaaatccatgggagaagatctattttgggctatacgtggtggaggaggagaaaactttggaatcattgcagcatgtaaaatcaaacttgttgttgtcccatcaaaggctactatattcagtgttaaaaagaacatggagatacatgggcttgtcaagttatttaacaaatggcaaaatattgcttacaagtatgacaaagatttaatgctcacgactcacttcagaactaggaatattacagataatcatgggaagaataagactacagtacatggttacttctcttccatttttcttggtggagtggatagtctagttgacttgatgaacaagagctttcctgagttgggtattaaaaaaactgattgcaaagaattgagctggattgatacaaccatcttctacagtggtgttgtaaattacaacactgctaattttaaaaaggaaattttgcttgatagatcagctgggaagaagacggctttctcaattaagttagactatgttaagaaactaatacctgaaactgcaatggtcaaaattttggaaaaattatatgaagaagaggtaggagttgggatgtatgtgttgtacccttacggtggtataatggatgagatttcagaatcagcaattccattccctcatcgagctggaataatgtatgaactttggtacactgctacctgggagaagcaagaagataacgaaaagcatataaactgggttcgaagtgtttataatttcacaactccttatgtgtcccaaaatccaagattggcgtatctcaattatagggaccttgatttaggaaaaactaatcctgagagtcctaataattacacacaagcacgtatttggggtgaaaagtattttggtaaaaattttaacaggttagttaaggtgaaaaccaaagctgatcccaataatttttttagaaacgaacaaagtatcccacctcttccaccgcgtcatcat

Соответствующая последовательность аминокислот открытой формы считывания Cannabis sativa синтазы каннабихроменовой кислоты - 545 aa представлена в SEQ ID NO: 2 (и может включать в себя все или часть из первых 28 аминокислот).

MNCSTFSFWFVCKIIFFFLSFNIQISIANPQENFLKCFSEYIPNNPANPKFIYTQHDQLY

MSVLNSTIQNLRFTSDTTPKPLVIVTPSNVSHIQASILCSKKVGLQIRTRSGGHDAEGLS

YISQVPFAIVDLRNMHTVKVDIHSQTAWVEAGATLGEVYYWINEMNENFSFPGGYCPTVG

VGGHFSGGGYGALMRNYGLAADNIIDAHLVNVDGKVLDRKSMGEDLFWAIRGGGGENFGI

IAACKIKLVVVPSKATIFSVKKNMEIHGLVKLFNKWQNIAYKYDKDLMLTTHFRTRNITD

NHGKNKTTVHGYFSSIFLGGVDSLVDLMNKSFPELGIKKTDCKELSWIDTTIFYSGVVNY

NTANFKKEILLDRSAGKKTAFSIKLDYVKKLIPETAMVKILEKLYEEEVGVGMYVLYPYG

GIMDEISESAIPFPHRAGIMYELWYTATWEKQEDNEKHINWVRSVYNFTTPYVSQNPRLA

YLNYRDLDLGKTNPESPNNYTQARIWGEKYFGKNFNRLVKVKTKADPNNFFRNEQSIPPL

PPRHH

Пример 2. Клонирование и экспрессия CBCAS

CBCAS была усилена из геномного фрагмента ДНК конопли с использованием праймеров 5'- CTGCAGGAATGAATTGCTCAACATTCTCCT-3’ (SEQ ID NO: 3) и 5’-AAGCTTTCATGGTACCCCATGATGACGCGGTGGAAGA-3’ (SEQ ID NO: 4).

50 мкл реакция содержала 100 нг шаблона, 0.2 мкг каждого праймера, полимеразу ДНК Pfu Utrall, буфер реакции 1х Pfu и 0.4 мкм dNTPs. Условия цикла представляли собой 95°С в течение 20 с., 55°С в течение 20 с., и 75°С в течение 2 минут. Продукт был очищен, A-сшит при помощи ДНК-полимеразы Taq, и клонирован во входящий вектор pCR8/GW/TOPO (инвитроген). Отдельные колонии изолировали, выращивали в LB-среде, дополненной спектиномицином, ДНК плазмид изолировали с использованием набора Qiagen QiaPrep и верифицировали при помощи секвенсирования по Сэнгеру. CBCAS ORF вырезали с использованием Pstl и Kpnl, изолировали посредством гелевого электрофореза и клонировали в IPICZαC (инвитроген), которые обрезали при помощи тех же энзимов ограничения и дефосфорилировали. Вся последовательность кодирования синтазы КБХК, в том числе нативный N-терминальный секреторный сигнал, использовалась в конструкции вектора экспрессии Pichia.

