Лекарственное средство, содержащее антитело к фосфолипазе d4

Изобретение относится к области биохимии, в частности к моноклональному антителу или фрагменту антитела, содержащему его антигенсвязывающий участок, которое связывается с белком фосфолипазы D4 (PLD4), а также его применению для лечения или профилактики заболевания, вызванного активированными В-клетками, для супрессии активированных В-клеток, а также для лечения заболевания, вызванного активированными В-клетками. Также раскрыт способ обнаружения активированных В-клеток, а также реагент для обнаружения активированных В-клеток, содержащий вышеуказанное антитело или его фрагмент. Изобретение также относится к in vitro способу супрессии активированных В-клеток, включающему применение антитела, связывающего с PLD4, или его фрагмента. Изобретение позволяет эффективно осуществлять лечение или профилактику заболевания, вызванного активированными В-клетками. 8 н. и 8 з.п. ф-лы, 7 ил., 4 пр.

 

[Область техники]

[0001]

Настоящее изобретение относится к применению антитела, которое связывается с фосфолипазой D4. Далее "фосфолипаза D" может сокращенно обозначаться как PLD и "фосфолипаза D4" и тому подобное, может сокращенно обозначаться как PLD4 и тому подобное.

[Уровень техники]

[0002]

PLD представляет собой фермент, который катализирует реакцию продуцирования фосфатидной кислоты и холина путем гидролиза фосфатидилхолина, и вызывает передачу различных внутриклеточных сигналов. Полагают, что продуцируемая фосфатидная кислота функционирует в качестве липидной сигнальной молекулы.

PLD1 и PLD2 были известны как два типа PLD млекопитающих, которые были ранее известны, и содержат фосфатидилинозитид-связывающий Phox-гомологичный домен (домен РХ) и фосфатидилинозитид-связывающий плекстрин-гомологичный домен (домен PH) в своей N-концевой области. Оба домена участвуют в мембранной локализации PLD.

PLD1 и PLD2 дополнительно содержат две последовательности His-х-Lys-хххх-Asp (мотивы HKD). Мотивы HKD являются основными доменами для активности PLD.

Фосфатидная кислота, продуцируемая с помощью PLD1 и PLD2, предположительно принимает участие в реконструкции цитоскелета, экзоцитозе, фагоцитозе, концентрации, клеточной адгезии, хемотаксисе и тому подобное, и оказывает, главным образом, воздействие на нервные системы, иммунные системы и тому подобное.

[0003]

Человеческий Hu-K4 и мышиный SAM9, которые в настоящее время официально называются PLD3, лишены доменов PX и PH, и не демонстрируют активность PLD, несмотря на наличие двух мотивов HKD. Хотя существуют еще три члена семейства PLD, PLD4, PLD5 и PLD6, было немного известно об этих неклассических PLD.

[0004]

В результате поиска набора экспрессирующихся генов в развитии мозжечка мыши в Cerebellar Development Transcriptome Database (CDT-DB), был определен продукт транскрипции, PLD4, контролируемый в процессе развития (см. непатентный документ 1). Об основных характеристиках PLD4 не сообщались. Ферментативная активность PLD4, с или без гликозилирования, должна быть определена.

[0005]

PLD4 имеет последовательность из 506 аминокислот, показанную в SEQ ID NO: 1, и кодируется последовательностью оснований кДНК SEQ ID NO: 44 (непатентная литература 1 и 2). Белок PLD4 имеет две предполагаемые области PDE (мотивы фосфодиэстеразы), состоящие из двух консервативных мотивов HKD (His-X-Lys-хххх-Asp аминокислотной последовательности, Х представляет собой другие аминокислоты) в С-концевой области, и предполагаемый сайт фосфорилирования (Тре 472). Структура белка PLD4 оценивается как трансмембранный белок типа II. Кроме того, PLD4 не имеет домены PX и PH в N-концевой области, при этом PLD1 и PLD2 в семействе классической PLD имеют их.

С другой стороны, ввиду наличия двух мотивов HKD, PLD4 принадлежит к семейству PLD, но не имеет домен PX и домен PH, но, между тем, имеет предполагаемый трансмембранный домен (непатентная литература 3).

[0006]

Экспрессия мРНК PLD4 была обнаружена в диапазоне от низких до средних уровнях малых кластеров клеток, преимущественно локализованных вокруг областей белого вещества, включая мозолистое тело и белое вещество мозжечка у 1-недельных мышей. Эти PLD4 мРНК-экспрессирующие клетки были идентифицированы как Iba1-положительная микроглия (непатентная литература 3). Тем не менее, PLD4-положительные клетки диспергированы в мозжечке мыши 10-дневных мышей. Это предполагает, что в начале постнатального развития в мозжечке мыши экспрессия PLD4 временно ограничена.

Образование миелина у мышей начинается в мозолистом теле и белом вещества мозжечка в течение одной недели после рождения. При этом PLD4 высоко экспрессируется в амебоидной (активированное состояние) микроглии, присутсвующей в белом веществе, и, таким образом, также полагают, что существует возможность того, что при этом PLD4-экспрессирующие клетки в белом веществе участвуют в образовании миелина. В частности, также было обнаружено, что PLD4 накапливается в пищевых вакуолях, и было сделано предположение, что существует вероятность участия PLD4 в фагоцитозе. В амебоидной микроглии, которая находится в активированном состоянии, секретируются различные цитокины и факторы роста, и одновременно активируется фагоцитоз. Полагают, что в белом веществе головного мозга мыши в период развития избыточное количество олигодендроцитов (глиальные клетки центральной нервной системы, которые образуют миелин, обертываясь вокруг аксонов) подвергается апоптозу. Вероятно, что олигодендроциты распадаются и удаляются в амебоидной микроглии для секреции сигнальных молекул и, таким образом, регулируется среда, образующая миелин, в белом веществе. Было сделано предположение, что PLD4 участвует в этих процессах, включая образование миелина.

[0007]

Экспрессия мышиного PLD4 мРНК наблюдается также в ненейрональных тканях и наблюдается, в основном, в селезенке. Сильная экспрессия белка PLD4 обнаруживается вокруг маргинальной зоны красной пульпы селезенки, и белок селезенки PLD4, отбираемый из фракций субклеточных мембранных, является высоко N-гликозилированным. В случае, когда PLD4 экспрессирован в гетерологичной клеточной системе, PLD4 локализован в эндоплазматическом ретикулюме и комплексе Гольджи. Гетерологично экспрессированный PLD4 не показывают ферментную активность PLD. (непатентная литература 3).

Из профиля экспрессии PLD4, который ограничен в пространстве и во времени, было сделано предположение, что PLD4 может играть роль в общих функциях в микроглии и клетках маргинальной зоны селезенки на раннем этапе постнатального развития головного мозга.

[0008]

С другой стороны, авторы настоящего изобретения обнаружили, что PLD4 специфично экспрессирован в высокой степени в pDC (плазмоцитоидные дендритные клетки) в период покоя (pDC в состоянии “покоя”) (патентная литература 1). Авторы настоящего изобретения дополнительно сообщают, что PLD4-специфическое антитело может быть использовано для подавления активности PDC.

[0009]

Кроме того, сообщалось об PLD4, как об одном из новых генов предрасположенности к системному склерозу у японцев (Systemic Sclerosis in Japanese) (непатентная литература 4). Однако, в результате аналогичного исследования, проведенного в Европе, не было обнаружено значительной корреляции с PLD4, и не были получены серьезные результаты, показывающие связь между PLD4 и аутоиммунными заболеваниями, такими как системный склероз.

[0010]

Иммунный механизм классифицируются приблизительно на две группы. Одна из них представляет "генетически предетерминированный иммунитет (наследственный иммунитет)", который обнаруживает чужеродные субстанции, такие как патогены, и осуществляет первичную атаку, а другая представляет "приобретенный иммунитет" посредством информационного взаимодействия, которое является презентированием антигенных пептидов и тому подобное, полученных из чужеродных субстанций. Нейтрофилы, макрофаги, дендритные клетки (DC), NK-клетки (естественные киллеры) и т.п. участвуют в основном в "генетически предетерминированном иммунитете", и Т-клетки и В-клетки, к которым передается информация антигенных пептидов и т.п., представленных выше указанными дендритными клетками и т.п., вовлечены в "приобретенной иммунитет". Т-клетки, активированные передачей информации антигенных пептидов, способны специфически распознавать и атаковать патогенные микроорганизмы непосредственно в качестве клеточно-опосредованного иммунитета, и В-клетки, активированные аналогичным образом, как описано выше, способны специфически распознавать и атаковать патогены косвенно, продуцируя антитела (гуморальный иммунитет).

[0011]

В "естественном иммунитете", патоген-ассоциированные молекулярные паттерны (PAMPs), повсеместно присутствующие в патогенах (LPS, CpG-ДНК, липопротеиды, РНК и т.д.), распознаются Toll-подобными рецепторами (TLR), и секреция воспалительных цитокинов активируется NF-KB, или секреция интерферона (IFN) активируется IRF (интерферон регулирующий фактор). TLR приблизительно классифицируются на две группы по сайтам субклеточной локализации: группа, экспрессированная на поверхности клеток, и группа, экспрессированная в эндосомах и эндоплазматическом ретикулуме (ER). В pDC, IRF7 активируется через TLR7 и TLR9, локализованный в эндосомах и эндоплазматическом ретикулуме, для вызывания продукции IFN-α. Было сделано предположение, что причиной, по которой эти TLR не экспрессированы не в клетках, а на поверхности клеток, является снижение риска возникновения аутоиммунных заболеваний. TLR7 и TLR9 распознают одноцепочечную РНК и ДНК, соответственно, в качестве лиганда. Не только чужеродные патогенные бактерии, но также и хозяин содержат эти нуклеиновые кислоты, и таким образом было сделано предположение, что рецепторы, распознающие нуклеиновые кислоты и активирующие клетки иммунной системы, всегда индуцируют аутоиммунные заболевания.

[0012]

С другой стороны, В-клетки (B лимфоциты), демонстрирующие важную роль в "приобретенном иммунитете", представляют собой лимфоциты, которые экспрессируют рецепторы иммуноглобулина Ig на своей поверхности. В-клетки продуцируются гемопоэтическими стволовыми клетками в костном мозге, и дифференцируются в предшественники В-клеток и незрелые В-клетки, а затем развиваются в "необученные" В-клетки (зрелые, непримированные B-клетки). Необученные В-клетки активируются не только стимуляцией указанными выше Т-клетками, но также и прямой стимуляцией антигеном, и далее становятся клетками, продуцирующими антитела, путем дифференциации и пролиферации с продуцированием и секретированием антител, таких как IgM, IgD, IgA, IgE, IgG (включая подклассы, такие как IgG1, IgG2, IgG3 IgG2b и т.п.). Было известно, что помимо В-клеточных рецепторов (BCR), распознающих специфические чужеродные антигены, указанные выше TLR экспрессируются в В-клетках. Ранее было известно, например, что LPS, который, как известно, вызывает пролиферацию и продукцию антител В-клеток, представляет собой лиганд TLR4, и вышеуказанный TLR7 и TLR9 также экспрессированы в В-клетках. Было сделано предположение, что такие лимфоциты обладают возможностью индуцировать не только вышеуказанные аутоиммунные заболевания, но и аллергические заболевания, благодаря своей способности чрезмерно продуцировать антитела.

IgG, иммуноглобулин G, представляет собой изотип антитела, состоящий из четырех пептидных цепей - двух идентичных тяжелых цепей и двух идентичных легких цепей. IgG продуцируется В-клетками и играет важную роль в адаптивном иммунитете. Необученные В-клетки, которые не продуцируют IgG, дифференцируются в плазмабласты и, в конечном итоге, в плазматические клетки. Плазмабласты и плазматические клетки могут продуцировать большое количество антител. Обычно миелоидные дендритные клетки (DC), как было показано, инициируют рост и дифференциацию B-клеток, стимулируя IL-12 и IL-6 и/или мембранными молекулами, например, BAFF/APRIL (непатентная литература 5, 6 и 7). Кроме того, плазмацитоидные DC (pDC) индуцируют созревание и дифференцировку необученных В-клеток в секретирующие антитела плазмабласты и плазматические клетки, продуцирующие IFN-α и IL-6 (непатентная литература 8). Вариабельный участок IgG захватывает различные патогены, такие как вирусы, бактерии и грибки, защищая, таким образом, организм от указанных инфекций.

SLE рассматривается в качестве классического аутоиммунного заболевания, обусловленного иммунным комплексом. Иммунные комплексы (IC) формируются в кровотоке или in situ в результате продуцирования аутоантител против нуклеиновых кислот и их ассоциированных белков, таких как двухцепочечная ДНК, рибонуклеопротеин и гистон. Такие IC вызывают воспаление с характерными для заболевания клиническими симптомами, такими как нефрит, артрит, кожные высыпания и васкулит. Кровь пациента, страдающего SLE, характеризуется сниженным количеством необученных В-клеток и повышенным количеством В-клеток памяти, плазмабластов и плазматических клеток (непатентная литература 9, 10 и 11). Таким образом, подавление дифференциации в плазматические клетки и продуцирования антител посредством манипуляции с плазмабластами, секретирующими аутореактивные антитела, обеспечит в результате перспективную стратегию лечения аутоиммунных заболеваний.

В PBMC существуют различные субпопуляции В-клеток, такие как необученные В-клетки, В-клетки памяти и плазмабласты. Большинство из подмножества В-клеток в PBMC представляет собой необученные В-клетки. Необученные B-клетки являются субпопуляцией В-клеток, которые не “встречались” с чужеродным антигеном. В-клетками памяти являются субпопуляцией В-клеток, образованных с помощью первичной инфекции и имеющих решающее значение в быстрой опосредованной антителами иммунной реакции путем дифференциации в плазмабласты. Плазмабласты являются субпопуляцией В-клеток, которые секретируют большое количество антител, и обозначаются как CD19+CD27+CD38-IgD+.

После “встречи” с чужеродным антигеном, “необученные” B-клетки становятся активированными В-клетками. Активированные В-клетки дополнительно дифференцируются в В-клетки памяти и/или также плазмабласты, которые секретируют антитела. Это изменение называется "созревание".

Созревание В-клеток происходит в несколько этапов. На начальной антиген-независимой фазе индуцируются зрелые В-клетки, которые могут связываться с уникальным антигеном. Этот этап созревания происходит в костном мозге и селезенке в живом организме. Антиген-зависимая фаза созревания В-клеток происходит после активации В-клеток антигеном связывания и дополнительной стимуляции. Эти сигналы способствуют созреванию B-клеток в любые В-клетки памяти или секретирующие антитела плазмабласты. Антиген-зависимая фаза созревания В-клеток включает пролиферацию активированных В-клеток, созревание аффинности антител и переключение класса антител. Эти созревания происходят в зародышевых центрах вторичных лимфоидных тканей.

Сообщалось, что в экспериментальных условиях in vitro pDC индуцируют созревание активированных В-клеток в Ig-секретирующие плазмабласты путем высвобождения IFN-α и IL-6. CpG2216 активирует pDC для индуцированием продукции IFN-α, и В-клетки для инициирования созревания. IFN-α, продуцируемый pDC, дополнительно поддерживает созревание активированных В-клеток в плазмабласты в присутствии IL-6.

[Перечень ссылок]

[Патентная литература]

[0013]

[PTL 1] PCT/JP2013/052781

[Непатентная литература]

[0014]

[NPL 1] Tao et al., Nat. Methods 2(8), pp 591-598 (2005)

[NPL 2] Clark et al., Genome Res. 13(10), pp 2265-2270 (2003)

[NPL 3] Plos ONE www.plosone.org, November 2010, Volume 5, Issue 11, e13932

[NPL 4] ARTHRITIS & RHEUMATISM Vol. 65, No. 2, February 2013, pp 472-480

[NPL 5] Balazs et al., 2002, Immunity, 17, 341-352

[NPL 6] Litinskiy et al., 2002, Nat Immunol, 3, 822-829

[NPL 7] MacLennan and Vinuesa, 2002, Immunity, 17, 235-238

[NPL 8] Jego et al, 2003, Immunity, 19, 225-234

[NPL 9] Odendahl et al., 2000, JI, 165, 5970-5979

[NPL 10] Arce et al., 2001, JI, 167, 2361-2369

[NPL 11] Wei et al., 2007, JI, 178, 6624-6633

[Сущность изобретения]

[Техническая задача]

[0015]

Задача, решаемая с помощью настоящего изобретения, заключается в регулировании активированных В-клеток путем связывания антитела с PLD4, а также в улучшении симптомов, вызываемых ими заболеваний.

[Решение задачи]

[0016]

В процессе исследования PLD4, авторы настоящего изобретения подтвердили, что помимо клеток pDC в период покоя, о которых сообщалось ранее, экспрессия PLD4 также индуцируется в активированных В-клетках. Поэтому авторы настоящего изобретения исследовали влияние антител PLD4 на активированные В-клетки. Способ продуцирования и очистки антител к PLD4 осуществляли методом, описанным в патентной литературе 1.

[0017]

То есть, настоящее изобретение относится к дополнительному применению с использованием описанных ниже антител к PLD4.

(1) Фармацевтическая композиция для супрессии активированных В-клеток, где фармацевтическая композиция содержит моноклональное антитело, которое связывается с белком фосфолипазы D4 (PLD4), или его фрагмент, содержащий антигенсвязывающий участок, в качестве активного ингредиента.