Энзим экспрессировали в качестве продукта N-терминального слияния, с пептидом сигнала альфа-фактора с кодированием вектором для обеспечения секреции белка из клеток Pichia. lPICzαC:CBCAS трансформировали в штамм Pichia pastoris Х33 (инвитроген) при помощи электропорации. Колонии, устойчивые к флеомицину, были выбраны и посеяны штрихом на минимальные метаноловые пластины, с которых отдельные колонии брали и использовали для инокулирования 50 мл модифицированной BMGY-среды (1% экстракт дрожжей, 2% пептон, 50 mP HEPES pH 6, 1.34% дрожжевого азотного основания, 4х10-5% биотин, 1% глицерол), которую выращивали в течение 2 дней. Приблизительно 20 мл этой культуры использовали для инокулирования 400 мл модифицированной BMMY-среды (1% экстракт дрожжей, 2% пептон, 50 mМ HEPES pH 7, 1.34% дрожжевого азотного основания, 4х10-5% биотин, 1% метанол, 0.00001% рибофлавин) до приблизительно начального OD600 1. Культуру выращивали в течение четырех дней при 20°С с взбалтыванием при 90 оборотах в минуту. Метанол добавляли каждые 24 часа до конечной концентрации 1%. Через четыре дня, клетки удалили из среды посредством центрифугирования (13k г за 20 минут) и очищенная среда была пропущена через фильтр 2 мкм с сохранением на льду. 100 мл пропустили через гидроксиапатитовый картридж (BioRad Bio-Scale Mini CHT Type 1, 40 μm media) при 90 mL h-1 с предшествовавшим уравновешиванием при помощи 5 CV 10 mM фосфата натрия pH 7. Использовали два картриджа, как таковые, параллельно. Картриджи промывали 5 объёмами столба 10 mM фосфата натрия pH 7, и затем инсталлировали последовательно в систему FLCP (Äkta, Amersham Biosciences). Белки вымывали из картриджей с линейным градиентом 10 mM фосфата натрия pH 7, до 100% 500 mM фосфата натрия рН более 7 более 200 объёмов столба при скорости потока 1.75 мл/мин. Собрали фракций пять мЛ. После повторного уравновешивания гидроксиапатитовых картриджей, оставшуюся среду обработали, как описано выше, и фракции затем сложили и проверили на активность CBCAS.

Пример 3. Проверки CBCAS

Реакции с использованием сред осуществляли посредством инкубирования 10 мкмоль КБГК в 500 мкЛ очищенной от примеси среды культуры на 14 часов. Реакции с использованием гидроксил-апатитовых фракций осуществляли с 100 мкЛ фракции с инкубированием 10 нмоль КБГК в течение 14 часов. Завершенные реакции окислили одной каплей 4 N HCl и извлекли при помощи 400 мкЛ ацетонитрила. После центрифугирования, органические фазы сложили и выпарили до высушивания. Продукты заново суспензировали в 20 мкЛ 50% метанола, из чего 10 мкЛ анализировали по LCMS. Продукты разделили при помощи Waters Alliance HPLC с использованием системы с бинарным растворителем (растворитель А: 10% ацетонитрила, 0.05% муравьиной кислоты; растворитель В: 99.95% ацетонитрила, 0.05% муравьиной кислоты) и столба Ascnetis C18 5 cm x 2.1 mm 2.7 μm column (Sigma). Изначальные условия: 55% А при 0.25 мл/мин. Снижение до 5% А от 0-8 миг., выдерживание при 5% А в течение 2.5 мин., возвращение к изначальным условиям более 2 миг., и уравновешивание при начальных условиях в течение 7 минут. Ультрафиолетовые спектры получали с использованием массива светодиодных детекторов, настроенных на 200-350 nm.

Как показано на фигуре 2, рекомбинантная CBCAS катализировала образование КБХК из КБГК. Как показано на фигуре 3, рекомбинантная CBCAS имеет кажущуюся массу 63 kDa после обработки эндогликосилазой (Endo Hf). Как показано на фигуре 4, рекомбинантная CBCAS имеет оптимальный pH 5.5, оптимальную температуру 40° и заселена высокими концентрациями DMSO и Triton X-100.

Проверяли активность для pH 3.5, 4, 4.5, 5, 5.5, 6, 6.5, и 7. Была активность между pH 4 и pH 6.5 в одном или более буфере. Максимальную активность проверяли для температур 35, 40, 45 и 50°С, максимальную активность наблюдали при 40°С.

Настоящий ген кодирует энзим CBCAS из конопли. Этот ген можно использовать для создания посредством разведения рекомбинантных растений, направленного мутагенеза, генетической инженерии, растений конопли с улучшенным производством каннабиноидов. В дополнение, инактивация или подавление этого гена в конопле может использоваться для блокировки каннабиноидного биосинтеза и, тем самым, уменьшения производства каннабиноидов, таких как КБХК, прекурсора КБХ, в растениях конопли (например, промышленная пенька). Этот ген можно использовать в сочетании с генами, кодирующими иные энзимы на метаболическом пути каннабиноида для проектирования каннабиноидного биосинтеза в других растениях или микроорганизмах.

Пример 4

Рекомбинантные последовательности не имеющие расчетной сигнальной последовательности и содержащие стартовый кодон/стартовый метионин.

SEQ ID NO: 5

ATG------------------------------------------------------------------------------------CCTCAAGAAAAC TTCCTTAAATGCTTCTCGGAATATATTCCTAACAATCCAGCAAATCCAAAATTCATATACACTCAACACGACCAATTGTATATGTCTGTCCTGAATTCGACAATACAAAATCTTAGATTCACCTCTGATACAACCCCAAAACCACTCGTTATTGTCACTCCTTCAAATGTCTCCCATATCCAGGCCAGTATTCTCTGCTCCAAGAAAGTTGGTTTGCAGATTCGAACTCGAAGCGGTGGCCATGATGCTGAGGGTTTGTCCTACATATCTCAAGTCCCATTTGCTATAGTAGACTTGAGAAACATGCATACGGTCAAAGTAGATATTCATAGCCAAACTGCGTGGGTTGAAGCCGGAGCTACCCTTGGAGAAGTTTATTATTGGATCAATGAGATGAATGAGAATTTTAGTTTTCCTGGTGGGTATTGCCCTACTGTTGGCGTAGGTGGACACTTTAGTGGAGGAGGCTATGGAGCATTGATGCGAAATTATGGCCTTGCGGCTGATAATATCATTGATGCACACTTAGTCAATGTTGATGGAAAAGTTCTAGATCGAAAATCCATGGGAGAAGATCTATTTTGGGCTATACGTGGTGGAGGAGGAGAAAACTTTGGAATCATTGCAGCATGTAAAATCAAACTTGTTGTTGTCCCATCAAAGGCTACTATATTCAGTGTTAAAAAGAACATGGAGATACATGGGCTTGTCAAGTTATTTAACAAATGGCAAAATATTGCTTACAAGTATGACAAAGATTTAATGCTCACGACTCACTTCAGAACTAGGAATATTACAGATAATCATGGGAAGAATAAGACTACAGTACATGGTTACTTCTCTTCCATTTTTCTTGGTGGAGTGGATAGTCTAGTTGACTTGATGAACAAGAGCTTTCCTGAGTTGGGTATTAAAAAAACTGATTGCAAAGAATTGAGCTGGATTGATACAACCATCTTCTACAGTGGTGTTGTAAATTACAACACTGCTAATTTTAAAAAGGAAATTTTGCTTGATAGATCAGCTGGGAAGAAGACGGCTTTCTCAATTAAGTTAGACTATGTTAAGAAACTAATACCTGAAACTGCAATGGTCAAAATTTTGGAAAAATTATATGAAGAAGAGGTAGGAGTTGGGATGTATGTGTTGTACCCTTACGGTGGTATAATGGATGAGATTTCAGAATCAGCAATTCCATTCCCTCATCGAGCTGGAATAATGTATGAACTTTGGTACACTGCTACCTGGGAGAAGCAAGAAGATAACGAAAAGCATATAAACTGGGTTCGAAGTGTTTATAATTTCACAACTCCTTATGTGTCCCAAAATCCAAGATTGGCGTATCTCAATTATAGGGACCTTGATTTAGGAAAAACTAATCCTGAGAGTCCTAATAATTACACACAAGCACGTATTTGGGGTGAAAAGTATTTTGGTAAAAATTTTAACAGGTTAGTTAAGGTGAAAACCAAAGCTGATCCCAATAATTTTTTTAGAAACGAACAAAGTATCCCACCTCTTCCACCGCGTCATCAT

SEQ ID NO: 6 – пунктирной линией обозначена удаленная последовательность

M---------------------------NPQENFLKCFSEYIPNNPANPKFIYTQHDQLY

MSVLNSTIQNLRFTSDTTPKPLVIVTPSNVSHIQASILCSKKVGLQIRTRSGGHDAEGLS

YISQVPFAIVDLRNMHTVKVDIHSQTAWVEAGATLGEVYYWINEMNENFSFPGGYCPTVG

VGGHFSGGGYGALMRNYGLAADNIIDAHLVNVDGKVLDRKSMGEDLFWAIRGGGGENFGI

IAACKIKLVVVPSKATIFSVKKNMEIHGLVKLFNKWQNIAYKYDKDLMLTTHFRTRNITD

NHGKNKTTVHGYFSSIFLGGVDSLVDLMNKSFPELGIKKTDCKELSWIDTTIFYSGVVNY

NTANFKKEILLDRSAGKKTAFSIKLDYVKKLIPETAMVKILEKLYEEEVGVGMYVLYPYG

GIMDEISESAIPFPHRAGIMYELWYTATWEKQEDNEKHINWVRSVYNFTTPYVSQNPRLA

YLNYRDLDLGKTNPESPNNYTQARIWGEKYFGKNFNRLVKVKTKADPNNFFRNEQSIPPL

PPRHH

SEQ ID NO: 7

Расчетный N-терминальный сигнальный пептид:

MNCSTFSFWFVCKIIFFFLSFNIQISIA

Пример 5

Оптимизированные по кодону последовательности были получены для E. coli и дрожжей.