(2) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SYWMH (SEQ ID NO: 2) в качестве CDR1, последовательность DIYPGSDSTNYNEKFKS (SEQ ID NO: 3) в качестве CDR2, и GGWLDAMDY (SEQ ID NO: 4) в качестве последовательности CDR3 в вариабельном участке тяжелой цепи.

(3) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность RASQDISNYLN (SEQ ID NO: 5) в качестве CDR1, последовательность YTSRLHS (SEQ ID NO: 6) в качестве CDR2 и последовательность QQGNTLPW (SEQ ID NO: 7) в качестве CDR3 в вариабельном участке легкой цепи.

(4) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SYWMH в качестве CDR1, последовательность DIYPGSDSTNYNEKFKS в качестве CDR2 и последовательность GGWLDAMDY в качестве CDR3 в вариабельном участке тяжелой цепи, и имеет последовательность RASQDISNYLN в качестве CDR1, последовательность YTSRLH в качестве CDR2 и последовательность QQGNTLPW в качестве CDR3 в вариабельном участке легкой цепи.

(5) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность TYWMH (SEQ ID NO: 8) в качестве CDR1, последовательность AIYPGNSETSYNQKFKG (SEQ ID NO: 9) в качестве CDR2 и GYSDFDY (SEQ ID NO: 10) в качестве последовательности CDR3 в вариабельном участке тяжелой цепи.

(6) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность HASQGIRSNIG (SEQ ID NO: 11) в качестве CDR1, последовательность HGTNLED (SEQ ID NO: 12) в качестве CDR2 и последовательность VQYVQFP (SEQ ID NO: 13) в качестве CDR3 в вариабельном участке легкой цепи.

(7) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность TYWMH в качестве CDR1, последовательность AIYPGNSETSYNQKFKG в качестве CDR2 и последовательность GYSDFDY в качестве CDR3 в вариабельном участке тяжелой цепи, и имеет последовательность HASQGIRSNIG в качестве CDR1, последовательность HGTNLED в качестве CDR2 и последовательность VQYVQFP в качестве CDR3 в вариабельном участке легкой цепи.

(8) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность DYNLH (SEQ ID NO: 14) в качестве CDR1, последовательность YIYPYNGNTGYNQKFKR (SEQ ID NO: 15) в качестве CDR2 и GGIYDDYYDYAIDY (SEQ ID NO: 16) в качестве последовательности CDR3 в вариабельном участке тяжелой цепи.

(9)Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность RASENIYSHIA (SEQ ID NO: 17) в качестве CDR1, последовательность GATNLAH (SEQ ID NO: 18) в качестве CDR2 и последовательность QHFWGTP (SEQ ID NO: 19) в качестве CDR3 в вариабельном участке легкой цепи.

(10) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность DYNLH в качестве CDR1, последовательность YIYPYNGNTGYNQKFKR в качестве CDR2 и последовательность GGIYDDYYDYAIDY в качестве CDR3 в вариабельном участке тяжелой цепи, и имеет последовательность RASENIYSHIA в качестве CDR1, последовательность GATNLAH в качестве CDR2 и последовательность QHFWGTP в качестве CDR3 в вариабельном участке легкой цепи.

(11) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SYYLY (SEQ ID NO: 20) в качестве CDR1, последовательность LINPTNSDTIFNEKFKS (SEQ ID NO: 21) в качестве CDR2 и EGGYGYGPFAY (SEQ ID NO: 22) в качестве последовательности CDR3 в вариабельном участке тяжелой цепи.

(12) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность TSSQTLVHSNGNTYLH (SEQ ID NO: 23) в качестве CDR1, последовательность KVSNRFS (SEQ ID NO: 24) в качестве CDR2 и последовательность HSTHVP (SEQ ID NO: 25) в качестве CDR3 в вариабельном участке легкой цепи.

(13) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SYYLY в качестве CDR1, последовательность LINPTNSDTIFNEKFKS в качестве CDR2 и последовательность EGGYGYGPFAY в качестве CDR3 в вариабельном участке тяжелой цепи, и имеет последовательность TSSQTLVHSNGNTYLH в качестве CDR1, последовательность KVSNRFS в качестве CDR2 и последовательность HSTHVP в качестве CDR3 в вариабельном участке легкой цепи.

(14) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SYGMS (SEQ ID NO: 26) в качестве CDR1, последовательность TISSGGSYIYYPESVKG (SEQ ID NO: 27) в качестве CDR2 и LYGGRRGYGLDY (SEQ ID NO: 28) в качестве последовательности CDR3 в вариабельном участке тяжелой цепи.

(15) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность RSSKSLLHSDGITYLY (SEQ ID NO: 29) в качестве CDR1, последовательность QMSNLAS (SEQ ID NO: 30) в качестве CDR2 и последовательность AQNLEL (SEQ ID NO: 31) в качестве CDR3 в вариабельном участке легкой цепи.

(16) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SYGMS в качестве CDR1, последовательность TISSGGSYIYYPESVKG в качестве CDR2 и последовательность LYGGRRGYGLDY в качестве CDR3 в вариабельном участке тяжелой цепи, и имеет последовательность RSSKSLLHSDGITYLY в качестве CDR1, последовательность QMSNLAS в качестве CDR2 и последовательность AQNLEL в качестве CDR3 в вариабельном участке легкой цепи.

(17) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SHYYWT (SEQ ID NO: 32) в качестве CDR1, последовательность YISYDGSNNYNPSLKN (SEQ ID NO: 33) в качестве CDR2 и EGPLYYGNPYWYFDV (SEQ ID NO: 34) в качестве последовательности CDR3 в вариабельном участке тяжелой цепи.

(18) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность RASQDIDNYLN (SEQ ID NO: 35) в качестве CDR1, последовательность YTSRLHS (SEQ ID NO: 36) в качестве CDR2 и последовательность QQFNTLP (SEQ ID NO: 37) в качестве CDR3 в вариабельном участке легкой цепи.

(19) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SHYYWT в качестве CDR1, последовательность YISYDGSNNYNPSLKN в качестве CDR2 и последовательность EGPLYYGNPYWYFDV в качестве CDR3 в вариабельном участке тяжелой цепи, и имеет последовательность RASQDIDNYLN в качестве CDR1, последовательность YTSRLHS в качестве CDR2 и последовательность QQFNTLP в качестве CDR3 в вариабельном участке легкой цепи.

(20) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SHYYWS (SEQ ID NO: 38) в качестве CDR1, последовательность YISYDGSNNYNPSLKN (SEQ ID NO: 39) в качестве CDR2 и EGPLYYGNPYWYFDV (SEQ ID NO: 40) в качестве последовательности CDR3 в вариабельном участке тяжелой цепи.

(21) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность RASQDIDNYLN (SEQ ID NO: 41) в качестве CDR1, последовательность YTSRLHS (SEQ ID NO: 42) в качестве CDR2 и последовательность QQFNTLP (SEQ ID NO: 43) в качестве CDR3 в вариабельном участке легкой цепи.

(22) Фармацевтическая композиция в соответствии с вышеуказанным пунктом (1), где моноклональное антитело или его фрагмент, содержащий антигенсвязывающий участок, имеет последовательность SHYYWS в качестве CDR1, последовательность YISYDGSNNYNPSLKN в качестве CDR2 и последовательность EGPLYYGNPYWYFDV в качестве CDR3 в вариабельном участке тяжелой цепи, и имеет последовательность RASQDIDNYLN в качестве CDR1, последовательность YTSRLHS в качестве CDR2 и последовательность QQFNTLP в качестве CDR3 в вариабельном участке легкой цепи.

(23) Фармацевтическая композиция для супрессии активированных В-клеток, где фармацевтическая композиция содержит моноклональное антитело, продуцированное любой из гибридом mp5B7, mp7B4, mp13D4 и mp13H11 с депозитарными номерами NITE BP-1211, NITE BP-1212, NITE BP-1213 и NITE BP-1214, или его фрагмент, содержащий антигенсвязывающий участок, в качестве активного ингредиента.

[0018]

(24) Фармацевтическая композиция по любому из вышеуказанных пунктов (1)-(23), дополнительно для профилактики или лечения аутоиммунных заболеваний.

(25) Фармацевтическая композиция по любому из вышеуказанных пунктов (1)-(23), дополнительно для профилактики или лечения аллергических заболеваний.

[0019]

(26) Способ обнаружения активированных В-клеток, который включает стадию приведения моноклонального антитела, связывающегося с внеклеточным доменом PLD4, или его фрагмента, содержащего антигенсвязывающий участок, в контакт с исследуемыми клетками, и обнаружения моноклонального антитела или его фрагмента, содержащего антигенсвязывающий участок, который связывается с клетками.

(27) Реагент для обнаружения активированных В-клеток, где реагент содержит моноклональное антитело, которое связывается с внеклеточным доменом PLD4, или его фрагмент, содержащий антителосвязывающий участок.

(28) Способ супрессии активированных В-клеток, включающий стадию приведения одного из следующих компонентов в контакт с активированными В-клетками:

(a) моноклональное антитело, которое связывается с PLD4 и подавляет активированные В-клетки, или его фрагмент, содержащий антигенсвязывающий участок, и

(b) иммуноглобулин, в котором привит определяющий комплементарность участок моноклонального антитела по пункту (а), или его фрагмент, содержащий антигенсвязывающий участок.

(29) Способ супрессии активированных В-клеток в живом организме, включающий стадию введения любого из следующих компонентов в живой организм:

(a) моноклональное антитело, которое связывается с PLD4 и подавляет активность активированных В-клеток, или его фрагмент, содержащий антигенсвязывающий участок, и

(b) иммуноглобулин, в который привит определяющий комплементарность участок моноклонального антитела по пункту (а), или его фрагмент, содержащий антигенсвязывающий участок.

(30) Способ в соответствии с вышеуказанным пунктами (28) или (29), где активность активированных В-клеток представляет собой продуцирующую антитело активность.

(31) Агент для супрессии активированных Т-клеток, где агент содержит, в качестве активного компонента, любой из следующих компонентов:

(a) моноклональное антитело, которое связывается с PLD4 и подавляет активированные В-клетки, или его фрагмент, содержащий антигенсвязывающий участок, и

(b) иммуноглобулин, в который привит определяющий комплементарность участок моноклонального антитела по пункту (а), или его фрагмент, содержащий антигенсвязывающий участок.

(32) Агент для супрессии активированных В-клеток в соответствии с вышеуказанным пунктом (31), где активность активированных В-клеток представляет собой антителопродуцирующую активность.

[0020]

"Активированные В-клетки" могут включать В-клетки, обладающие активностью пролиферации и продуцирования антитела и секреции путем не только прямой стимуляции посредством BCR и TLR, но и стимуляция посредством Т-клеток.

[0021]

"Фрагмент, содержащий антигенсвязывающий участок" может включать, но ими не ограничиваться, фрагменты Fab, Fab', F(аb')2 и т.п., полученные путем частичного расщепления папаином или пепсином. Кроме того, фрагмент, содержащий антигенсвязывающий участок, также может включать фрагмент иммуноглобулина, содержащий вариабельный участок, в который привит CDR (участок, определяющий комплементарность) моноклонального антитела. Хорошо известно, что эти фрагменты антител могут использоваться в качестве молекул антител, имеющих аффинность связывания с антигенами. Альтернативно, в той мере, в какой это необходимо, антигенсвязывающая активность сохраняется, могут быть использованы антитела, сконструированные путем рекомбинации генов. Примеры антител, сконструированных путем рекомбинации генов, могут включать химерные антитела, CDR-привитые антитела, одноцепочечные Fv (scFv), диатело (диатела), линейные антитела и полиспецифические антитела, образованные из фрагментов антител и тому подобное. Известен способ получения этих антител на основе моноклональных антител или антителообразующих клеток, продуцирующих моноклональные антитела.

[0022]

"Аутоиммунные заболевания" представляют собой заболевания, которые вызваны атаками иммунной системы, ошибочно воспринимающей ткани собственного организма как чужеродные субстанции. Органоспецифические аутоиммунные заболевания включают, но ими не ограничиваются, синдром Гийена-Барре, миастению гравис, хронический гастрит (хронический атрофический гастрит), аутоиммунный гепатит, первичный билиарный цирроз печени, первичный склерозирующий холангит, аутоиммунный панкреатит, синдром аортита, синдром Гудпасчера, быстро прогрессирующий гломерулонефрит, мегалобластную анемию, аутоиммунную гемолитическую анемию, аутоиммунную нейтропению, идиопатическую тромбоцитопеническую пурпуру, Базедову болезнь, тиреоидит Хашимото, первичный гипотиреоз, идиопатическую болезнь Аддисона, сахарный диабет 1 типа, язвенный колит, болезнь Крона, целиакию и тому подобное; и системные аутоиммунные заболевания включают суставной ревматизм, системную красную волчанку, синдром антифосфолипидных антител, полимиозит, склеродермию, синдром Шегрена, васкулитный синдром, аутоиммунный лимфопролиферативный синдром (ALPS) и т.п.

[0023]

"Аллергические заболевания" представляют собой заболевания, вызванные атипичной иммунной реакцией против чужеродных субстанций, и включают, но ими не ограничивается, атопический дерматит, бронхиальную астму, поллиноз, аллергический ринит, крапивницу, детский астма, аллергический гастроэнтерит, контактный дерматит, сывороточную реакцию, сосудистую пурпуру и т.п.

[Положительный эффект изобретения]

[0024]

Настоящее изобретение относится к способу лечения, относящемуся к супрессии активированных В-клеток с использованием антитела, специфически распознающего PLD4, и его фрагмента, и лекарственному средству, обладающему его терапевтическим эффектом.

[0025]

Также настоящее изобретение, как ожидается, может вызывать профилактические и терапевтические эффекты у пациентов с аутоиммунными заболеваниями или аллергическими заболеваниями путем использования супрессирующей активности в отношении активированных B-клеток.

[Краткое описание чертежей]

[0026]

[Фиг. 1]

На фиг.1 представлена диаграмма FACS-анализа, которая показывает окрашивание В-клеток человека (CD19+) антителами к PLD4. Белок PLD4 индуцировали на В-клетках CD19+ путем стимуляции лигандом TLR9, CpG2006. Индукция PLD4 в активированных В-клетках (CD19 +) может быть обнаружена с помощью лиганда TLR9 (CpG2006). Моноклональные антитела 11G9.6 и 5B7 использовали для обнаружения PLD4. Мышиный IgG2b каппа использовали в качестве отрицательного контроля.

[Фиг.2]

На фиг.2 представлена диаграмма FACS-анализа, которая показывает окрашивание человеческих PBMC антителами к PLD4 и антителами к CD19. Количество клеток PLD4+ увеличивалось в активированных В-клетках (CD19+) при стимуляции лигандом TLR9. Мышиный IgG1 каппа использовали в качестве негативного контроля.

[Фиг.3]

На фиг.3 представлена диаграмма FACS-анализа, которая показывает окрашивание человеческих PBMC антителами к PLD4 и антителом к CD19 с или без стимулирования лигандом TLR9. Значительное увеличение количества PLD4+ TLR9-лиганд стимулированных В-клеток (CD19+) можно было обнаружить с помощью антител к PLD4 (5B7, 13D4, 13H11 и 11G9.6). Мышиный IgG2b каппа использовали в качестве негативного контроля.

[фиг. 4]

На фиг. 4 представлена диаграмма FACS-анализа, которая показывает уменьшение количества PLD4+ активированных В-клеток посредством каждого из указанных рекомбинантных антител к PLD4. Совместное культивирование PBMC с рекомбинантными антителами к PLD4 (ch3B4, ch13D4, ch13H11, ch5B7 и ch11G9.6) снижает количество PLD4+ активированных В-клеток в присутствии лиганда TLR9. В случае, если антитело не добавляют (No Ab), и в случае, если используют неспецифическое антитело (контрольный Ig), тем не менее, активация В-клеток, при добавлении CpG2006, не может быть супрессирована.

[фиг. 5]

На фиг. 5 представлена диаграмма, на которой супрессивный эффект на фиг. 4 выражен в цифрах. Группа активированных В-клеток, которая экспрессирует PLD4 и обработана контрольным Ig, взята за 100%, и показаны изменения в группе активированных B-клеток, которая экспрессирует PLD4 и обработана каждым рекомбинантным антителом к PLD4.

[Фиг. 6]

На фиг.6 представлен результат цитометрии. РВМС культивировали с указанными рекомбинантными PLD4 антителами в присутствии лиганда TLR9 и рекомбинантного человеческого IL-6. При обработке ch3B4, ch5B7, ch13D4, ch13H11 или ch11G9.6 популяция плазмабластов (CD19+CD27+IgD-CD38+) уменьшалась по сравнению с обработкой контрольным Ig.

[Фиг. 7]

На фиг.7 представлен результат анализа ELISA (ферментный иммуносорбентный анализ) супернатанта культуры фиг. 6. Продукция IgG человека плазмабластами снижалась при обработке ch3B4, ch5B7, ch13D4, ch13H11 или ch11G9.6 по сравнению с обработкой контрольным Ig.

[Описание вариантов осуществления]

[0027]

Авторы настоящего изобретения недавно обнаружили, что PLD4 представляет собой молекулу, чья экспрессия индуцируется активацией В-клеток.