Оптимизированная последовательность E.coli

ATGAACTGCT CGACATTTAG TTTTTGGTTT GTGTGCAAGA TCATTTTTTT TTTTCTTTCG TTTAACATTC AGATTAGTAT TGCAAACCCG CAGGAGAACT TTCTCAAATG TTTTAGCGAA TATATCCCGA ACAACCCGGC CAACCCGAAA TTCATTTACA CACAACACGA TCAACTGTAC ATGAGCGTAT TGAACAGCAC CATCCAGAAT TTGCGCTTTA CTTCGGACAC AACGCCGAAG CCTCTGGTCA TCGTTACGCC CTCGAATGTT TCACATATCC AAGCGTCAAT TCTTTGTTCT AAAAAGGTCG GCCTGCAGAT TCGCACACGG TCGGGCGGCC ATGATGCCGA AGGTCTGTCT TACATCTCAC AAGTCCCTTT CGCAATCGTT GATTTGCGGA ACATGCACAC TGTAAAAGTT GATATTCACT CACAAACCGC TTGGGTCGAA GCAGGTGCCA CGCTTGGGGA AGTATATTAC TGGATTAACG AAATGAACGA GAATTTCTCG TTTCCAGGCG GTTACTGCCC AACCGTAGGT GTGGGCGGTC ATTTTTCCGG AGGCGGTTAT GGTGCGTTAA TGCGCAACTA TGGCCTGGCG GCAGACAATA TTATTGATGC CCACCTCGTT AATGTGGATG GTAAAGTACT GGATCGCAAA TCAATGGGTG AAGACCTCTT CTGGGCGATT CGTGGTGGGG GTGGCGAGAA CTTTGGTATC ATCGCGGCAT GTAAGATCAA GCTGGTGGTA GTTCCGTCTA AAGCGACCAT CTTTAGCGTG AAAAAAAACA TGGAGATTCA CGGCCTGGTA AAATTGTTCA ACAAATGGCA GAACATCGCT TACAAATACG ACAAAGATCT GATGTTAACG ACTCACTTCC GCACCCGTAA CATTACTGAC AATCACGGCA AAAATAAGAC TACTGTGCAT GGTTACTTTA GTAGTATCTT CCTGGGTGGA GTCGATTCCC TGGTCGATTT AATGAACAAG AGCTTTCCGG AGCTGGGGAT TAAAAAAACC GACTGTAAAG AGCTGAGTTG GATCGACACG ACGATCTTCT ACAGCGGAGT AGTCAACTAC AACACTGCCA ACTTTAAGAA AGAAATTCTG CTGGACCGCA GCGCAGGTAA AAAGACCGCC TTCTCCATCA AACTGGATTA CGTCAAAAAG CTGATTCCGG AAACAGCAAT GGTAAAGATT CTGGAAAAAC TGTATGAAGA AGAGGTTGGC GTTGGCATGT ATGTCTTATA TCCGTATGGG GGCATTATGG ATGAAATTTC TGAAAGTGCT ATTCCCTTCC CACACCGCGC GGGGATTATG TACGAACTGT GGTATACGGC CACGTGGGAA AAACAAGAGG ACAATGAGAA ACACATCAAC TGGGTTCGGT CAGTATATAA CTTTACCACC CCGTATGTCT CGCAGAACCC GCGTCTGGCG TATCTGAACT ATCGCGATCT TGATTTGGGT AAAACCAATC CGGAAAGCCC GAATAACTAC ACCCAGGCAC GCATTTGGGG GGAAAAATAT TTCGGGAAAA ACTTCAACCG GCTGGTGAAG GTGAAAACGA AGGCTGACCC GAATAACTTT TTTCGGAATG AACAAAGCAT TCCGCCGTTA CCGCCGCGCC ACCAC SEQ ID NO: 8)

Оптимизированная последовательность E. coli имеет на 75% идентичность последовательностей относительно SEQ ID NO: 1

Оптимизированная последовательность Saccharomyces (дрожжи)

ATGAATTGTA GTACTTTCTC TTTCTGGTTT GTTTGTAAGA TTATATTTTT TTTTCTTAGT TTCAATATAC AAATTTCAAT TGCAAACCCT CAAGAAAATT TCCTTAAGTG CTTTTCAGAA TATATCCCTA ATAATCCTGC AAACCCTAAA TTCATTTATA CACAACATGA TCAGTTATAT ATGTCTGTCT TAAACTCTAC CATTCAAAAT TTGAGGTTCA CGTCTGATAC AACCCCAAAG CCTTTAGTTA TCGTGACACC CTCTAACGTT AGTCATATTC AGGCTAGTAT CTTATGTTCA AAAAAAGTGG GTTTACAAAT CAGAACTAGG TCTGGTGGTC ATGACGCGGA AGGTCTGTCT TACATATCTC AGGTGCCGTT TGCAATCGTT GATCTACGTA ATATGCATAC AGTTAAAGTC GATATTCACT CTCAAACTGC ATGGGTCGAG GCTGGTGCCA CTCTAGGTGA AGTTTATTAC TGGATCAATG AAATGAACGA GAATTTTTCC TTCCCAGGTG GTTATTGTCC TACTGTGGGT GTAGGCGGAC ACTTTTCTGG CGGGGGGTAT GGTGCTTTGA TGAGGAACTA TGGTTTGGCC GCCGATAATA TAATTGACGC CCATCTTGTA AACGTCGACG GGAAGGTTCT GGACCGTAAA TCTATGGGTG AAGATTTATT CTGGGCGATA AGAGGTGGCG GGGGAGAGAA CTTTGGTATT ATCGCAGCTT GTAAGATTAA GTTAGTTGTT GTCCCCTCAA AAGCAACAAT TTTTTCAGTG AAGAAGAACA TGGAAATCCA CGGTTTGGTA AAACTGTTTA ATAAATGGCA GAATATTGCC TACAAATACG ATAAGGATTT GATGTTGACA ACACATTTCA GAACTAGAAA TATTACTGAC AACCACGGAA AGAACAAGAC AACCGTCCAT GGATATTTTA GTTCTATTTT CTTAGGCGGA GTTGATTCAC TAGTAGACTT AATGAACAAG TCTTTCCCCG AATTGGGAAT AAAAAAAACC GATTGCAAGG AATTATCCTG GATAGATACA ACAATATTCT ACTCTGGAGT CGTTAATTAT AATACGGCCA ACTTTAAGAA GGAAATATTA TTAGATCGTT CCGCAGGTAA AAAGACAGCT TTTTCCATAA AATTGGACTA CGTCAAAAAA TTAATTCCTG AGACAGCCAT GGTAAAAATA TTGGAAAAAT TGTACGAAGA GGAGGTAGGC GTGGGTATGT ATGTGTTATA CCCATACGGT GGTATTATGG ATGAAATTTC TGAGAGCGCT ATTCCCTTCC CCCATCGTGC AGGTATAATG TATGAATTAT GGTACACAGC AACATGGGAA AAACAAGAGG ATAACGAAAA GCATATTAAT TGGGTACGTA GTGTGTACAA CTTTACGACA CCTTACGTGT CCCAAAATCC AAGATTAGCG TATTTGAACT ATAGAGACTT AGATTTAGGT AAAACAAACC CTGAGTCTCC AAATAATTAC ACCCAAGCCA GGATTTGGGG TGAAAAATAC TTCGGCAAAA ATTTCAATAG ATTGGTTAAG GTAAAAACTA AGGCGGATCC AAACAATTTT TTTAGAAATG AGCAGAGTAT TCCGCCCCTG CCTCCAAGAC ACCAT (SEQ ID NO: 9)

Оптимизированная последовательность дрожжей имеет на 78% идентичность последовательностей относительно SEQ ID NO: 1.