[0028]

Авторы настоящего изобретения ранее описывали экспрессию, внутриклеточную локализацию, структуру и функции человеческого PLD4 (патентная литература 1). В настоящем изобретении дополнительно выяснили, что экспрессия PLD4 индуцируется не только pDC, но также активированными В-клетками. Также недавно было обнаружено, что антитела к PLD4 супрессируют активированные В-клетки. Такие выводы усиливают вероятность того, что антитела к PLD4 обладают терапевтическим эффектом в отношении аутоиммунных заболеваний при супрессии не только активности pDC, о чем сообщалось ранее, но также активности В-клеток.

[0029]

Белки, такие как CD19, CD20, CD22 и BAFF-R, экспрессируются на поверхности В-клеток. CD19 экспрессируется на В-клетках на ранней стадии, такой как, стадия превращения про-В-клеток в плазматические клетки, секретирующие антитела, и функционирует в качестве контролирующего активацию вспомогательного рецептора на зрелых В-клетках. CD20 экспрессируется как на предшественниках В-клеток, так и активированных В-клетках, CD22 экспрессируется на клеточной поверхности зрелых В-клеток, и экспрессия BAFF-R наблюдается на экстенсивной стадии дифференциации В-клеток. Таким образом, существует проблема в том, что антитела, распознающие эти белки супрессируют не только активированные В-клетки, но также непримированные необученные В-клетки. Антитела к PLD4 по настоящему изобретению, однако, характеризуются супрессированием активированных В-клеток без воздействия на необученные В-клетки.

[0030]

Антитела к PLD4, используемые в настоящем изобретении, аналогичны антителам, о которых сообщалось ранее (патентная литература 1). Вкратце, с использованием в качестве иммуногена рекомбинантный слитый белок PLD4-Ig, кодирующего последовательность аминокислот, содержащую внеклеточный домен PLD4 (аминокислотная последовательность, соответствующая позиции 54-506 в аминокислотной последовательности, показанной в SEQ ID NO: 1), получали антитело против PLD4, способом, описанным далее.

[0031]

<Получение моноклональных антител к PLD4 человека>

1) Иммунизация

В качестве иммуногена был использован вышеуказанный рекомбинантный слитый белок PLD4-Ig. В дорзальную гиподерму трех мышей линии BALB/с вводили слитый белок PLD4-Ig. В качестве адъювантов использовали полный и неполный адъюванты Фрейнда, (Sigma). Объем первого введения составлял 200 мкг/мышь, а объем второго-четвертого введения составлял 50 мкг/мышь.

2) Подтверждение титра антисыворотки

Кровь собирали после третьей и четвертой иммунизации и титр антисыворотки оценивали посредством анализа ELISA.

Слитый белок PLD4-Ig преобразовывали в твердую фазу на 96-ти луночном микротитрационном планшете. Антисыворотку серийно разбавляли с 3-кратным повышением, начиная с 1000-кратного, и получали серии разведений до 729000 раз. В антиген-покрытые планшеты добавляли по 50 мкл каждого образца и выполняли реакцию первого порядка. После промывки выполняли реакцию второго порядка с HRP-меченным антителом IgG ((κ, λ), и регистрировали формирование цвета с помощью OPD (ортофенилендиамин) (490 нм).

3) Слияние клеток

Клетки селезенки отбирали у мышей, у которых наблюдали увеличение титра антисыворотки. Извлеченные клетки селезенки и клетки миеломы мыши (P3U1) сливали методом PEG, и слитые клетки селезенки выборочно культивировали в среде НАТ.

[0032]

<Анализ гибридом методом FACS с использованием клеток CAL-1>

Антитело, полученное от каждого клона слитых клеток селезенки, полученных с помощью селективной культуры HAT, оценивали методом FACS. В результате 3B4, 5B7, 7B4, 8C11, 10C3, 11D10, 13D4, 13H11, 14C1 и 11G9.6 в лунке с гибридомным супернатантом культуры взаимодействовали с PLD4 человека.

[0033]

В каждом моноклональном антителе, полученном от вышеуказанных гибридом, участки CDR (CDR, CDR1, CDR2 и CDR3) и участки FW (каркасные участки) в вариабельном участке и последовательность вариабельного участка определяли в соответствии с аналитическим методом системы нумерации Kabat (Kabat et al, 1991, Sequences of Proteins of Immunological Interest, National Institutes of Health Publication No. 91-3242, 5th ed., United States Department of Health and Human Services, Bethesda, MD).

[0034]

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 11G9.6 соответствует SEQ ID NO: 74, и аминокислотная последовательность соответствует SEQ ID NO: 75. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 11G9.6 соответствуют последовательности SEQ ID NO: 2, SEQ ID NO: 3 и SEQID NO: 4, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 3B4 соответствует SEQ ID NO: 76, и аминокислотная последовательность соответствует SEQ ID NO: 77. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 3B4 соответствуют последовательности SEQ ID NO: 8, SEQ ID NO: 9 и SEQID NO: 10, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 5B7 соответствует SEQ ID NO: 78, и аминокислотная последовательность соответствует SEQ ID NO: 79. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 5B7 соответствуют последовательности SEQ ID NO: 14, SEQ ID NO: 15 и SEQID NO: 16, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 7B4 соответствует SEQ ID NO: 80, и аминокислотная последовательность соответствует SEQ ID NO: 81. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 7B4 соответствуют последовательности SEQ ID NO: 14, SEQ ID NO: 15 и SEQID NO: 16, соответственно. Антитело 7B4 представляет собой антитело, которое имеет аналогичные CDR последовательности в вариабельных участках тяжелой и легкой цепей как антитело 5B7.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 8C11 соответствует SEQ ID NO: 82, и аминокислотная последовательность соответствует SEQ ID NO: 83. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 8C11 соответствуют последовательности SEQ ID NO: 20, SEQ ID NO: 21 и SEQID NO: 22, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 10C3 соответствует SEQ ID NO: 84, и аминокислотная последовательность соответствует SEQ ID NO: 85. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 10C3 соответствуют последовательности SEQ ID NO: 26, SEQ ID NO: 27 и SEQID NO: 28, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 11D10 соответствует SEQ ID NO: 86, и аминокислотная последовательность соответствует SEQ ID NO: 87. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 11D10 соответствуют последовательности SEQ ID NO: 26, SEQ ID NO: 27 и SEQID NO: 28, соответственно. Антитело 11D10 представляет собой антитело, которое имеет аналогичные CDR последовательности в вариабельных участках тяжелой и легкой цепей как антитело 10C3. Однако их изотипы тяжелыхх цепей отличаются (10C3 имеет константный участок мышиного IgG2a, и 11D10 имеет константный участок мышиного IgG2b).

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 13D4 соответствует SEQ ID NO: 88, и аминокислотная последовательность соответствует SEQ ID NO: 89. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 13D4 соответствуют последовательности SEQ ID NO: 32, SEQ ID NO: 33 и SEQID NO: 34, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 13H11 соответствует SEQ ID NO: 90, и аминокислотная последовательность соответствует SEQ ID NO: 91. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 13H11 соответствуют последовательности SEQ ID NO: 38, SEQ ID NO: 39 и SEQID NO: 40, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 14C1 соответствует SEQ ID NO: 92, и аминокислотная последовательность соответствует SEQ ID NO: 93. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 14C1 соответствуют последовательности SEQ ID NO: 38, SEQ ID NO: 39 и SEQID NO: 40, соответственно. Антитело 14C1 представляет собой антитело, которое имеет аналогичные CDR последовательности в вариабельных участках тяжелой и легкой цепей, как в антителе 13H11. Однако их изотипы тяжелых цепей являются различными (13H11 имеет константный участок мышиного IgG2b, и 14C1 имеет константный участок мышиного IgG1).

[0035]

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 11G9.6 соответствует SEQ ID NO: 94, и аминокислотная последовательность соответствует SEQ ID NO: 95. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 11G9.6 соответствуют последовательности SEQ ID NO: 5, SEQ ID NO: 6 и SEQID NO: 7, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 3B4 соответствует SEQ ID NO: 96, и аминокислотная последовательность соответствует SEQ ID NO: 97. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 3B4 соответствуют последовательности SEQ ID NO: 11, SEQ ID NO: 12 и SEQID NO: 13, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 5B7 соответствует SEQ ID NO: 98, и аминокислотная последовательность соответствует SEQ ID NO: 99. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 5B7 соответствуют последовательности SEQ ID NO: 17, SEQ ID NO: 18 и SEQID NO: 19, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 7B4 соответствует SEQ ID NO: 100, и аминокислотная последовательность соответствует SEQ ID NO: 101. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 7B4 соответствуют последовательности SEQ ID NO: 17, SEQ ID NO: 18 и SEQID NO: 19, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 8C11 соответствует SEQ ID NO: 102, и аминокислотная последовательность соответствует SEQ ID NO: 103. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 8C11 соответствуют последовательности SEQ ID NO: 23, SEQ ID NO: 24 и SEQID NO: 25, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 10C3 соответствует SEQ ID NO: 104, и аминокислотная последовательность соответствует SEQ ID NO: 105. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 10C3 соответствуют последовательности SEQ ID NO: 29, SEQ ID NO: 30 и SEQID NO: 31, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 11D10 соответствует SEQ ID NO: 106, и аминокислотная последовательность соответствует SEQ ID NO: 107. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 11D10 соответствуют последовательности SEQ ID NO: 29, SEQ ID NO: 30 и SEQID NO: 31, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 13D4 соответствует SEQ ID NO: 108, и аминокислотная последовательность соответствует SEQ ID NO: 109. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 13D4 соответствуют последовательности SEQ ID NO: 35, SEQ ID NO: 36 и SEQID NO: 37, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 13H11 соответствует SEQ ID NO: 100, и аминокислотная последовательность соответствует SEQ ID NO: 111. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 13H11 соответствуют последовательности SEQ ID NO: 41, SEQ ID NO: 42 и SEQID NO: 43, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 14C1 соответствует SEQ ID NO: 112, и аминокислотная последовательность соответствует SEQ ID NO: 113. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 14C1 соответствуют последовательности SEQ ID NO: 41, SEQ ID NO: 42 и SEQID NO: 43, соответственно.

[0036]

Примеры более предпочтительных моноклональных антител в настоящем изобретении могут включать моноклональные антитела, продуцируемые гибридомами mp5B7, mp7B4, mp13D4 и mp13H11.

Гибридомы mp5B7, mp7B4, mp13D4 и mp13H11 были одобрены National Institute of Technology and Evaluation (Национальный институт технологии и оценки), International Patent Organism Depositary (Международный Депозитарий патентованных организмов),

под регистрационным номером NITE АБП-1211, NITE АБП-1212, NITE АБП-1213 и NITE АВР-1214 от 27 января 2012 года. Подробности задающие осаждения будет описана следующим образом.

(1) Название и адрес органа Депозитария

Название: National Institute of Technology and Evaluation (Национальный институт технологии и оценки), Advanced Industrial Science and Technology (института передовых промышленных наук и технологий), International Patent Organism Depositary (Международный Депозитарий патентованных организмов)

Адрес: 2-5-8 Kazusa Kamatari Kisarazu-shi, Chiba Ibaraki, 292-0818, Japan

(2) Дата регистрации: Январь 27, 2012

(3) Депозитарный номер NITE BP-1211 (гибридома mp5B7)

NITE BP-1212 (гибридома mp7B4)

NITE BP-1213 (гибридома mp13D4)

NITE BP-1214 (гибридома mp13H11)

[0037]

В частности, более предпочтительными антителами являются антитела, имеющие сочетание

CDR1 тяжелой цепи: DYNLH, CDR2: YIYPYNGNTGYNQKFKR и CDR3: GGIYDDYYDYAIDY, и

CDR1 легкой цепи: RASENIYSHIA, CDR2: GATNLAH и CDR3: QHFWGTP

в виде последовательностей CDR, образующих ее вариабельные участки; антитело, имеющее сочетание

CDR1 тяжелой цепи: SHYYWT, CDR2: YISYDGSNNYNPSLKN и CDR3: EGPLYYGNPYWYFDV, и

CDR1 легкой цепи: RASQDIDNYLN, CDR2: YTSRLHS и CDR3: QQFNTLP

в виде последовательностей CDR, образующих ее вариабельные участки; антитело, имеющее сочетание

CDR1 тяжелой цепи: SHYYWS, CDR2: YISYDGSNNYNPSLKN, и CDR3: EGPLYYGNPYWYFDV, и

CDR1 легкой цепи: RASQDIDNYLN, CDR2: YTSRLHS, и CDR3: QQFNTLP,

в виде последовательностей CDR, образующих ее вариабельные участки.

[0038]

Рекомбинантное антитело или гуманизированное антитело, распознающее PLD4, может быть получено с использованием кодирующий его полинуклеотида, методами генной инженерии. Как описано в патентном документе 1, например, каждое активное рекомбинантное антитело (ch3B4Ab, ch5B7Ab, ch7B4Ab, ch8C11Ab, ch10C3Ab, ch11D10Ab, ch13D4Ab, ch13H11Ab, ch14C1Ab, ch11G9.6Ab т.д.) могут быть легко получены специалистами в данной области техники с использованием каждого участка CDR вышеописанных мышиных моноклональных антител (3B4, 5B7, 7B4, 8C11, 10C3, 11D10, 13D4, 13H11, 14C1, 11G9.6 т.д.).

[0039]

Авторы настоящего изобретения подтвердили, что моноклональные антитела против PLD4 обладают CDC (комплементзависимая цитотоксичность) активностью и ADCC (антитело-зависимая клеточная цитотоксичность) активностью против PLD4-экспрессирующих клеток. Таким образом, моноклональные антитела к PLD4 в соответствии с настоящим изобретением обладают цитотоксическим действием против PLD4-экспрессирующих клеток.

[0040]

То есть, настоящее изобретение относится к агенту для супрессии активированных В-клеток, где агент содержит антитело, которое связывается с внеклеточным доменом PLD4, в качестве активного компонента. Альтернативно, настоящее изобретение относится к способу супрессии продукции антител, который включает стадию введения антитела, связывающегося с внеклеточным доменом PLD4. Настоящее изобретение дополнительно относится к применению антитела, связывающегося с внеклеточным доменом PLD4, в производстве фармацевтической композиции для супрессии активированных В-клеток.

[0041]

В настоящем изобретении может быть использовано антитело, модифицированное согласно потребностям. В соответствии с настоящим изобретением, антитело, распознающее внеклеточный домен PLD4, обладает супрессирующим действием в отношении активированных B-клеток. То есть, полагают, что существует возможность того, что антитело само по себе обладает цитотоксическим действием в отношении активированных В-клеток. Известен подкласс антитела, демонстрирующего интенсивное эффекторное действие. Альтернативно, супрессивный эффект в отношении активированных В-клеток может быть дополнительно усилен путем модификации антитела цитотоксическим агентом. Эти вещества могут быть указаны в качестве цитотоксических средств.

Токсины: эндотоксин бактерий рода Pseudomonas (PE), дифтерийный токсин, лизин

Радиоизотопы: Tc99m, Sr89, I131, Y90

Противораковые средства: калихеамицин, митомицин, паклитаксел

Токсины, содержащие белки, могут связываться с антителом или его фрагментом или т.п. с помощью бифункционального реагента. Альтернативно, путем конъюгирования гена, кодирующего антитела с геном, кодирующим токсин, также может быть получен слитый белок, состоящий из двух белков. Также известен способ связывания радиоактивного изотопа с антителом. Известен способ маркировки антитела радиоизотопом, например, с помощью хелатирующего агента. Кроме того, противоопухолевое средство может быть связано с антителом, используя гликан или бифункциональный реагент или тому подобное.

[0042]

В настоящем изобретении, антитело, структура которого искусственно модифицирована, может быть использовано в качестве активного компонента. Например, известны различные способы модификации для улучшения цитотоксического действия и стабильности антител. Конкретно известен иммуноглобулин, в котором гликан его тяжелой цепи модифицирован (Shinkawa, T. et al. J. Biol. Chem. 278:3466-3473. 2003). Путем модификации гликана, ADCC (антитело-зависимая клеточная цитотоксичность) активность иммуноглобулинов усиливается.

[0043]

В настоящем изобретении могут быть использованы одно или несколько моноклональных антител. Например, несколько типов моноклональных антител, распознающих внеклеточный домен PLD4, могут быть объединены и использованы в настоящем изобретении.

[0044]

Как описано ниже, можно подтвердить, что антитела к PLD4 обладают супрессирующим действием в отношении активности активированных В-клеток продуцировать антитела, обеспечивающие приобретенный иммунитет. В-клетки продуцируют большое количество антител путем стимуляции лиганда BCR или лиганда TLR (предпочтительно лиганд TLR4, лиганд TLR7 или лиганд TLR9). Антитело к PLD4 предоставляется до и после стимуляции вышеуказанного лиганда на В-клетках или одновременно со стимуляцией лиганда, и с использованием В-клеток, для которых антитело к PLD4 не предусмотрено в качестве контроля, сравнивается способность продуцировать В-клетками антитела, обеспечивающие приобретенный иммунитет. Способность продуцировать антитела может быть оценена путем измерения секреторного иммуноглобулина, содержащегося в супернатанте культуры В-клеток. В результате сравнения, когда количество обеспечивающих приобретенный иммунитет антител, продуцируемых В-клетками, в супернатанте значительно снижается при добавлении антитела к PLD4, можно подтвердить, что исследуемое антитело к PLD4 оказывает супрессирующее действие на способность В-клеток продуцировать антитела. Способ измерения количества антител является известным. В-клетки клетки представляют собой клетки, которые продуцируют гуморальный иммунитет (секреторное антитело) в живом организме. Таким образом, гуморальный иммунитет можно контролировать путем супрессии способности В-клеток продуцировать антитела.

[0045]

Когда антитело, распознающее внеклеточный домен PLD4, вводят хозяину, отличному от вида организма, от которого получают антитело, его желательно преобразовать в форму, которая будет трудно распознаваться указанным хозяином как чужеродная субстанция. При преобразовании в описанные ниже молекулы, например, может быть затруднительно, чтобы иммуноглобулин распознавался как чужеродная субстанция. Методы обработки молекул иммуноглобулинов, как описано ниже, являются известными:

- фрагмент, содержащий антигенсвязывающий участок, у которого отсутствует константный участок (Monoclonal Antibodies: Principles and Practice. third edition, Academic Press Limited. 1995; Antibody Engineering, A Practical Approach, IRL PRESS, 1996);

- рекомбинантное антитело, состоящее из антигенсвязывающего участка моноклонального антитела и константного участка иммуноглобулина хозяина (Experimental manual for genetic expression, Kodansha Ltd. 1994 (под редакцией Isao Ishida and Tamie Ando)); и

- CDR-замещенное антитело, в котором участок, определяющий комплементарность (CDR), в иммуноглобулине хозяина заменен CDR моноклонального антитела (Experimental manual for genetic expression, Kodansha Ltd. 1994 (под редакцией Isao Ishida and Tamie Ando)).

[0046]

Альтернативно, ген вариабельного участка иммуноглобулина человека может быть также получен методом фагового отображения McCafferty J. et al., Nature 348:552-554, 1990; Kretzschmar T et. al., Curr Opin Biotechnol. 2002 Dec; 13(6):598-602.). В методе фагового отображения, ген, кодирующий вариабельный участок иммуноглобулина человека вводят в фаговый ген. Используя в качестве источников различные типы генов иммуноглобулина, можно также создать фаговую библиотеку. Фаг экспрессирует указанный вариабельный участок в виде слитого белка, содержащий белок, конструирующий сам фаг. Вариабельный участок, экспрессированный фагом на фаговой поверхности, поддерживает активность связывания с антигенами. Таким образом, при селекции фага, связывающегося с антигеном или клетками, экспрессирующими антиген, или тому подобное, фаг, экспрессирующий вариабельный участок, обладающий активностью целевого связывания, может быть выбран из фаговой библиотеки. Кроме того, ген, кодирующий вариабельный участок, обладающий активностью целевого связывания, сохраняется в фаговой частицы, выбранной вышеописанным образом. То есть, в способе фагового отображения, используя связывающую активность вариабельного участка в виде индекса, может быть получен ген, кодирующий вариабельный участок, обладающий активностью целевого связывания.

[0047]

В средстве для супрессии активности В-клеток или методе для супрессии активности В-клеток в соответствии с настоящим изобретением, антитело, распознающее внеклеточный домен PLD4 или фрагмент антитела, содержащий, по меньшей мере, его антигенсвязывающий участок, можно вводить в виде белка или кодирующего его полинуклеотида. Для введения полинуклеотида, желательно, чтобы вектор, в котором расположен полинуклеотид, кодирующий целевой белок, использовался под контролем соответствующего промотора с тем, чтобы целевой белок мог быть экспрессирован. Энхансер и терминатор могут также быть расположены в векторе. Векторы, которые содержат гены, кодирующие тяжелые и легкие цепи, составляющие иммуноглобулин, и в которых молекула иммуноглобулина может быть экспрессирована, являются известными. Вектор, в котором иммуноглобулин может быть экспрессирован, может быть введен путем внедрения в клетки. Для введения в живой организм, вектор, который может инфицировать клетки путем введения в живой организм, может быть введен непосредственно. Альтернативно, вектор вводят в лимфоцит, отделенной от живого организма, а затем вектор может быть возвращен в живом организме (ex vivo).

[0048]

В средстве для супрессии активности В-клеток или методе для супрессии активности В-клеток в соответствии с настоящим изобретением, количество моноклонального антитела для введения в живой организм составляет, обычно, от 0,5 мг до 10 мг, например, от 1 мг до 50 мг, предпочтительно от 2 до 10 мг иммуноглобулина на кг массы тела. Интервал введения антитела в живой организм может быть соответствующим образом установлен с тем, чтобы эффективная концентрация иммуноглобулина в живом организме могла быть сохранена в течение периода лечения. Конкретно, например, антитело можно вводить с интервалами от 1 до 2 недель. Может быть использован любой способ введения. Специалист в данной области может соответствующим образом выбрать эффективный способ введения для лечения. Конкретно, могут быть указаны пероральный или парентеральный способ введения. Антитело может вводиться системно или местно, например, посредством внутривенной инъекции, внутримышечной инъекции, внутрибрюшинной инъекцией или подкожной инъекции или тому подобное. Композиции, пригодные для парентерального введения по настоящему изобретению, включают инъекции, суппозитории, аэрозоли и тому подобное. Кроме того, в случае применения к клеткам, иммуноглобулин присутствует в культуральной жидкости в количестве, составляющем обычно 1 мкг/мл, предпочтительно 10 мкг/мл или больше, более предпочтительно 50 мкг/мл или больше, и еще более предпочтительно 0,5 мг/мл или больше.

[0049]

В агенте для супрессии активности В-клеток или методе для супрессии активности В-клеток в соответствии с настоящим изобретением, моноклональное антитело можно вводить в живой организм любым способом. Обычно моноклональное антитело объединяют с фармацевтически приемлемым носителем. В случае необходимости, моноклональное антитело может быть объединено с добавками, такими как загуститель, стабилизатор, антисептик и солюбилизирующий агент. Такие носители или добавки включают лактозу, лимонную кислоту, стеариновую кислоту, стеарат магния, сахарозу, крахмал, тальк, желатин, агар, растительное масло, этиленгликоль и тому подобное. Термин "фармацевтически приемлемый" означает быть одобренным государственными органами различных стран, или что его применение для животных, млекопитающих и, в частности, человека указано в фармакопеях различных стран или общепризнанных фармакопеях. Агент для супрессии активности В-клеток по настоящему изобретению может также поставляться в форме лиофилизированных порошков или таблеток с одной или несколькими дозами. Кроме того, стерилизованная вода для инъекций, физиологический солевой раствор или буферный раствор, которые используют для растворения, могут объединяться с лиофилизированными порошками или таблетками для получения желаемой концентрации композиция перед введением.

[0050]

Кроме того, для введения в виде вектора, экспрессирующего иммуноглобулин, тяжелую цепь и легкую цепь трансфицируют в виде различных плазмид, и каждую плазмиду можно вводить в количестве от 0,1 до 10 мг, например, от 1 до 5 мг на кг массы тела. Кроме того, от 1 до 5 мкг векторов/106 клеток используют для введения в клетки in vitro. Настоящее изобретение далее будет описано более подробно с помощью примеров.

[0051]

Вся литература предшествующего уровня техники, приведенная в настоящем описании, включена здесь в качестве ссылки.

[0052]

Настоящее изобретение будет далее описано более подробно с помощью примеров. Следует отметить, однако, что настоящее изобретение не ограничивается примерами.

[Примеры]

[0053]

Пример 1

РВМС человека (1×107 клеток/мл) стимулировали CpG2006, лигандом TLR9, (в конечной концентрации 1 мкM) и инкубировали в 24-луночном планшете в CO2-инкубаторе (37°C, 5% СО2) в течение примерно 20 часов. Параллельно РВМС человека (1×107 клеток/мл), которые не стимулировали, также культивировали в CO2-инкубаторе (37°C, 5% CO2) в течение 20 часов.

РВМС человека обрабатывали FcR блокирующим реагентом (Miltenyi), который предварительно разбавили в 5-кратно FACS-буфером (1% FBS/PBS), при 4°C в течение 20 минут. После промывки выполняли окрашивание 5B7, 11G9.6 или мышиным IgG2b каппа первичным антителом, (каждое 10 мкг/мл) в 4°C в течение 15 минут. Вторичное антитело и последующие антитела разбавляли буфером FACS, так чтобы FcR блокирующий реагент был разбавлен 25-кратно. PE-меченое антитело к Ig мыши (BD), вторичное антитело, разбавляли 100-кратно, и добавляли раствор и смешивали. Кроме того, для фракционирования В-клеток на FACS, APC-меченое антитело к CD19 человека (BioLegend) разводили 30-кратно FACS-буфером, содержащим FcR блокирующий реагент, и выполняли окрашивание при 4°C в течение 15 минут. Данные вводили с использованием цитофлуориметра FACS Calibur (BD). Живые клетки наносили на точечную диаграмму с осью X: FSC и осью Y: SSC. Данные вводили до тех пор, пока число клеток в выделенном регионе живых клеток не достигло 100000 единиц. В-клетки: выделяли регион антитела к молекулам маркера-положительные клетки. Выделенные регионы клеток анализировали на гистограмме с осью X: PLD4, и результаты окрашивания мышиным IgG2b каппа накладывали на них. В результате, антитела к PLD4 трудно связывались с нестимулированными В-клетками, но селективно связывались с активированными В-клетками при стимуляции лигандом TLR9 (фиг. 1). Это показывает, что PLD4 экспрессируется на активированных В-клетках.

[0054]

Пример 2

<Анализ связывания с В-клетками посредством каждого моноклонального антитела>

РВМС человека стимулировали CpG2006 с конечной концентрацией 1 мкM в течение 20 часов. Клетки собирали и обрабатывали FcR блокирующим реагентом в 4°C в течение 20 минут. После промывки, выполняли окрашивание каждым, в количестве 10 мкг/мл, 3B4, 5B7, 13D4, 13H11, 11G9.6, мышиным IgG1 каппа или мышиным IgG2b каппа, первичным антителом при 4°C в течение 15 минут. Окрашивание выполняли PE-меченым антителом против мышиного Ig, вторичным антителом, при 4°C в течение 15 минут. Для выделения региона В-клеток, выполняли двойное окрашивание APC-меченым антителом к CD19 человека при 4°C в течение 15 минут. Группу живых клеток на точечной диаграмме с осью X: FSC и осью Y: SSC анализировали при связывании антитела к CD19 с PLD4+ В-клетками (фиг 2 и фиг.3). В результате, все исследуемые моноклональные антитела к PLD4 связывались с В-клетками, стимулированными TLR9. То есть, было подтверждено, что посредством всех моноклональных антител к PLD4, в В-клетках активация-зависимым образом была индуцирована экспрессия PLD4.

[0055]

Пример 3

<Цитотоксическая активность рекомбинантного антитела к PLD4 против активированных В-клеток>

Частоту встречаемости PLD4+ активированных В-клеток, идуцированных стимуляцией лигандом TLR9 (1 мкM) использовали в качестве индекса. РВМС человека культивировали с CpG2006 и каждым рекомбинантным антителом к PLD4 или контрольным Ig в течение приблизительно 16 часов. В качестве среды использовали RPM11640 (Sigma) (включая 10% FBS (Equitech-Bio), 5 мл 200 мМ L-глутамина (GIBCO), 5 мл Pen-Strep (GIBCO), 5 мл пирувата натрия (Gibco), и 0,5 мл 50 мМ 2-МЕ (Sigma)). Клетки собирали и обрабатывали FcR блокирующим реагентом при 4°C в течение 20 минут. После промывки клетки дополнительно окрашивали 5B7 или 13D4, 3B4 или мышиным IgG2b каппа, первичным антителом, при 4°C в течение 15 минут (каждый 10 мкг/мл). Образец, в котором РВМС обрабатывали рекомбинантным антителом 3B4 (ch3B4), рекомбинантным антителом 3D4 (ch3D4) или рекомбинантным антителом 13H11 (ch13H11), окрашивали 5B7, и образец, в котором РВМС обрабатывали рекомбинантным антителом 5B7 (ch5B7) или рекомбинантным антителм 11G9.6 (ch11G9.6), окрашивали 13D4. Было установлено, что клон антитела к PLD4, обработанный для ADCC, и клон антитела к PLD4, используемый для окрашивания, не конкурируют друг с другом. Связывание анти-PLD4 обнаруживалось PE-меченным антителом к IgG мыши, вторичным антителом, при 4°C в течение 15 минут. Для выделения региона В-клеток, выполняли двойное окрашивание APC-меченым антителом к CD19 человека при 4°C в течение 15 минут (фиг. 4). Популяцию PLD4+ активированных В-клеток, обработанных каждым рекомбинантным антителом к PLD4, сравнивали с популяцией PLD4+ активированных В-клеток, обработанных контрольным антителом (фиг. 5). В результате, все рекомбинантные антитела к PLD4 уменьшали количество активированных PLD4+ B-клеток по сравнению с обработкой контрольным Ig (в случае обработки контрольным Ig рассматривались как 100%, ch3B4: 70,2%, ch13D4: 56,0%, ch13H11: 55,3%, ch5B7: 25,8%, ch11G9,6: 66,4%).

[0056]

Пример 4

<Ингибирующие эффекты рекомбинантных антител к PLD4 против активированных В-клеток>

Для определения эффекта антитела к PLD4 человека в отношении созревания B-клеток и продукцирования Ig путем активации В-клеток, все PBMC человека обрабатывали ch3B4, ch5B7, ch13D4, ch13H11, ch11G9.6 или контрольным Ig в течение 24 ч. Затем, для индуцирования активации В-клеток, РВМС дополнительно культивировали в присутствии CpG2216 (1 мкM) и рекомбинантного IL-6 человека, обеспечивая созревание В-клеток. В результате культивирования активированных В-клеток в течение 7 дней, плазмабласты, CD19+CD27+CD38-IgD+, в активированных В-клетках анализировали с помощью проточной цитометрии с РЕ-меченым антителом к CD19 человека. Для измерения продукции IgG человека, культивированные активированные В-клетки вновь стимулировали 50 нг/мл РМА (форболмиристатацетат) после промывки PBS 2 раза. Два дня спустя, измеряли продукцию IgG человека в культурах супернатанта методом ELISA. Количество плазмабластов в активированных В-клетках уменьшалось путем обработки ch3B4, ch5B7, ch13D4, ch13H11 или ch11G9.6 по сравнению с контрольной обработкой Ig (рисунок 6). Кроме того, продукция IgG человека сократилась при обработке ch3B4, ch5B7, ch13D4, ch13H11 или ch11G9.6 по сравнению с обработкой контрольными Ig (рисунок 7). Эти результаты показывают, что обработка рекомбинантными антителами к PLD4 человека уменьшает количество секретирующих антитела активированных В-клеток человека.

[Промышленная применимость]

[0057]

Как показано в приведенных выше примерах, антитела к PLD4 распознают и супрессируют активированные В-клетки. Таким образом, антитела могут быть использованы для профилактики и лечения заболеваний, связанных с функционированием иммунной системы (аутоиммунные заболевания и аллергические заболевания).

[0058]

<Расшифровка последовательностей моноклональных антител к PLD4 в соответствии с настоящим изобретением >

1. Мышиное антитело 11G9.6 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 11G9.6 к PLD4 соответствует SEQ ID NO: 74, и аминокислотная последовательность соответствует SEQ ID NO: 75. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 11G9.6 соответствуют последовательности SEQ ID NO: 2, SEQ ID NO: 3 и SEQID NO: 4, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 11G9.6 к PLD4 (504 н.п.) [заглавные буквы: VH вариабельный участок мышиного 11G9.6, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] (SEQ ID NO: 74)

ATGAGATCACAGTTCTCTATACAGTTACTGAGCACACAGAACCTCACCTTGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTGTCCACTCCCAGGTCCAACTGCAGCAGCCTGGGGCTGAACTGGTGAAGCCTGGGACTTCAGTGAAAATGTCCTGCAAGGCTTCTGGCTACACCTTCACCAGCTACTGGATGCACTGGGTGAAGCAGAGGCCGGGACAAGGCCTTGAGTGGATTGGAGATATTTATCCTGGTAGTGATAGTACTAACTACAATGAGAAGTTCAAGAGCAAGGCCACACTGACTGTAGACACATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCAAGAGGAGGGTGGTTGGATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAgccaaaacaacacccccatcagtctatccactggcccctaagggc

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 11G9.6 (168 а.о.) [заглавные буквы: VH вариабельный участок мышиного 11G9.6, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3) (SEQ ID NO: 75).