Другие преимущества, которые свойственны такой структуре, очевидны для специалиста в данной области техники. Варианты осуществления, описанные здесь иллюстративны и не несут ограничительного характера в отношении объёма заявленного изобретения. Изменения вышеуказанных вариантов осуществления будут очевидны для специалистов в данной области техники и описаны изобретателем в рамках объёма прилагаемой формулы изобретения.

Список литературы:

Alvarez JP, Pekker I, Goldshmidt A, Blum E, Amsellem Z, Eshed Y (2006) Endogenous and synthetic microRNAs stimulate simultaneous, efficient, and localized regulation of multiple targets in diverse species. Plant Cell 18:1134-51.

van Bakel, H., Stout, J. M., Cote, A. G., Tallon, C. M., Sharpe, A. G., Hughes, T. R., & Page, J. E. (2011). The draft genome and transcriptome of Cannabis sativa. Genome Biology, 12(10), R102.

Bechtold N, Ellis J, Pelletier G (1993) In planta Agrobacterium-mediated gene transfer by infiltration of adult Arabidopsis thaliana plants. C R Acad Sci Paris, Sciences de la vie/Life sciences 316: 1194-1199.

Becker D, Brettschneider R, Lorz H (1994) Fertile transgenic wheat from microprojectile bombardment of scutellar tissue. Plant J. 5: 299-307.

Bourrie, M (2003) Hemp: A Short History of the Most Misunderstood Plant and Its Uses and Abuses (Key Porter, Toronto).

Collakova E, DellaPenna D (2001) Isolation and functional analysis of homogentisate phytyltransferase from Synechocystis sp. PCC 6803 and Arabidopsis. Plant Physiol 127: 1113-1124.

Datla R, Anderson JW, Selvaraj G (1997) Plant promoters for transgene expression. Biotechnology Annual Review 3: 269-296.

Davis, W. M., & Hatoum, N. S. (1983). Neurobehavioral actions of cannabichromene and interactions with delta 9-tetrahydrocannabinol. General Pharmacology, 14(2), 247–52.

DeBlock M, DeBrouwer D, Tenning P (1989) Transformation of Brassica napus and Brassica oleracea using Agrobacterium tumefaciens and the expression of the bar and neo genes in the transgenic plants. Plant Physiol. 91: 694-701.

DeLong, G. T., Wolf, C. E., Poklis, A., & Lichtman, A. H. (2010). Pharmacological evaluation of the natural constituent of Cannabis sativa, cannabichromene and its modulation by Δ(9)-tetrahydrocannabinol. Drug and Alcohol Dependence, 112(1-2), 126–33.

Depicker A, Montagu MV (1997) Post-transcriptional gene silencing in plants. Curr Opin Cell Biol. 9: 373-82.

Elsohly, M. A., & Slade, D. (2005). Chemical constituents of marijuana: the complex mixture of natural cannabinoids. Life Sciences, 78(5), 539–48.

Feeney M and ZK Punja (2003) Tissue culture and Agrobacterium-mediated transformation of Hemp (Cannabis sativa L.) In Vitro Cell Dev Biol-Plant 39:578-585

Fellermeier M, Zenk MH. (1998) Prenylation of olivetolate by a hemp transferase yields cannabigerolic acid, the precursor of tetrahydrocannabinol. FEBS Letters. 427: 283-285.

Fernandez-Valverde, M., Reglero, A., Martinez-Blanco, H., & Luengo, J. M. (1993). Purification of Pseudomonas putida acyl coenzyme A ligase active with a range of aliphatic and aromatic substrates. Appl. Envir. Microbiol., 59(4), 1149–1154.

Gagne, S. J., Stout, J. M., Liu, E., Boubakir, Z., Clark, S. M., & Page, J. E. (2012). Identification of olivetolic acid cyclase from Cannabis sativa reveals a unique catalytic route to plant polyketides. Proceedings of the National Academy of Sciences of the United States of America, 109(31), 12811–6.

Helliwell CA, Waterhouse PM (2005) Constructs and methods for hairpin RNA-mediated gene silencing in plants. Methods Enzymology 392:24-35.

Izzo, A. A., Capasso, R., Aviello, G., Borrelli, F., Romano, B., Piscitelli, F., … Di Marzo, V. (2012). Inhibitory effect of cannabichromene, a major non-psychotropic cannabinoid extracted from Cannabis sativa, on inflammation-induced hypermotility in mice. British Journal of Pharmacology, 166(4), 1444–60.

Henikoff S, Till BJ, Comai L (2004) TILLING. Traditional mutagenesis meets functional genomics. Plant Physiol 135:630-6.

Katavic V, Haughn GW, Reed D, Martin M, Kunst L (1994) In planta transformation of Arabidopsis thaliana. Mol. Gen. Genet. 245: 363-370.

Katsuyama Y, Funa N, Miyahisa I, Horinouchi S (2007) Synthesis of unnatural flavonoids and stilbenes by exploiting the plant biosynthetic pathway in Escherichia coli. Chem Biol. 14(6): 613-21.