CDR1 в вариабельном участке тяжелой цепи антитела 11G9.6

(SEQ ID NO: 2)

CDR2 в вариабельном участке тяжелой цепи антитела 11G9.6

(SEQ ID NO: 3)

CDR3 в вариабельном участке тяжелой цепи антитела 11G9.6

(SEQ ID NO: 4)

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 11G9.6 к PLD4 соответствует SEQ ID NO: 38, и аминокислотная последовательность соответствует SEQ ID NO: 39. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 11G9.6 соответствуют последовательности SEQ ID NO: 40, SEQ ID NO: 41 и SEQID NO: 42, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 11G9.6 к PLD4 (421 н.п.) [заглавные буквы: VL вариабельный участок мышиного 11G9.6, строчные буквы: константная область легкой цепи мышиного Ig κ] (SEQ ID NO: 94)

ATGATGTCCTCTGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGTACCAGATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGCAAGTCAGGACATTAGCAATTATTTAAACTGGTATCAGCAGAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTTTTGCCAACAGGGTAATACGCTTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAAcgggctgatgctgcaccaactgtatccatcaagggcgaat

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 11G9.6 (140 а.о.) [заглавные буквы: VL вариабельный участок мышиного 11G9.6, строчные буквы: мышиного Ig κ константная область легкой цепи] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3) (SEQ ID NO: 95).

CDR1 в вариабельном участке легкой цепи антитела 11G9.6

(SEQ ID NO: 5)

CDR2 в вариабельном участке легкой цепи антитела 11G9.6

(SEQ ID NO: 6)

CDR3 в вариабельном участке легкой цепи антитела 11G9.6

(SEQ ID NO: 7)

[0059]

2. Мышиное антитело 3B4 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 3B4 к PLD4 соответствует SEQ ID NO: 76, и аминокислотная последовательность соответствует SEQ ID NO: 77. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 3B4 соответствуют последовательности SEQ ID NO: 8, SEQ ID NO: 9 и SEQID NO: 10, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 3B4 к PLD4 (437 н.п.) [заглавные буквы: VH вариабельный участок мышиного 3B4, строчные буквы: константный участок тяжелой цепи мышиного IgG1]

ATGGAATGTAACTGGATACTTCCTTTTATTCTGTCGGTAATTTCAGGGGTCTCCTCAGAGGTTCAGCTCCAGCAGTCTGGGACTGTGCTGTCAAGGCCTGGGGCTTCCGTGACGATGTCCTGCAAGGCTTCTGGCGACAGCTTTACCACCTACTGGATGCACTGGGTAAAACAGAGGCCTGGACAGGGTCTAGAATGGATTGGTGCTATCTATCCTGGAAATAGTGAAACTAGCTACAACCAGAAGTTCAAGGGCAAGGCCAAACTGACTGCAGTCACATCCGCCAGCACTGCCTATATGGAGTTCACTAGCCTGACAAATGAGGACTCTGCGGTCTATTACTGTACGGGGGGTTATTCCGACTTTGACTACTGGGGCCAAGGCACCACTCTCACAGTCTCCTCAgccaaaacgacacccccatctgtctatccact

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 3B4 (145 а.о.) [заглавные буквы: VH вариабельный участок мышиного 3B4, строчные буквы: константный участок тяжелой цепи мышиного IgG1] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 3B4

TYWMH

CDR2 в вариабельном участке тяжелой цепи антитела 3B4

AIYPGNSETSYNQKFKG

CDR3 в вариабельном участке тяжелой цепи антитела 3B4

GYSDFDY

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 3B4 к PLD4 соответствует SEQ ID NO: 96, и аминокислотная последовательность соответствует SEQ ID NO: 97. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 3B4 соответствуют последовательности SEQ ID NO: 11, SEQ ID NO: 12 и SEQID NO: 13, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 3B4 к PLD4 (459 н.п.) [заглавные буквы: VL вариабельный участок мышиного 3B4, строчные буквы: κ константная область легкой цепи мышиного Ig]

ATGATGGTCCTTGCTCAGTTTCTTGCATTCTTGTTGCTTTGGTTTCCAGGTGCAGGATGTGACATCCTGATGACCCAATCTCCATCCTCCATGTCTGTATCTCTGGGAGACACAGTCAGCATCACTTGCCATGCAAGTCAGGGCATTAGAAGTAATATAGGGTGGTTGCAGCAGAAACCAGGGAAATCATTTAAGGGCCTGATCTTTCATGGAACCAACTTGGAAGATGGAGTTCCATCAAGGTTCAGTGGCAGAGGATCTGGAGCAGATTATTCTCTCACCATCAACAGCCTGGAATCTGAAGATTTTGCAGACTATTACTGTGTACAGTATGTTCAGTTTCCTCCAACGTTCGGCTCGGGGACAAAGTTGGAAATAAGAcgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatctggaggtgcctcagtcgtg

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 3B4 (153 а.о.) [заглавные буквы: VL вариабельный участок мышиного 3B4, строчные буквы: κ константная область легкой цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 3B4

HASQGIRSNIG

CDR2 в вариабельном участке легкой цепи антитела 3B4

HGTNLED

CDR3 в вариабельном участке легкой цепи антитела 3B4

VQYVQFP

[0060]

3. Мышиное антитело 5B7 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 5B7 к PLD4 соответствует SEQ ID NO: 78, и аминокислотная последовательность соответствует SEQ ID NO: 79. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 5B7 соответствуют последовательности SEQ ID NO: 14, SEQ ID NO: 15 и SEQID NO: 16, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи of the мышиное антитело 5B7 к PLD4 (475 н.п.) [заглавные буквы: VH вариабельный участок мышиного 5B7, строчные буквы: константный участок тяжелой цепи мышиного IgG2b]

ATGGGATGGAGCTGGATCTTTCTCTTCCTCCTGTCAGGAACTGCAGGCGTCCACTCTGAGGTCCAGCTTCAGCAGTCAGGACCTGAACTGGTGAAACCTGGGGCCTCAGTGAAGATATCCTGCAAGGCTTCTGGATACACATTCACTGACTACAACTTGCACTGGGTGAAGCAGAGCCATGGAAAGAGCCTTGAGTGGATTGGATATATTTATCCTTACAATGGTAATACTGGCTACAACCAGAAGTTCAAGAGGAAGGCCACATTGACTGTAGACAATTCCTCCGGCACAGTCTACATGGAGCTCCGCAGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTGCAAGAGGAGGGATCTATGATGATTACTACGACTATGCTATCGACTATTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAgccaaaacaacacccccatcagtctatccactggcccctaagggcgaat

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 5B7 (158 а.о.) [заглавные буквы: VH вариабельный участок мышиного 5B7, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 5B7

DYNLH

CDR2 в вариабельном участке тяжелой цепи антитела 5B7

YIYPYNGNTGYNQKFKR

CDR3 в вариабельном участке тяжелой цепи антитела 5B7

GGIYDDYYDYAIDY

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 5B7 к PLD4 соответствует SEQ ID NO: 98, и аминокислотная последовательность соответствует SEQ ID NO: 99. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 5B7 соответствуют последовательности SEQ ID NO: 17, SEQ ID NO: 18 и SEQID NO: 19, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи of the мышиное антитело 5B7 к PLD4 (467 н.п.) [заглавные буквы: VL вариабельный участок мышиного 5B7, строчные буквы: κ константная область легкой цепи мышиная Ig]

ATGAGTGTGCCCACTCAGGTCCTGGGGTTGCTGCTGCTGTGGCTTACAGATGCCAGATGTGACATCCAGATGACTCAGTCTCCAGCCTCCCTATCTGTATCTGTGGGAGAAACTGTCGCCATCACATGTCGAGCAAGTGAGAATATTTACAGTCATATAGCATGGTATCAGCAGAAAGAGGGAAAATCTCCTCAGCGCCTGGTCTATGGTGCAACAAACTTAGCACATGGTGTGCCATCAAGGTTCAGTGGCAGTGGATCAGGCACACAGTATTCCCTCAAGATCAACAGCCTTCAGTCTGAAGATTTTGGGAGTTATTACTGTCAACATTTTTGGGGTACTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAAcgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttctt

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 5B7 (155 а.о.) [заглавные буквы: VL вариабельный участок мышиного 5B7, строчные буквы: κ константная область легкой цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 5B7

RASENIYSHIA

CDR2 в вариабельном участке легкой цепи антитела 5B7

GATNLAH

CDR3 в вариабельном участке легкой цепи антитела 5B7

QHFWGTP

[0061]

4. Мышиное антитело 7B4 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 7B4 к PLD4 соответствует SEQ ID NO: 80, и аминокислотная последовательность соответствует SEQ ID NO: 81. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 7B4 соответствуют последовательности SEQ ID NO: 14, SEQ ID NO: 15 и SEQID NO: 16, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 7B4 к PLD4 (470 н.п.) [заглавные буквы: VH вариабельный участок мышиного 7B4, строчные буквы: константный участок тяжелой цепи мышиного IgG2b]

ATGGGATGGAGCTGGATCTTTCTCTTCCTCCTGTCAGGAACTGCAGGCGTCCACTCTGAGGTCCAGCTTCAGCAGTCAGGACCTGAACTGGTGAAACCTGGGGCCTCAGTGAAGATATCCTGCAAGGCTTCTGGATACACATTCACTGACTACAACTTGCACTGGGTGAAGCAGAGCCATGGAAAGAGCCTTGAGTGGATTGGATATATTTATCCTTACAATGGTAATACTGGCTACAACCAGAAGTTCAAGAGGAAGGCCACATTGACTGTAGACAATTCCTCCGGCACAGTCTACATGGAGCTCCGCAGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTGCAAGAGGAGGGATCTATGATGATTACTACGACTATGCTATCGACTATTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAgccaaaacaacacccccatcagtctatccactggcccctaaggg

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 7B4 (156 а.о.) [заглавные буквы: мышиного 7B4 VH вариабельный участок, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 7B4

DYNLH

CDR2 в вариабельном участке тяжелой цепи антитела 7B4

YIYPYNGNTGYNQKFKR

CDR3 в вариабельном участке тяжелой цепи антитела 7B4

GGIYDDYYDYAIDY

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 7B4 к PLD4 соответствует SEQ ID NO: 100, и аминокислотная последовательность соответствует SEQ ID NO: 101. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 7B4 соответствуют последовательности SEQ ID NO: 17, SEQ ID NO: 18 и SEQID NO: 19, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 7B4 к PLD4 (454 н.п.) [заглавные буквы: VL вариабельный участок мышиного 7B4, строчные буквы: κ константная область легкой цепи мышиного Ig]

ATGAGTGTGCCCACTCAGGTCCTGGGGTTGCTGCTGCTGTGGCTTACAGATGCCAGATGTGACATCCAGATGACTCAGTCTCCAGCCTCCCTATCTGTATCTGTGGGAGAAACTGTCGCCATCACATGTCGAGCAAGTGAGAATATTTACAGTCATATAGCATGGTATCAGCAGAAAGAGGGAAAATCTCCTCAGCGCCTGGTCTATGGTGCAACAAACTTAGCACATGGTGTGCCATCAAGGTTCAGTGGCAGTGGATCAGGCACACAGTATTCCCTCAAGATCAACAGCCTTCAGTCTGAAGATTTTGGGAGTTATTACTGTCAACATTTTTGGGGTACTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAAcgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatctggaggtgcctcag

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 7B4 (151 а.о.) [заглавные буквы: VL вариабельный участок мышиного 7B4, строчные буквы: κ константная область легкой цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 7B4

RASENIYSHIA

CDR2 в вариабельном участке легкой цепи антитела 7B4

GATNLAH

CDR3 в вариабельном участке легкой цепи антитела 7B4

QHFWGTP

[0062]

5. Мышиное антитело 8C11 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 8C11 к PLD4 соответствует SEQ ID NO: 82, и аминокислотная последовательность соответствует SEQ ID NO: 83. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 8C11 соответствуют последовательности SEQ ID NO: 20, SEQ ID NO: 21 и SEQ ID NO: 22, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 8C11 к PLD4 (462 н.п.) [заглавные буквы: VH вариабельный участок мышиного 8C11, строчные буквы: константный участок тяжелой цепи мышиного IgG2b]

ATGGGATGGAGCTATATCATCCTCTTTTTGGTAGCAACAGCAACAGGGGTCCACTCCCAGGTCCAACTGCAGCAGTCGGGGGCTGAACTGGTGAAGCCTGGGGCTTCAGTGAAGTTGTCCTGCAAGGCTTCTGGCTACACCTTCACCAGCTACTATTTGTACTGGGTGAGGCAGAGGCCTGGACAAGGCCTTGAGTGGATTGGACTGATTAATCCTACCAATAGTGATACTATCTTCAATGAGAAGTTCAAGAGCAAGGCCACACTGACTGTAGACAAATCCTCCAGCACAGCATACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTACACGAGAGGGGGGATATGGTTACGGCCCGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAgccaaaacaacacccccatcagtctatccactggcccctaagggc

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 8C11 (154 а.о.) [заглавные буквы: мышиного 8C11 VH вариабельный участок, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 8C11

SYYLY

CDR2 в вариабельном участке тяжелой цепи антитела 8C11

LINPTNSDTIFNEKFKS

CDR3 в вариабельном участке тяжелой цепи антитела 8C11

EGGYGYGPFAY

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 8C11 к PLD4 соответствует SEQ ID NO: 102, и аминокислотная последовательность соответствует SEQ ID NO: 103. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 8C11 соответствуют последовательности SEQ ID NO: 23, SEQ ID NO: 24 и SEQID NO: 25, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 8C11 к PLD4 (457 н.п.) [заглавные буквы: VL вариабельный участок мышиного 8C11, строчные буквы: κ константная область легкой цепи мышиного Ig]

ATGAAGTTGCCTGTTAGGCTGTTGGTGCTGATGTTCTGGATTCCTGCTTCCAGCAGTGATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTCCATCTCTTGCACATCTAGTCAGACCCTTGTACACAGTAATGGAAACACCTATTTACATTGGTACCTGCAGAAGCCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCACAGTACACATGTTCCATTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAAcgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatctggag

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 8C11 (152 а.о.) [заглавные буквы: VL вариабельный участок мышиного 8C11, строчные буквы: κ константная область легкой цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 8C11

TSSQTLVHSNGNTYLH

CDR2 в вариабельном участке легкой цепи антитела 8C11

KVSNRFS

CDR3 в вариабельном участке легкой цепи антитела 8C11

HSTHVP

[0063]

6. Мышиное антитело 10C3 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 10C3 к PLD4 соответствует SEQ ID NO: 84, и аминокислотная последовательность соответствует SEQ ID NO: 85. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 10C3 соответствуют последовательности SEQ ID NO: 26, SEQ ID NO: 27 и SEQID NO: 28, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 10C3 к PLD4 (450 н.п.) [заглавные буквы: VH вариабельный участок мышиного 10C3, строчные буквы: константный участок тяжелой цепи мышиного IgG2a]

ATGAACTTCGGGCTCAGCTTGATTTTCCTTGCCCTCATTTTAAAAGGTGTCCAGTGTGAGGTGCAGCTGGTGGAGTCTGGGGGAGACTTAGTGAGGCCTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGGATTCAGTTTCAGTAGCTATGGCATGTCTTGGTTTCGCCAGACTCCAGACAAGAGGCTGGAGTGGGTCGCAACCATTAGTAGTGGTGGTAGTTACATCTACTATCCAGAAAGTGTGAAGGGGCGATTCACCATCTCCAGAGACAATGCCAGGAACATCCTGTACCTGCAAATGAGCAGTCTGAAGTCTGAGGACACAGCCATGTATTATTGTGTAAGACTCTACGGTGGTAGGAGAGGCTATGGTTTGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAgccaaaacaacagccccatcggtctatcca

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 10C3 (150 а.о.) [заглавные буквы: VH вариабельный участок мышиного 10C3, строчные буквы: константный участок тяжелой цепи мышиного IgG2a] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 10C3

SYGMS

CDR2 в вариабельном участке тяжелой цепи антитела 10C3

TISSGGSYIYYPESVKG

CDR3 в вариабельном участке тяжелой цепи антитела 10C3

LYGGRRGYGLDY

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 10C3 к PLD4 соответствует SEQ ID NO: 104, и аминокислотная последовательность соответствует SEQ ID NO: 105. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 10C3 соответствуют последовательности SEQ ID NO: 29, SEQ ID NO: 30 и SEQID NO: 31, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 10C3 к PLD4 (423 н.п.) [заглавные буквы: VL вариабельный участок мышиного 10C3, строчные буквы: κ константная область легкой цепи мышиного Ig]

ATGAGGTTCTCTGCTCAGCTTCTGGGGCTGCTTGTGCTCTGGATCCCTGGATCCACTGCGGAAATTGTGATGACGCAGGCTGCATTCTCCAATCCAGTCACTCTTGGAACATCAGCTTCCATCTCCTGCAGGTCTAGTAAGAGTCTCCTACATAGTGATGGCATCACTTATTTGTATTGGTATCTGCAGAAGCCAGGCCAGTCTCCTCAGCTCCTGATTTATCAGATGTCCAACCTTGCCTCAGGAGTCCCAGACAGGTTCAGTAGCAGTGGGTCAGGAACTGATTTCACACTGAGAATCAGCAGAGTGGAGGCTGAGGATGTGGGTGTTTATTACTGTGCTCAAAATCTAGAACTTTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAAcgggctgatgctgcaccaactgtatccatc

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 10C3 (141 а.о.) [заглавные буквы: VL вариабельный участок мышиного 10C3, строчные буквы: κ константная область легкой цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 10C3

RSSKSLLHSDGITYLY

CDR2 в вариабельном участке легкой цепи антитела 10C3

QMSNLAS

CDR3 в вариабельном участке легкой цепи антитела 10C3

AQNLEL

[0064]

7. Мышиное антитело 11D10 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 11D10 к PLD4 соответствует SEQ ID NO: 86, и аминокислотная последовательность соответствует SEQ ID NO: 87. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 11D10 соответствуют последовательности SEQ ID NO: 26, SEQ ID NO: 27 и SEQID NO: 28, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 11D10 к PLD4 (450 н.п.) [заглавные буквы: VH вариабельный участок мышиного 11D10, строчные буквы: константный участок тяжелой цепи мышиного IgG2b]

ATGAACTTCGGGCTCAGCTTGATTTTCCTTGCCCTCATTTTAAAAGGTGTCCAGTGTGAGGTGCAGCTGGTGGAGTCTGGGGGAGACTTAGTGAGGCCTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGGATTCAGTTTCAGTAGCTATGGCATGTCTTGGTTTCGCCAGACTCCAGACAAGAGGCTGGAGTGGGTCGCAACCATTAGTAGTGGTGGTAGTTACATCTACTATCCAGAAAGTGTGAAGGGGCGATTCACCATCTCCAGAGACAATGCCAGGAACATCCTGTACCTGCAAATGAGCAGTCTGAAGTCTGAGGACACAGCCATGTATTATTGTGTAAGACTCTACGGTGGTAGGAGAGGCTATGGTTTGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAgccaaaacaacacccccatcagtctatcca

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 11D10 (150 а.о.) [заглавные буквы: VH вариабельный участок мышиного 11D10, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 11D10

SYGMS

CDR2 в вариабельном участке тяжелой цепи антитела 11D10

TISSGGSYIYYPESVKG

CDR3 в вариабельном участке тяжелой цепи антитела 11D10

LYGGRRGYGLDY

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 11D10 к PLD4 соответствует SEQ ID NO: 106, и аминокислотная последовательность соответствует SEQ ID NO: 107. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 11D10 соответствуют последовательности SEQ ID NO: 29, SEQ ID NO: 30 и SEQID NO: 31, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 11D10 к PLD4 (423 н.п.) [заглавные буквы: VL вариабельный участок мышиного 11D10, строчные буквы: κ константная область легкой цепи мышиного Ig]

ATGAGGTTCTCTGCTCAGCTTCTGGGGCTGCTTGTGCTCTGGATCCCTGGATCCACTGCGGAAATTGTGATGACGCAGGCTGCATTCTCCAATCCAGTCACTCTTGGAACATCAGCTTCCATCTCCTGCAGGTCTAGTAAGAGTCTCCTACATAGTGATGGCATCACTTATTTGTATTGGTATCTGCAGAAGCCAGGCCAGTCTCCTCAGCTCCTGATTTATCAGATGTCCAACCTTGCCTCAGGAGTCCCAGACAGGTTCAGTAGCAGTGGGTCAGGAACTGATTTCACACTGAGAATCAGCAGAGTGGAGGCTGAGGATGTGGGTGTTTATTACTGTGCTCAAAATCTAGAACTTTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAAcgggctgatgctgcaccaactgtatccatc

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 11D10 (141 а.о.) [заглавные буквы: VL вариабельный участок мышиного 11D10, строчные буквы: константная область легкой каппа-цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 11D10

RSSKSLLHSDGITYLY

CDR2 в вариабельном участке легкой цепи антитела 11D10

QMSNLAS

CDR3 в вариабельном участке легкой цепи антитела 11D10

AQNLEL

[0065]

8. Мышиное антитело 13D4 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 13D4 к PLD4 соответствует SEQ ID NO: 88, и аминокислотная последовательность соответствует SEQ ID NO: 89. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 13D4 соответствуют последовательности SEQ ID NO: 32, SEQ ID NO: 33 и SEQID NO: 34, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 13D4 к PLD4 (472 н.п.) [заглавные буквы: VH вариабельный участок мышиного 13D4, строчные буквы: константный участок тяжелой цепи мышиного IgG2b]

ATGAAAGTGTTGAGTCTGTTGTACCTGTTGACAGCCATTCCTGGTATCCTGTCTGATGTACAGCTTCAGGAGTCAGGACCTGGCCTCGTGAAACCTTCTCAATCTCTGTCTCTCACCTGCTCTGTCACTGGCTACTCCATCACCAGTCATTATTACTGGACCTGGATCCGGCAGTTTCCAGGAAACAAACTGGAATGGATGGGCTACATAAGCTACGACGGTAGCAATAACTACAACCCATCTCTCAAAAATCGAATCTCCATCACTCGTGACACATCTAAGAACCAGTTTTTCCTGAAGTTGAATTCTGTGACTACTGAGGACACAGCTACATATAACTGTGCAAGAGAGGGCCCGCTCTACTATGGTAACCCCTACTGGTATTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCAgccaaaacaacacccccatcagtctatccactggcccctaagggcg

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 13D4 (157 а.о.) [заглавные буквы: VH вариабельный участок мышиного 13D4, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 13D4

SHYYWT

CDR2 в вариабельном участке тяжелой цепи антитела 13D4

YISYDGSNNYNPSLKN

CDR3 в вариабельном участке тяжелой цепи антитела 13D4

EGPLYYGNPYWYFDV

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 13D4 к PLD4 соответствует SEQ ID NO: 108, и аминокислотная последовательность соответствует SEQ ID NO: 109. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 13D4 соответствуют последовательности SEQ ID NO: 35, SEQ ID NO: 36 и SEQID NO: 37, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 13D4 к PLD4 (404 н.п.) [заглавные буквы: VL вариабельный участок мышиного 13D4, строчные буквы: κ константная область легкой цепи мышиного Ig]

ATGATGTCCTCTGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGTACCAGATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGGGACAGAGTCACCATCAGTTGCAGGGCAAGTCAGGACATTGACAATTATTTAAACTGGTATCAGCAGAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAACCTGGAGCAAGAAGATGTTGCCACTTACTTTTGCCAGCAGTTTAATACGCTTCCTCGGACGTTCGGTGGAGGCACCAAACTGGAAATCAAAcgggctgatgctgcaccaactgt

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 13D4 (134 а.о.) [заглавные буквы: VL вариабельный участок мышиного 13D4, строчные буквы: константная область легкой каппа-цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 13D4

RASQDIDNYLN

CDR2 в вариабельном участке легкой цепи антитела 13D4

YTSRLHS

CDR3 в вариабельном участке легкой цепи антитела 13D4

QQFNTLP

[0066]

9. Мышиное антитело 13H11 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 13H11 к PLD4 соответствует SEQ ID NO: 90, и аминокислотная последовательность соответствует SEQ ID NO: 91. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 13H11 соответствуют последовательности SEQ ID NO: 38, SEQ ID NO: 39 и SEQID NO: 40, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 13H11 к PLD4 (471 н.п.) [заглавные буквы: VH вариабельный участок мышиного 13H11, строчные буквы: константный участок тяжелой цепи мышиного IgG2b]

ATGAAAGTGTTGAGTCTGTTGTACCTGTTGACAGCCATTCCTGGTATCCTGTCTGATGTACAGCTTCAGGAGTCAGGACCTGGCCTCGTGAAACCTTCTCAGTCTCTGTCTCTCACCTGCTCTGTCACTGGCTACTCCATCTCCAGTCATTATTACTGGAGTTGGATCCGGCAGTTTCCAGGAAACAGACTGGAATGGATGGGCTACATAAGCTACGACGGTAGCAATAACTACAACCCATCTCTCAAAAATCGAATCTCCATCACTCGTGACACATCTAAGAACCAGTTTTTCCTGAAGTTGAATTCTGTGACTACTGAGGACACAGCTACATATAACTGTGCAAGAGAGGGCCCGCTCTACTATGGTAACCCCTACTGGTATTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCAgccaaaacaacacccccatcagtctatccactggcccctaagggc

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 13H11 (157 а.о.) [заглавные буквы: VH вариабельный участок мышиного 13H11, строчные буквы: константный участок тяжелой цепи мышиного IgG2b] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 13H11

SHYYWS

CDR2 в вариабельном участке тяжелой цепи антитела 13H11

YISYDGSNNYNPSLKN

CDR3 в вариабельном участке тяжелой цепи антитела 13H11

EGPLYYGNPYWYFDV

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 13H11 к PLD4 соответствует SEQ ID NO: 110, и аминокислотная последовательность соответствует SEQ ID NO: 111. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 13H11 соответствуют последовательности SEQ ID NO: 41, SEQ ID NO: 42 и SEQID NO: 43, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 13H11 к PLD4 (414 н.п.) [заглавные буквы: VL вариабельный участок мышиного 13H11, строчные буквы: константная область легкой каппа-цепи мышиного Ig]

ATGATGTCCTCTGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGTACCAGATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGGGGCAGCGTCACCATCAGTTGCAGGGCAAGTCAGGACATTGACAATTATTTAAACTGGTATCAGCAAAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAACCTGGAACAAGAAGATATTGCCACTTACTTTTGCCAACAGTTTAATACGCTTCCTCGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAAcgggctgatgctgcaccaactgtatccatcttc

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 13H11 (138 а.о.) [заглавные буквы: VL вариабельный участок мышиного 13H11, строчные буквы: константная область легкой каппа-цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 13H11

RASQDIDNYLN

CDR2 в вариабельном участке легкой цепи антитела 13H11

YTSRLHS

CDR3 в вариабельном участке легкой цепи антитела 13H11

QQFNTLP

[0067]

10. Мышиное антитело 14C1 к PLD4

Нуклеотидная последовательность вариабельного участка тяжелой цепи полученного мышиного антитела 14C1 к PLD4 соответствует SEQ ID NO: 92, и аминокислотная последовательность соответствует SEQ ID NO: 93. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке тяжелой цепи мышиного антитела 14C1 соответствуют последовательности SEQ ID NO: 38, SEQ ID NO: 39 и SEQID NO: 40, соответственно.

Нуклеотидная последовательность вариабельного участка тяжелой цепи мышиного антитела 14C1 к PLD4 (470 н.п.) [заглавные буквы: VH вариабельный участок мышиного 14C1, строчные буквы: константный участок тяжелой цепи мышиного IgG1]

ATGAAAGTGTTGAGTCTGTTGTACCTGTTGACAGCCATTCCTGGTATCCTGTCTGATGTACAGCTTCAGGAGTCAGGACCTGGCCTCGTGAAACCTTCTCAGTCTCTGTCTCTCACCTGCTCTGTCACTGGCTACTCCATCTCCAGTCATTATTACTGGAGTTGGATCCGGCAGTTTCCAGGAAACAGACTGGAATGGATGGGCTACATAAGCTACGACGGTAGCAATAACTACAACCCATCTCTCAAAAATCGAATCTCCATCACTCGTGACACATCTAAGAACCAGTTTTTCCTGAAGTTGAATTCTGTGACTACTGAGGACACAGCTACATATAACTGTGCAAGAGAGGGCCCGCTCTACTATGGTAACCCCTACTGGTATTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCAgccaaaacgacacccccatctgtctatccactggcccctaaggg

Аминокислотная последовательность вариабельного участка тяжелой цепи мышиного антитела 14C1 (156 а.о.) [заглавные буквы: VH вариабельный участок мышиного 14C1, строчные буквы: константный участок тяжелой цепи мышиного IgG1] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке тяжелой цепи антитела 14C1

SHYYWS

CDR2 в вариабельном участке тяжелой цепи антитела 14C1

YISYDGSNNYNPSLKN

CDR3 в вариабельном участке тяжелой цепи антитела 14C1

EGPLYYGNPYWYFDV

Нуклеотидная последовательность вариабельного участка легкой цепи полученного мышиного антитела 14C1 к PLD4 соответствует SEQ ID NO: 112, и аминокислотная последовательность соответствует SEQ ID NO: 113. Аминокислотные последовательности CDR1, CDR2 и CDR3 в вариабельном участке легкой цепи мышиного антитела 14C1 соответствуют последовательности SEQ ID NO: 41, SEQ ID NO: 42 и SEQID NO: 43, соответственно.

Нуклеотидная последовательность вариабельного участка легкой цепи мышиного антитела 14C1 к PLD4 (465 н.п.) [заглавные буквы: VL вариабельный участок мышиного 14C1, строчные буквы: константная область легкой каппа-цепи мышиного Ig]

ATGATGTCCTCTGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGTACCAGATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGGGGCAGCGTCACCATCAGTTGCAGGGCAAGTCAGGACATTGACAATTATTTAAACTGGTATCAGCAAAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAACCTGGAACAAGAAGATATTGCCACTTACTTTTGCCAACAGTTTAATACGCTTCCTCGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAAcgggctgatgctgcaccaactgtatccatcttcccaccatccagtgagcagttaacatctggaggtgcctcagtcgtgtgcttc

Аминокислотная последовательность вариабельного участка легкой цепи мышиного антитела 14C1 (155 а.о.) [заглавные буквы: VL вариабельный участок мышиного 14C1, строчные буквы: константная область легкой каппа-цепи мышиного Ig] Подчеркнутая последовательность обозначает сигнальную последовательность, а двойное подчеркивание обозначает участки CDR (CDR1, CDR2 и CDR3).

CDR1 в вариабельном участке легкой цепи антитела 14C1

RASQDIDNYLN

CDR2 в вариабельном участке легкой цепи антитела 14C1

YTSRLHS

CDR3 в вариабельном участке легкой цепи антитела 14C1

QQFNTLP

[0068]

Последовательности оснований и аминокислотные последовательности тяжелой цепи и легкой цепи созданного рекомбинантного антитела 11G9.6 соответствуют приведенным ниже номерам последовательностей.

Тяжелая цепь

SEQ ID NO: 120 (последовательность оснований)

SEQ ID NO: 121 (аминокислотная последовательность)

Легкая цепь

SEQ ID NO: 122 (последовательность оснований)

SEQ ID NO: 123 (аминокислотная последовательность)

[0069]

11. Нуклеотидная последовательность тяжелой цепи рекомбинантного антитела 11G9.6 к PLD4 (1401 н.п.) [заглавные буквы: VH вариабельный участок рекомбинантного 11G9, строчные буквы: константный участок тяжелой цепи человеческого IgG1] (SEQ ID NO: 120)

ATGAAAGTGTTGAGTCTGTTGTACCTGTTGACAGCCATTCCTGGTATCCTGTCTcagGTCCAACTGCAGCAGCCTGGGGCTGAACTGGTGAAGCCTGGGACTTCAGTGAAAATGTCCTGCAAGGCTTCTGGCTACACCTTCACCAGCTACTGGATGCACTGGGTGAAGCAGAGGCCGGGACAAGGCCTTGAGTGGATTGGAGATATTTATCCTGGTAGTGATAGTACTAACTACAATGAGAAGTTCAAGAGCAAGGCCACACTGACTGTAGACACATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCAAGAGGAGGGTGGTTGGATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAgctagcaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctgggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaatga

[0070]

12. Аминокислотная последовательность тяжелой цепи рекомбинантного антитела 11G9.6 к PLD4 (466 а.о.) [заглавные буквы: VH вариабельный участок рекомбинантного 11G9, строчные буквы: константный участок тяжелой цепи человеческого IgG1] (SEQ ID NO: 121)

MKVLSLLYLLTAIPGILSQVQLQQPGAELVKPGTSVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGDIYPGSDSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSEDSAVYYCARGGWLDAMDYWGQGTSVTVSSastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk

[0071]

13. Нуклеотидная последовательность легкой цепи рекомбинантного антитела 11G9.6 к PLD4 (705 н.п.) [заглавные буквы: VL вариабельный участок рекомбинантного 11G9, строчные буквы: константная область легкой каппа-цепи Ig человека] (SEQ ID NO: 122)

ATGATGTCCTCTGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGTACCAGATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGCAAGTCAGGACATTAGCAATTATTTAAACTGGTATCAGCAGAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTTTTGCCAACAGGGTAATACGCTTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAAcgaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgagctcgcccgtcacaaagagcttcaacaggggagagtgctag

[0072]

14. Аминокислотная последовательность легкой цепи рекомбинантного антитела 11G9.6 к PLD4 (234 а.о.) [заглавные буквы: VL вариабельный участок рекомбинантного 11G9, строчные буквы: константная область легкой каппа-цепи Ig человека] (SEQ ID NO: 123)

MMSSAQFLGLLLLCFQGTRCDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIKrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

[0073]

<кДНК и белковые последовательности PLD4-связанных молекул >

> кДНК PLD4 человека (1521 н.п.) (SEQ ID NO: 44)