Kichikai K, Taura F, Morimoto S, Masayama Y. (2001) Japanese Patent Publication 2001-029082 published February 6, 2001.

Kojoma M, Seki H Yoshida S Muranaka T (2006) DNA polymorphisms in the THCA synthase gene in “drug-type” and “figer-type” Cannabis sativa L. Forensic Sci Int 159:132-40.

Leonard E, Yan Y, Fowler ZL, Li Z, Lim CG, Lim KH, Koffas MA (12 Mar 2008) Strain Improvement of Recombinant Escherichia coli for Efficient Production of Plant Flavonoids. Mol Pharm. [Epub ahead of print] PMID: 18333619 [PubMed - as supplied by publisher].

Ligresti, A., Moriello, A. S., Starowicz, K., Matias, I., Pisanti, S., De Petrocellis, L., … Di Marzo, V. (2006). Antitumor activity of plant cannabinoids with emphasis on the effect of cannabidiol on human breast carcinoma. Journal of Pharmacology and Experimental Therapeutics, 318(3), 1375–87. doi:10.1124/jpet.106.105247

Maione, S., Piscitelli, F., Gatta, L., Vita, D., De Petrocellis, L., Palazzo, E., … Di Marzo, V. (2011). Non-psychoactive cannabinoids modulate the descending pathway of antinociception in anaesthetized rats through several mechanisms of action. British Journal of Pharmacology, 162(3), 584–96. doi:10.1111/j.1476-5381.2010.01063.x

Meyer P (1995) Understanding and controlling transgene expression. Trends in Biotechnology, 13: 332-337.

Moloney MM, Walker JM, Sharma KK (1989) High efficiency transformation of Brassica napus using Agrobacterium vectors. Plant Cell Rep. 8: 238-242.

Morimoto S, Komatsu K, Taura F, Shoyama,Y. (1998) Purification and characterization of cannabichromenic acid synthase from Cannabis sativa. Phytochemistry. 49: 1525-1529.

Nehra NS, Chibbar RN, Leung N, Caswell K, Mallard C, Steinhauer L, Baga M, Kartha KK (1994) Self-fertile transgenic wheat plants regenerated from isolated scutellar tissues following microprojectile bombardment with two distinct gene constructs. Plant J. 5: 285-297.

Ohyanagi H, Tanaka T, Sakai H, Shigemoto Y, Yamaguchi K,Habara T, Fujii Y, Antonio BA, Nagamura Y, Imanishi T, Ikeo K, Itoh T, Gojobori T, Sasaki T. (2008) GenBank Accession NP_001060083.

Page JE, Nagel J (2006) Biosynthesis of terpenophenolics in hop and cannabis. In JT Romeo, ed, Integrative Plant Biochemistry, Vol. 40. Elsevier, Oxford, pp 179-210.

R. G. Pertwee, R. G. Pertwee, Cannabinoids R. G. Pertwee, Ed. (Springer-Verlag, Berlin/Heidelberg, 2005), pp. 1–51–51.

Potrykus I (1991) Gene transfer to plants: Assessment of published approaches and results. Annu. Rev. Plant Physiol. Plant Mol. Biol. 42: 205-225.

Pouwels et al., Cloning Vectors. A Laboratory Manual, Elsevier, Amsterdam (1986).

Ralston L, Subramanian S, Matsuno M, Yu O (2005) Partial reconstruction of flavonoid and isoflavonoid biosynthesis in yeast using soybean type I and type II chalcone isomerases. Plant Physiol. 137(4): 1375-88.

Rhodes CA, Pierce DA, Mettler IJ, Mascarenhas D, Detmer JJ (1988) Genetically transformed maize plants from protoplasts. Science 240: 204-207.

Romano, B., Borrelli, F., Fasolino, I., Capasso, R., Piscitelli, F., Cascio, M., … Izzo, A. (2013). The cannabinoid TRPA1 agonist cannabichromene inhibits nitric oxide production in macrophages and ameliorates murine colitis. British Journal of Pharmacology, 169(1), 213–29.

Sambrook et al, Molecular Cloning: A Laboratory Manual, Third Edition, Cold Spring Harbor, N.Y. (2001).

Sanford JC, Klein TM, Wolf ED, Allen N (1987) Delivery of substances into cells and tissues using a particle bombardment process. J. Part. Sci. Technol. 5: 27-37.

Schneider, K., Kienow, L., Schmelzer, E., Colby, T., Bartsch, M., Miersch, O., … Stuible, H.-P. (2005). A new type of peroxisomal acyl-coenzyme A synthetase from Arabidopsis thaliana Has the Catalytic Capacity to Activate Biosynthetic Precursors of Jasmonic Acid 10.1074/jbc.M413578200. Journal of Biological Chemistry, 280(14), 13962–13972.

Schwab R, Ossowski S, Riester M, Warthmann N, Weigel D (2006) Highly specific gene silencing by artificial microRNAs in Arabidopsis. Plant Cell 18:1121-33.

Shimamoto K, Terada R, Izawa T, Fujimoto H (1989) Fertile transgenic rice plants regenerated from transformed protoplasts. Nature 338: 274-276.

Shockey, J. M., Fulda, M. S., & Browse, J. (2003). Arabidopsis Contains a Large Superfamily of Acyl-Activating Enzymes . Phylogenetic and Acyl-Coenzyme A Synthetases. Plant Physiol., 132(June), 1065–1076.

Shoyama Y, Hirano H, Nishioka I. (1984) Biosynthesis of propyl cannabinoid acid and its biosynthetic relationship with pentyl and methyl cannabinoid acids. Phytochemistry. 23(9): 1909-1912.