ATGCTGAAGCCTCTTTGGAAAGCAGCAGTGGCCCCCACATGGCCATGCTCCATGCCGCCCCGCCGCCCGTGGGACAGAGAGGCTGGCACGTTGCAGGTCCTGGGAGCGCTGGCTGTGCTGTGGCTGGGCTCCGTGGCTCTTATCTGCCTCCTGTGGCAAGTGCCCCGTCCTCCCACCTGGGGCCAGGTGCAGCCCAAGGACGTGCCCAGGTCCTGGGAGCATGGCTCCAGCCCAGCTTGGGAGCCCCTGGAAGCAGAGGCCAGGCAGCAGAGGGACTCCTGCCAGCTTGTCCTTGTGGAAAGCATCCCCCAGGACCTGCCATCTGCAGCCGGCAGCCCCTCTGCCCAGCCTCTGGGCCAGGCCTGGCTGCAGCTGCTGGACACTGCCCAGGAGAGCGTCCACGTGGCTTCATACTACTGGTCCCTCACAGGGCCTGACATCGGGGTCAACGACTCGTCTTCCCAGCTGGGAGAGGCTCTTCTGCAGAAGCTGCAGCAGCTGCTGGGCAGGAACATTTCCCTGGCTGTGGCCACCAGCAGCCCGACACTGGCCAGGACATCCACCGACCTGCAGGTTCTGGCTGCCCGAGGTGCCCATGTACGACAGGTGCCCATGGGGCGGCTCACCAGGGGTGTTTTGCACTCCAAATTCTGGGTTGTGGATGGACGGCACATATACATGGGCAGTGCCAACATGGACTGGCGGTCTCTGACGCAGGTGAAGGAGCTTGGCGCTGTCATCTATAACTGCAGCCACCTGGCCCAAGACCTGGAGAAGACCTTCCAGACCTACTGGGTACTGGGGGTGCCCAAGGCTGTCCTCCCCAAAACCTGGCCTCAGAACTTCTCATCTCACTTCAACCGTTTCCAGCCCTTCCACGGCCTCTTTGATGGGGTGCCCACCACTGCCTACTTCTCAGCGTCGCCACCAGCACTCTGTCCCCAGGGCCGCACCCGGGACCTGGAGGCGCTGCTGGCGGTGATGGGGAGCGCCCAGGAGTTCATCTATGCCTCCGTGATGGAGTATTTCCCCACCACGCGCTTCAGCCACCCCCCGAGGTACTGGCCGGTGCTGGACAACGCGCTGCGGGCGGCAGCCTTCGGCAAGGGCGTGCGCGTGCGCCTGCTGGTCGGCTGCGGACTCAACACGGACCCCACCATGTTCCCCTACCTGCGGTCCCTGCAGGCGCTCAGCAACCCCGCGGCCAACGTCTCTGTGGACGTGAAAGTCTTCATCGTGCCGGTGGGGAACCATTCCAACATCCCATTCAGCAGGGTGAACCACAGCAAGTTCATGGTCACGGAGAAGGCAGCCTACATAGGCACCTCCAACTGGTCGGAGGATTACTTCAGCAGCACGGCGGGGGTGGGCTTGGTGGTCACCCAGAGCCCTGGCGCGCAGCCCGCGGGGGCCACGGTGCAGGAGCAGCTGCGGCAGCTCTTTGAGCGGGACTGGAGTTCGCGCTACGCCGTCGGCCTGGACGGACAGGCTCCGGGCCAGGACTGCGTTTGGCAGGGCTGA

> Белок PLD4 человека (506 аминокислот) (SEQ ID NO: 1)

MLKPLWKAAVAPTWPCSMPPRRPWDREAGTLQVLGALAVLWLGSVALICLLWQVPRPPTWGQVQPKDVPRSWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQAWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSSPTLARTSTDLQVLAARGAHVRQVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQVKELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPPRYWPVLDNALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSNIPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQLFERDWSSRYAVGLDGQAPGQDCVWQG

> кДНК PLD4 яванской макаки (1521 н.п.) (SEQ ID NO: 63)

ATGCTGAAGCCTCTTCGGAGAGCgGCAGTGACCCCCATGTGGCCGTGCTCCATGCTGCCCCGCCGCCTGTGGGACAGAGAGGCTGGCACGTTGCAGGTCCTGGGAGTGCTGGCTATGCTGTGGCTGGGCTCCATGGCTCTTACCTACCTCCTGTGGCAAGTGCGCCGTCCTCCCACCTGGGGCCAGGTGCAGCCCAAGGACGTGCCCAGGTCCTGGGGGCATGGTTCCAGCCCAGCTCTGGAGCCCCTGGAAGCGGAGGTCAGGAAGCAGAGGGACTCCTGCCAGCTTGTCCTTGTGGAAAGCATCCCCCAGGACCTGCCATTTGCAGCCGGCAGCCTCTCCGCCCAGCCTCTGGGCCAGGCCTGGCTGCAGCTGCTGGACACTGCCCAGGAGAGCGTCCACGTGGCTTCATACTACTGGTCCCTCACAGGGCCCGACATTGGGGTCAACGACTCATCTTCCCAGCTGGGAGAGGCCCTTCTGCAGAAGCTGCAGCAGCTGCTGGGCAGGAACATTTCCTTGGCTGTGGCCACCAGCAGTCCAACACTGGCCAGGAAGTCCACCGACCTGCAGGTCCTGGCTGCCCGAGGTGCCCAGGTACGACGGGTGCCCATGGGGCGGCTCACCAGGGGCGTTTTGCACTCCAAATTCTGGGTTGTGGATGGACgGCACATATACATGGGCAGTGCcAACATGGACTGGCGGTCCCTGACGCAGGTGAAGGAGCTTGGCGCTGTCATCTATAACTGCAGCCACCTGGCCCAAGACCTGGAGAAGACCTTCCAGACCTACTGGGTGCTGGGGGTGCCCAAGGCTGTCCTCCCCAAAACCTGGCCTCAGAACTTCTCATCTCACATCAACCGTTTCCAGCCCTTCCAGGGCCTCTTTGATGGGGTGCCCACCACTGCCTACTTCTCAGCATCGCCACCcGCACTCTGTCCCCAGGGCCGCACCCCTGACCTGGAGGCGCTGTTGGCGGTGATGGGGAGCGCCCAGGAGTTCATCTATGCCTCCGTGATGGAGTATTTCCCTACCACgCGCTTCAGCCACCCCCGCAGGTACTGGCCGGTGCTGGACAACGCGCTGCGGGCGGCAGCCTTCAGCAAGGGTGTGCGCGTGCGCCTGCTGGTCAGCTGCGGACTCAACACGGACCCCACCATGTTCCCCTATCTGCGGTCCCTGCAGGCGCTCAGCAACCCCGCGGCCAACGTCTCTGTGGACGTGAAAGTCTTCATCGTGCCGGTGGGGAATCATTCCAACATCCCGTTCAGCAGGGTGAACCACAGCAAGTTCATGGTCACGGAGAAGGCAGCCTACATAGGCACCTCCAACTGGTCGGAGGATTACTTCAGCAGCACGACGGGGGTGGGCCTGGTGGTCACCCAGAGCCCCGGCGCGCAGCCCGCGGGGGCCACGGTACAGGAGCAGCTGCGGCAGCTCTTTGAGCGGGACTGGAGTTCGCGCTACGCCGTCGGCCTGGACGGACAGGCTCCGGGCCAGGACTGCGTTTGGCAGGGCTGA

> Белок PLD4 яванской макаки (506 аминокислот) (SEQ ID NO: 129)

MLKPLRRAAVTPMWPCSMLPRRLWDREAGTLQVLGVLAMLWLGSMALTYLLWQVRRPPTWGQVQPKDVPRSWGHGSSPALEPLEAEVRKQRDSCQLVLVESIPQDLPFAAGSLSAQPLGQAWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSSPTLARKSTDLQVLAARGAQVRRVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQVKELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHINRFQPFQGLFDGVPTTAYFSASPPALCPQGRTPDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPRRYWPVLDNALRAAAFSKGVRVRLLVSCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSNIPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTTGVGLVVTQSPGAQPAGATVQEQLRQLFERDWSSRYAVGLDGQAPGQDCVWQG

> кДНК PLD4 макаки-резус (1521 н.п.) (SEQ ID NO: 124)

ATGCTGAAGCCTCTTCGGAGAGCGGCAGTGACCCCCATGTGGCCGTGCTCCATGCTGCCCCGCCGCCTGTGGGACAGAGAGGCTGGCACGTTGCAGGTCCTGGGAGTGCTGGCTATGCTGTGGCTGGGCTCCATGGCTCTTACCTACCTCCTGTGGCAAGTGCGCTGTCCTCCCACCTGGGGCCAGGTGCAGCCCAGGGACGTGCCCAGGTCCTGGGGGCATGGTTCCAGCCTAGCTCTGGAGCCCCTGGAAGCGGAGGTCAGGAAGCAGAGGGACTCCTGCCAGCTTGTCCTTGTGGAAAGCATCCCCCAGGACCTGCCATTTGCAGCCGGCAGCCTCTCCGCCCAGCCTCTGGGCCAGGCCTGGCTGCAGCTGCTGGACACTGCCCAGGAGAGCGTCCACGTGGCTTCATACTACTGGTCCCTCACAGGGCCCGACATTGGGGTCAACGACTCATCTTCCCAGCTGGGAGAGGCCCTTCTGCAGAAGCTGCAGCAGCTGCTGGGCAGGAACATTTCCTTGGCTGTGGCCACCAGCAGTCCAACACTGGCCAGGAAGTCCACCGACCTGCAGGTCCTGGCTGCCCGAGGTGCCCAGGTACGACGGGTGCCCATGGGGCGGCTCACCAGGGGCGTTTTGCACTCCAAATTCTGGGTTGTGGATGGACGGCACATATACATGGGCAGTGCCAACATGGACTGGCGGTCCCTGACGCAGGTGAAGGAGCTTGGCGCTGTCATCTATAACTGCAGCCACCTGGCCCAAGACCTGGAGAAGACCTTCCAGACCTACTGGGTGCTGGGGGTGCCCAAGGCTGTCCTCCCCAAAACCTGGCCTCAGAACTTCTCATCTCACATCAACCGTTTCCAGCCCTTCCAGGGCCTCTTTGATGGGGTGCCCACCACTGCCTACTTCTCAGCATCGCCACCCGCACTCTGTCCCCAGGGCCGCACCCCTGACCTGGAGGCGCTGTTGGCGGTGATGGGGAGCGCCCAGGAGTTCATCTATGCCTCCGTGATGGAGTATTTCCCTACCACGCGCTTCAGCCACCCCCGCAGGTACTGGCCGGTGCTGGACAACGCGCTGCGGGCGGCAGCCTTCAGCAAGGGTGTGCGCGTGCGCCTGCTGGTCAGCTGCGGACTCAACACGGACCCCACCATGTTCCCCTATCTGCGGTCCCTGCAGGCGCTCAGCAACCCCGCGGCCAACGTCTCTGTGGACGTGAAAGTCTTCATCGTGCCGGTGGGGAATCATTCCAACATCCCGTTCAGCAGGGTGAACCACAGCAAGTTCATGGTCACGGAGAAGGCAGCCTACATAGGCACCTCCAACTGGTCGGAGGATTACTTCAGCAGCACGACGGGGGTGGGCCTGGTGGTCACCCAGAGCCCCGGCGCGCAGCCCGCGGGGGCCACGGTACAGGAGCAGCTGCGGCAGCTCTTTGAGCGGGACTGGAGTTCGCGCTACGCCGTCGGCCTGGACGGACAGGCTCCGGGCCAGGACTGCGTTTGGCAGGGCTGA

> Белок PLD4 макаки-резус (506 аминокислот) (SEQ ID NO: 130)

MLKPLRRAAVTPMWPCSMLPRRLWDREAGTLQVLGVLAMLWLGSMALTYLLWQVRCPPTWGQVQPRDVPRSWGHGSSLALEPLEAEVRKQRDSCQLVLVESIPQDLPFAAGSLSAQPLGQAWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSSPTLARKSTDLQVLAARGAQVRRVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQVKELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHINRFQPFQGLFDGVPTTAYFSASPPALCPQGRTPDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPRRYWPVLDNALRAAAFSKGVRVRLLVSCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSNIPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTTGVGLVVTQSPGAQPAGATVQEQLRQLFERDWSSRYAVGLDGQAPGQDCVWQG

> PLD4 кДНК мыши (1512 пар оснований) (SEQ ID NO: 131)

ATGGACAAGAAGAAAGAGCACCCAGAGATGCGGATACCACTCCAGACAGCAGTGGAGGTCTCTGATTGGCCCTGCTCCACATCTCATGATCCACATAGCGGACTTGGCATGGTACTGGGGATGCTAGCTGTACTGGGACTCAGCTCTGTGACTCTCATCTTGTTCCTGTGGCAAGGGGCCACTTCTTTCACCAGTCATCGGATGTTCCCTGAGGAAGTGCCCTCCTGGTCCTGGGAGACCCTGAAAGGAGACGCTGAGCAGCAGAATAACTCCTGTCAGCTCATCCTTGTGGAAAGCATCCCCGAGGACTTGCCATTTGCAGCTGGCAGCCCCACTGCCCAGCCCCTGGCCCAGGCTTGGCTGCAGCTTCTTGACACTGCTCGGGAGAGCGTCCACATTGCCTCGTACTACTGGTCCCTCACTGGACTGGACATTGGAGTCAATGACTCGTCTTCTCGGCAGGGAGAGGCCCTTCTACAGAAGTTCCAACAGCTTCTTCTCAGGAACATCTCTGTGGTGGTGGCCACCCACAGCCCAACATTGGCCAAGACATCCACTGACCTCCAGGTCTTGGCTGCCCATGGTGCCCAGATACGACAAGTGCCCATGAAACAGCTTACTGGGGGTGTTCTACACTCCAAATTCTGGGTTGTGGATGGGCGACACGTCTACGTGGGCAGCGCCAACATGGACTGGCGGTCCCTGACTCAGGTGAAGGAACTTGGTGCAATCATCTACAACTGCAGCAACCTGGCTCAAGACCTTGAGAAAACATTCCAGACCTACTGGGTGCTAGGGACTCCCCAAGCTGTTCTCCCTAAAACCTGGCCTCGGAACTTCTCATCCCACATCAACCGCTTCCATCCCTTGCGGGGTCCCTTTGATGGGGTTCCCACCACGGCCTATTTCTCGGCCTCCCCTCCCTCCCTCTGCCCGCATGGCCGGACCCGGGATCTGGACGCAGTGTTGGGAGTGATGGAGGGTGCTCGCCAGTTCATCTATGTCTCGGTGATGGAGTATTTCCCTACCACGCGCTTCACCCACCATGCCAGGTACTGGCCCGTGCTGGACAATGCGCTACGGGCAGCGGCCCTCAATAAGGGTGTGCATGTGCGCTTACTGGTCAGCTGCTGGTTCAACACAGACCCCACCATGTTCGCTTATCTGAGGTCCCTGCAGGCTTTCAGTAACCCCTCGGCTGGCATCTCAGTGGATGTGAAAGTCTTCATCGTGCCTGTGGGAAATCATTCCAACATCCCGTTCAGCCGCGTGAACCACAGCAAGTTCATGGTCACAGACAAGACAGCCTATGTAGGCACCTCTAACTGGTCAGAAGACTACTTCAGCCACACCGCTGGTGTGGGCCTGATTGTCAGCCAGAAGACCCCCAGAGCCCAGCCAGGCGCAACCACCGTGCAGGAGCAGCTGAGGCAACTCTTTGAACGAGACTGGAGTTCCCACTATGCTATGGACCTAGACAGACAAGTCCCGAGCCAGGACTGTGTCTGGTAG

>Белок PLD4 мыши (503 аминокислот) (SEQ ID NO: 132)

MDKKKEHPEMRIPLQTAVEVSDWPCSTSHDPHSGLGMVLGMLAVLGLSSVTLILFLWQGATSFTSHRMFPEEVPSWSWETLKGDAEQQNNSCQLILVESIPEDLPFAAGSPTAQPLAQAWLQLLDTARESVHIASYYWSLTGLDIGVNDSSSRQGEALLQKFQQLLLRNISVVVATHSPTLAKTSTDLQVLAAHGAQIRQVPMKQLTGGVLHSKFWVVDGRHVYVGSANMDWRSLTQVKELGAIIYNCSNLAQDLEKTFQTYWVLGTPQAVLPKTWPRNFSSHINRFHPLRGPFDGVPTTAYFSASPPSLCPHGRTRDLDAVLGVMEGARQFIYVSVMEYFPTTRFTHHARYWPVLDNALRAAALNKGVHVRLLVSCWFNTDPTMFAYLRSLQAFSNPSAGISVDVKVFIVPVGNHSNIPFSRVNHSKFMVTDKTAYVGTSNWSEDYFSHTAGVGLIVSQKTPRAQPGATTVQEQLRQLFERDWSSHYAMDLDRQVPSQDCVW

>Последовательность кДНК PLD3 человека (SEQ ID NO: 55)