Sirikantaramas S, Morimoto S, Shoyama Y, Ishikawa Y, Wada Y, Shoyama Y, Taura F. (2004) The gene controlling marijuana psychoactivity: molecular cloning and heterologous expression of Delta1-tetrahydrocannabinolic acid synthase from Cannabis sativa L. J Biol Chem. 279: 39767-39774.

Sirikantaramas S, Taura F, Tanaka Y, Ishikawa Y, Morimoto S, Shoyama Y. (2005) Tetrahydrocannabinolic acid synthase, the enzyme controlling marijuana psychoactivity, is secreted into the storage cavity of the glandular trichomes. Plant Cell Physiol. 46: 1578-1582.

Songstad DD, Somers DA, Griesbach RJ (1995) Advances in alternative DNA delivery techniques. Plant Cell, Tissue and Organ Culture 40:1-15.

Stam M, de Bruin R, van Blokland R, van der Hoorn RA, Mol JN, Kooter JM (2000) Distinct features of post-transcriptional gene silencing by antisense transgenes in single copy and inverted T-DNA repeat loci. Plant J. 21:27-42.

Stout, J. M., Boubakir, Z., Ambrose, S. J., Purves, R. W., & Page, J. E. (2012). The hexanoyl-CoA precursor for cannabinoid biosynthesis is formed by an acyl-activating enzyme in Cannabis sativa trichomes. Plant J. 71(3): 353–65.

Taura F, Morimoto S, Shoyama Y. (1996) Purification and characterization of cannabidiolic-acid synthase from Cannabis sativa L. Biochemical analysis of a novel enzyme that catalyzes the oxidocyclization of cannabigerolic acid to cannabidiolic acid. J Biol Chem. 271: 17411-17416.

Taura F, Morimoto S, Shoyama Y, Mechoulam R. (1995) First direct evidence for the mechanism of 1-tetrahydrocannabinolic acid biosynthesis. Journal of the American Chemical Society. 117: 9766-9767.

Taura F, Matsushita H, Morimoto S, Masayama Y. (2000) Japanese Patent Publication 2000-078979 published March 21, 2000.

Taura F, Sirikantaramas S, Shoyama Y, Yoshikai K, Shoyama Y, Morimoto S. (2007) Cannabidiolic-acid synthase, the chemotype-determining enzyme in the fiber-type Cannabis sativa. FEBS Lett. 581: 2929-2934.

Taura F, Tanaka S, Taguchi C, Fukamizu T, Tanaka H, Shoyama Y, Morimoto, S. (2009) Characterization of olivetol synthase, a polyketide synthase putatively involved in cannabinoid biosynthetic pathway. FEBS Lett. 583: 2061-2066.

Vasil I K (1994) Molecular improvement of cereals. Plant Mol. Biol. 25: 925-937.

Veress T, Szanto J.I. and Leisztner, L (1990) Determination of cannabinoid acids by high performance liquied chromatography of their neutral derivatives formed by thermal decarboxylation. J. of Chromatography, 520:339-347

Walden R, Wingender R (1995) Gene-transfer and plant regeneration techniques. Trends in Biotechnology 13: 324-331.

Ware, M. A., Wang, T., Shapiro, S., Robinson, A., Ducruet, T., Huynh, T., … Collet, J.-P. (2010). Smoked cannabis for chronic neuropathic pain: a randomized controlled trial. CMAJ : Canadian Medical Association Journal = Journal de l’Association Medicale Canadienne, 182(14), E694–701.

Wirth, P. W., Watson, E. S., ElSohly, M. A., Seidel, R., Murphy, J. C., & Turner, C. E. (1980). Anti-inflammatory activity of cannabichromene homologs. Journal of Pharmaceutical Sciences, 69(11), 1359–60.

Zhang H, Wang Y, Pfeifer BA (31 Jan 2008) Bacterial hosts for natural product production. Mol Pharm. [Epub ahead of print] PMID: 18232637 [PubMed - as supplied by publisher].

1. Изолированная молекула нуклеиновой кислоты, содержащая:

i) нуклеотидную последовательность, кодирующую полипептид, обладающий активностью синтазы каннабихроменовой кислоты с последовательностью SEQ ID NO: 2 или 6, или полипептид, имеющий по меньшей мере на 96% идентичную SEQ ID NO: 2 или 6 последовательность, или;

ii) нуклеотидную последовательность, идентичную, по меньшей мере, более чем на 96% последовательности SEQ ID NO: 1, 5 или 8, или 9 и кодирующую полипептид, обладающий активностью синтазы каннабихроменовой кислоты.

2. Изолированная молекула нуклеиновой кислоты по п.1, отличающаяся тем, что она содержит

i) нуклеотидную последовательность, кодирующую полипептид, имеющий по меньшей мере на 99,3% идентичную SEQ ID NO: 2 или 6 последовательность; или

ii) нуклеотидную последовательность, по меньшей мере на 99,5% идентичную SEQ ID NO: 1 или 5; или

iii) нуклеотидную последовательность, по меньшей мере на 96% идентичную SEQ ID NO: 8 или 9 и кодирующую полипептид, обладающий активностью синтазы каннабихроменовой кислоты.

3. Изолированная молекула нуклеиновой кислоты по п.1 или 2, отличающаяся тем, что нуклеотидная последовательность, по меньшей мере, более чем на 96% идентична последовательности SEQ ID NO: 1 или 5 и кодирует полипептид, обладающий активностью синтазы каннабихроменовой кислоты.

4. Изолированная молекула нуклеиновой кислоты по любому из пп.1-3, отличающаяся тем, что нуклеотидная последовательность является такой, как указано в SEQ ID NO: 1 или 5, или её нуклеотидная последовательность кодируется вырожденным кодоном, при этом необязательно, что нуклеотидная последовательность, кодированная вырожденным кодоном, содержит такую последовательность, как указано в SEQ ID NO: 8 или 9.

5. Изолированная молекула нуклеиновой кислоты по пп. 1-4, отличающаяся тем, что она связана с одним или более гетерологичным фрагментом нуклеиновой кислоты, дополнительно с одним или более линкером, сигнальной последовательностью, распознаваемой меткой или маркером, таким как маркер очистки.

6. Изолированный полипептид, обладающий активностью синтазы каннабихроменовой кислоты, содержащий аминокислотную последовательность, идентичную SEQ ID NO: 2 или 6, целиком или ее фрагменту по меньшей мере на 96%.

7. Изолированный полипептид по п.6, отличающийся тем, что аминокислотная последовательность является такой, как установлено в SEQ ID NO: 2 или 6.

8. Изолированный полипептид по пп.6, 7, отличающийся тем, что он связан с одним или более гетерологичным фрагментом, дополнительно с одним или более линкером, сигнальной последовательностью, распознаваемой меткой или маркером, таким как маркер очистки.

9. Экспрессирующий конструкт для экспрессии полипептида, обладающего активностью синтазы каннабихроменовой кислоты, отличающийся тем, что содержит молекулу нуклеиновой кислоты по пп. 2-4.

10. Экспрессирующая система in vitro для экспрессии полипептида, обладающего активностью синтазы каннабихроменовой кислоты, отличающаяся тем, что она содержит молекулу нуклеиновой кислоты по пп. 1-4.

11. Организм для получения полипептида c активностью синтазы каннабихроменовой кислоты, отличающийся тем, что он содержит изолированную молекулу нуклеиновой кислоты по пп.1-4, или конструкт по п.9, или экспрессирующую систему по п.10, и/или экспрессирует изолированный полипептид по пп. 6-8, при этом организм представляет собой растение, микроорганизм или насекомое.

12. Организм по п.11, отличающийся тем, что он представляет собой микроорганизм.

13. Организм по п.12, отличающийся тем, что он представляет собой дрожжи или E.coli.

14. Клетка для получения полипептида c активностью синтазы каннабихроменовой кислоты, отличающаяся тем, что она содержит изолированную молекулу нуклеиновой кислоты или любую из пп. 1-4, или конструкт по п. 9, или экспрессирующую систему по п. 10 и/или экспрессирует изолированный полипептид по пп. 6-8, при этом клетка принадлежит растению, микроорганизму или насекомому.

15. Ткань для получения полипептида c активностью синтазы каннабихроменовой кислоты, отличающаяся тем, что она содержит изолированную молекулу нуклеиновой кислоты или любую из пп. 1-4, или конструкт по п. 9, или экспрессирующую систему по п. 10 и/или экспрессирует изолированный полипептид по пп. 6-8, при этом ткань принадлежит растению или насекомому.

16. Способ повышения уровня каннабиноидных соединений в организме, клетке или ткани, отличающийся тем, что он содержит введение и экспрессию или сверхэкспрессию молекулы нуклеиновой кислоты по пп. 1-4, или конструкт по п. 9, или экспрессирующую систему по п. 10, в организм, клетку или ткань для повышения уровня каннабиноидного соединения, при этом организмом является растение, микроорганизм или насекомое, клетка принадлежит растению, микроорганизму или насекомому, и ткань принадлежит растению или насекомому.

17. Способ по п.16, отличающийся тем, что организм представляет собой микроорганизм.

18. Способ по п.17, отличающийся тем, что микроорганизм представляет собой дрожжи или E.coli.

19. Способ по п.16, отличающийся тем, что молекула нуклеиновой кислоты экспрессируется или сверхэкспрессируется в сочетании с экспрессией или сверхэкспрессией одной или нескольких других нуклеиновых кислот, которые кодируют один или несколько ферментов на пути биосинтетического метаболизма каннабиноида.

20. Способ по п.19, отличающийся тем, что один или несколько ферментов на пути биосинтетического метаболизма каннабиноида - это одно или несколько из перечисленного: гексаноил-СоА синтетаза, циклаза оливетоловой кислоты, синтаза ТГКК, синтаза КБДК или ароматическая пренилтрансфераза PT1.

21. Способ по любому из пп. 16-20, отличающийся тем, что один или несколько каннабиноидов являются каннабигероловой кислотой, каннабигеролом, Δ9-тетрагидроканнабиноловой кислотой, каннабидиоловой кислотой, каннабихроменовой кислотой, Δ9-тетрагидроканнабинолом, каннабидиолом, каннабихроменом и каннабидиолом или вариантами этих соединений, имеющих метиловые или пропиловые боковые цепочки.

22. Композиция для повышения уровня каннабиноидных соединений в организме, клетке или ткани, отличающаяся тем, что она содержит (а) изолированную молекулу нуклеиновой кислоты по пп. 1-4; (b) изолированный полипептид по п. 6 или 7, (с) конструкт по п. 9 или (d) экспрессирующую систему по п. 10 и носитель, при этом организмом является растение, микроорганизм или насекомое, клетка принадлежит растению, микроорганизму или насекомому, и ткань принадлежит растению или насекомому.



 

Похожие патенты:

Патент ru2708144

Наверх