ATGAAGCCTAAACTGATGTACCAGGAGCTGAAGGTGCCTGCAGAGGAGCCCGCCAATGAGCTGCCCATGAATGAGATTGAGGCGTGGAAGGCTGCGGAAAAGAAAGCCCGCTGGGTCCTGCTGGTCCTCATTCTGGCGGTTGTGGGCTTCGGAGCCCTGATGACTCAGCTGTTTCTATGGGAATACGGCGACTTGCATCTCTTTGGGCCCAACCAGCGCCCAGCCCCCTGCTATGACCCTTGCGAAGCAGTGCTGGTGGAAAGCATTCCTGAGGGCCTGGACTTCCCCAATGCCTCCACGGGGAACCCTTCCACCAGCCAGGCCTGGCTGGGCCTGCTCGCCGGTGCGCACAGCAGCCTGGACATCGCCTCCTTCTACTGGACCCTCACCAACAATGACACCCACACGCAGGAGCCCTCTGCCCAGCAGGGTGAGGAGGTCCTCCGGCAGCTGCAGACCCTGGCACCAAAGGGCGTGAACGTCCGCATCGCTGTGAGCAAGCCCAGCGGGCCCCAGCCACAGGCGGACCTGCAGGCTCTGCTGCAGAGCGGTGCCCAGGTCCGCATGGTGGACATGCAGAAGCTGACCCATGGCGTCCTGCATACCAAGTTCTGGGTGGTGGACCAGACCCACTTCTACCTGGGCAGTGCCAACATGGACTGGCGTTCACTGACCCAGGTCAAGGAGCTGGGCGTGGTCATGTACAACTGCAGCTGCCTGGCTCGAGACCTGACCAAGATCTTTGAGGCCTACTGGTTCCTGGGCCAGGCAGGCAGCTCCATCCCATCAACTTGGCCCCGGTTCTATGACACCCGCTACAACCAAGAGACACCAATGGAGATCTGCCTCAATGGAACCCCTGCTCTGGCCTACCTGGCGAGTGCGCCCCCACCCCTGTGTCCAAGTGGCCGCACTCCAGACCTGAAGGCTCTACTCAACGTGGTGGACAATGCCCGGAGTTTCATCTACGTCGCTGTCATGAACTACCTGCCCACTCTGGAGTTCTCCCACCCTCACAGGTTCTGGCCTGCCATTGACGATGGGCTGCGGCGGGCCACCTACGAGCGTGGCGTCAAGGTGCGCCTGCTCATCAGCTGCTGGGGACACTCGGAGCCATCCATGCGGGCCTTCCTGCTCTCTCTGGCTGCCCTGCGTGACAACCATACCCACTCTGACATCCAGGTGAAACTCTTTGTGGTCCCCGCGGATGAGGCCCAGGCTCGAATCCCATATGCCCGTGTCAACCACAACAAGTACATGGTGACTGAACGCGCCACCTACATCGGAACCTCCAACTGGTCTGGCAACTACTTCACGGAGACGGCGGGCACCTCGCTGCTGGTGACGCAGAATGGGAGGGGCGGCCTGCGGAGCCAGCTGGAGGCCATTTTCCTGAGGGACTGGGACTCCCCTTACAGCCATGACCTTGACACCTCAGCTGACAGCGTGGGCAACGCCTGCCGCCTGCTCTGA

>Белок PLD3 человека (490 аминокислот) (SEQ ID NO: 127)

MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLRRATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYMVTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL

> кДНК PLD5 человека (1338 пар оснований) (SEQ ID NO: 56)

ATGGGAGAGGATGAGGATGGACTCTCAGAAAAAAATTGCCAAAATAAATGTCGAATTGCCCTGGTGGAAAATATTCCTGAAGGCCTTAACTATTCAGAAAATGCACCATTTCACTTATCACTTTTCCAAGGCTGGATGAATTTACTCAACATGGCCAAAAAGTCTGTTGACATAGTGTCTTCCCATTGGGATCTCAACCACACTCATCCATCAGCATGTCAGGGTCAACGTCTTTTTGAAAAGTTGCTCCAGCTGACTTCGCAAAATATTGAAATCAAGCTAGTGAGTGATGTAACAGCTGATTCAAAGGTATTAGAAGCCTTGAAATTAAAGGGAGCCGAGGTGACGTACATGAACATGACCGCTTACAACAAGGGCCGGCTGCAGTCCTCCTTCTGGATCGTGGACAAACAGCACGTGTATATCGGCAGTGCCGGTTTGGACTGGCAATCCCTGGGACAGATGAAAGAACTCGGTGTCATCTTCTACAACTGCAGCTGCCTGGTCCTAGATTTACAAAGGATATTTGCTCTATATAGTTCATTAAAATTCAAAAGCAGAGTGCCTCAAACCTGGTCCAAAAGACTCTATGGAGTCTATGACAATGAAAAGAAATTGCAACTTCAGTTGAATGAAACCAAATCTCAAGCATTTGTATCGAATTCTCCAAAACTCTTTTGCCCTAAAAACAGAAGTTTTGACATAGATGCCATCTACAGTGTGATAGATGATGCCAAGCAGTATGTGTACATCGCTGTCATGGACTACCTGCCTATCTCCAGCACAAGCACCAAAAGGACTTACTGGCCAGACTTGGATGCAAAAATAAGAGAAGCATTAGTTTTACGAAGCGTTAGAGTTCGACTCCTTTTAAGCTTCTGGAAGGAAACTGATCCCCTTACGTTTAACTTTATTTCATCTCTTAAAGCGATTTGCACTGAAATAGCCAACTGCAGTTTGAAAGTTAAATTTTTTGATCTGGAAAGAGAGAATGCTTGTGCTACAAAAGAACAAAAGAATCACACCTTTCCTAGGTTAAATCGCAACAAGTACATGGTGACAGATGGAGCAGCTTATATTGGAAATTTTGATTGGGTAGGGAATGATTTCACTCAGAATGCTGGCACGGGCCTTGTTATCAACCAGGCAGATGTGAGGAACAACAGAAGCATCATTAAGCAACTTAAAGATGTGTTTGAAAGGGACTGGTATTCACCGTATGCCAAAACCTTACAGCCAACCAAACAGCCGAACTGCTCAAGCCTGTTCAAACTCAAACCCCTCTCCAACAAAACTGCCACAGACGACACAGGCGGAAAGGATCCCCGGAACGTATGA

> PLD5 белок человека (445 аминокислот) (SEQ ID NO: 128)

MGEDEDGLSEKNCQNKCRIALVENIPEGLNYSENAPFHLSLFQGWMNLLNMAKKSVDIVSSHWDLNHTHPSACQGQRLFEKLLQLTSQNIEIKLVSDVTADSKVLEALKLKGAEVTYMNMTAYNKGRLQSSFWIVDKQHVYIGSAGLDWQSLGQMKELGVIFYNCSCLVLDLQRIFALYSSLKFKSRVPQTWSKRLYGVYDNEKKLQLQLNETKSQAFVSNSPKLFCPKNRSFDIDAIYSVIDDAKQYVYIAVMDYLPISSTSTKRTYWPDLDAKIREALVLRSVRVRLLLSFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLERENACATKEQKNHTFPRLNRNKYMVTDGAAYIGNFDWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTATDDTGGKDPRNV

> кДНК рекомбинационного белка PLD4-Ig человека (2142 н.п.) (SEQ ID NO: 125)

ATGGAGTTTCAGACCCAGGTCTTTGTATTCGTGTTGCTCTGGTTGTCTGGTGTTGATGGAgattacaaggatgacgacgataaaGGATCCcccagagggcccacaatcaagccctgtcctccatgcaaatgcccagcacctaacctcttgggtggaccatccgtcttcatcttccctccaaagatcaaggatgtactcatgatctccctgagccccatagtcacatgtgtggtggtggatgtgagcgaggatgacccagatgtccagatcagctggtttgtgaacaacgtggaagtacacacagctcagacacaaacccatagagaggattacaacagtactctccgggtggtcagtgccctccccatccagcaccaggactggatgagtggcaaggagttcaaatgcaaggtcaacaacaaagacctcccagcgcccatcgagagaaccatctcaaaacccaaagggtcagtaagagctccacaggtatatgtcttgcctccaccagaagaagagatgactaagaaacaggtcactctgacctgcatggtcacagacttcatgcctgaagacatttacgtggagtggaccaacaacgggaaaacagagctaaactacaagaacactgaaccagtcctggactctgatggttcttacttcatgtacagcaagctgagagtggaaaagaagaactgggtggaaagaaatagctactcctgttcagtggtccacgagggtctgcacaatcaccacacgactaagagcttctcccggactccgggtaaaCGTCCTCCCACCTGGGGCCAGGTGCAGCCCAAGGACGTGCCCAGGTCCTGGGAGCATGGCTCCAGCCCAGCTTGGGAGCCCCTGGAAGCAGAGGCCAGGCAGCAGAGGGACTCCTGCCAGCTTGTCCTTGTGGAAAGCATCCCCCAGGACCTGCCATCTGCAGCCGGCAGCCCCTCTGCCCAGCCTCTGGGCCAGGCCTGGCTGCAGCTGCTGGACACTGCCCAGGAGAGCGTCCACGTGGCTTCATACTACTGGTCCCTCACAGGGCCTGACATCGGGGTCAACGACTCGTCTTCCCAGCTGGGAGAGGCTCTTCTGCAGAAGCTGCAGCAGCTGCTGGGCAGGAACATTTCCCTGGCTGTGGCCACCAGCAGCCCGACACTGGCCAGGACATCCACCGACCTGCAGGTTCTGGCTGCCCGAGGTGCCCATGTACGACAGGTGCCCATGGGGCGGCTCACCAGGGGTGTTTTGCACTCCAAATTCTGGGTTGTGGATGGACGGCACATATACATGGGCAGTGCCAACATGGACTGGCGGTCTCTGACGCAGGTGAAGGAGCTTGGCGCTGTCATCTATAACTGCAGCCACCTGGCCCAAGACCTGGAGAAGACCTTCCAGACCTACTGGGTACTGGGGGTGCCCAAGGCTGTCCTCCCCAAAACCTGGCCTCAGAACTTCTCATCTCACTTCAACCGTTTCCAGCCCTTCCACGGCCTCTTTGATGGGGTGCCCACCACTGCCTACTTCTCAGCGTCGCCACCAGCACTCTGTCCCCAGGGCCGCACCCGGGACCTGGAGGCGCTGCTGGCGGTGATGGGGAGCGCCCAGGAGTTCATCTATGCCTCCGTGATGGAGTATTTCCCCACCACGCGCTTCAGCCACCCCCCGAGGTACTGGCCGGTGCTGGACAACGCGCTGCGGGCGGCAGCCTTCGGCAAGGGCGTGCGCGTGCGCCTGCTGGTCGGCTGCGGACTCAACACGGACCCCACCATGTTCCCCTACCTGCGGTCCCTGCAGGCGCTCAGCAACCCCGCGGCCAACGTCTCTGTGGACGTGAAAGTCTTCATCGTGCCGGTGGGGAACCATTCCAACATCCCATTCAGCAGGGTGAACCACAGCAAGTTCATGGTCACGGAGAAGGCAGCCTACATAGGCACCTCCAACTGGTCGGAGGATTACTTCAGCAGCACGGCGGGGGTGGGCTTGGTGGTCACCCAGAGCCCTGGCGCGCAGCCCGCGGGGGCCACGGTGCAGGAGCAGCTGCGGCAGCTCTTTGAGCGGGACTGGAGTTCGCGCTACGCCGTCGGCCTGGACGGACAGGCTCCGGGCCAGGACTGCGTTTGGCAGGGCTGA

> Слитый белок PLD4-Ig человека (713 аминокислот) (SEQ ID NO: 126)

MEFQTQVFVFVLLWLSGVDGDYKDDDDKGSPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKRPPTWGQVQPKDVPRSWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQAWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSSPTLARTSTDLQVLAARGAHVRQVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQVKELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPPRYWPVLDNALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSNIPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQLFERDWSSRYAVGLDGQAPGQDCVWQG

УЧЕТНЫЕ НОМЕРА

[0074]

NITE ABP-1211

NITE ABP-1212

NITE ABP-1213

NITE ABP-1214

СВОБОДНЫЙ ТЕКСТ ПЕРЕЧНЯ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

[0075]

SEQ ID NO: 45: Прямой праймер

SEQ ID NO: 46: Обратный праймер

SEQ ID NO: 47: Прямой праймер

SEQ ID NO: 48: Обратный праймер

SEQ ID NO: 49: Прямой праймер

SEQ ID NO: 50: Обратный праймер

SEQ ID NO: 51: Прямой праймер

SEQ ID NO: 52: Обратный праймер

SEQ ID NO: 53: Прямой праймер

SEQ ID NO: 54: Обратный праймер

SEQ ID NO: 70: Якорный праймер

SEQ ID NO: 70: n обозначает деоксиинозин

SEQ ID NO: 71: праймер AUAP

SEQ ID NO: 72: Праймер

SEQ ID NO: 73: Праймер

SEQ ID NO: 114: Праймер

SEQ ID NO: 115: Праймер

SEQ ID NO: 116: Праймер

SEQ ID NO: 117: Праймер

SEQ ID NO: 118: Праймер

SEQ ID NO: 119: Праймер

[Перечень последовательностей]

1. Моноклональное антитело или фрагмент антитела, содержащий его антигенсвязывающий участок, которое связывается с белком фосфолипазы D4 (PLD4), содержащее:

(a) CDR1 тяжелой цепи с последовательностью SEQ ID NO:2,

CDR2 тяжелой цепи с последовательностью SEQ ID NO:3,

CDR3 тяжелой цепи с последовательностью SEQ ID NO:4,

CDR1 легкой цепи с последовательностью SEQ ID NO:5,

CDR2 легкой цепи с последовательностью SEQ ID NO:6, и

CDR3 легкой цепи с последовательностью SEQ ID NO:7;

(b) CDR1 тяжелой цепи с последовательностью SEQ ID NO:8,

CDR2 тяжелой цепи с последовательностью SEQ ID NO:9,

CDR3 тяжелой цепи с последовательностью SEQ ID NO:10,

CDR1 легкой цепи с последовательностью SEQ ID NO:11,

CDR2 легкой цепи с последовательностью SEQ ID NO:12, и

CDR3 легкой цепи с последовательностью SEQ ID NO:13;

(c) CDR1 тяжелой цепи с последовательностью SEQ ID NO:14,

CDR2 тяжелой цепи с последовательностью SEQ ID NO:15,

CDR3 тяжелой цепи с последовательностью SEQ ID NO:16,

CDR1 легкой цепи с последовательностью SEQ ID NO:17,

CDR2 легкой цепи с последовательностью SEQ ID NO:18, и

CDR3 легкой цепи с последовательностью SEQ ID NO:19;

(d) CDR1 тяжелой цепи с последовательностью SEQ ID NO:32,

CDR2 тяжелой цепи с последовательностью SEQ ID NO:33,

CDR3 тяжелой цепи с последовательностью SEQ ID NO:34,

CDR1 легкой цепи с последовательностью SEQ ID NO:35,

CDR2 легкой цепи с последовательностью SEQ ID NO:36, и

CDR3 легкой цепи с последовательностью SEQ ID NO:37; или

(e) DR1 тяжелой цепи с последовательностью SEQ ID NO:38,

CDR2 тяжелой цепи с последовательностью SEQ ID NO:39,

CDR3 тяжелой цепи с последовательностью SEQ ID NO:40,

CDR1 легкой цепи с последовательностью SEQ ID NO:41,

CDR2 легкой цепи с последовательностью SEQ ID NO:42, и

CDR3 легкой цепи с последовательностью SEQ ID NO:43.

2. Моноклональное антитело или фрагмент антитела, содержащий его антигенсвязывающий участок, по п.1, содержащее:

(a) вариабельный участок тяжелой цепи последовательности SEQ ID NO:75, который представляет собой:

QVQLQQPGAELVKPGTSVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGDIYPGSDSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSEDSAVYYCARGGWLDAMDYWGQGTSVTVSS,

и вариабельный участок легкой цепи последовательности SEQ ID NO:95, который представляет собой:

DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIK;

(b) вариабельный участок тяжелой цепи последовательности SEQ ID NO:77, который представляет собой:

EVQLQQSGTVLSRPGASVTMSCKASGDSFTTYWMHWVKQRPGQGLEWIGAIYPGNSETSYNQKFKGKAKLTAVTSASTAYMEFTSLTNEDSAVYYCTGGYSDFDYWGQGTTLTVSS,

и вариабельный участок легкой цепи последовательности SEQ ID NO:97, который представляет собой:

DILMTQSPSSMSVSLGDTVSITCHASQGIRSNIGWLQQKPGKSFKGLIFHGTNLEDGVPSRFSGRGSGADYSLTINSLESEDFADYYCVQYVQFPPTFGSGTKLEIR;

(c) вариабельный участок тяжелой цепи последовательности SEQ ID NO:79, который представляет собой:

EVQLQQSGPELVKPGASVKISCKASGYTFTDYNLHWVKQSHGKSLEWIGYIYPYNGNTGYNQKFKRKATLTVDNSSGTVYMELRSLTSEDSAVYYCARGGIYDDYYDYAIDYWGQGTSVTVSS,

и вариабельный участок легкой цепи последовательности SEQ ID NO:99, который представляет собой:

DIQMTQSPASLSVSVGETVAITCRASENIYSHIAWYQQKEGKSPQRLVYGATNLAHGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTPWTFGGGTKLEIK;

(d) вариабельный участок тяжелой цепи последовательности SEQ ID NO:81, который представляет собой:

EVQLQQSGPELVKPGASVKISCKASGYTFTDYNLHWVKQSHGKSLEWIGYIYPYNGNTGYNQKFKRKATLTVDNSSGTVYMELRSLTSEDSAVYYCARGGIYDDYYDYAIDYWGQGTSVTVSS,

и вариабельный участок легкой цепи последовательности SEQ ID NO:101, который представляет собой:

DIQMTQSPASLSVSVGETVAITCRASENIYSHIAWYQQKEGKSPQRLVYGATNLAHGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTPWTFGGGTKLEIK;

(e) вариабельный участок тяжелой цепи последовательности SEQ ID NO:89, который представляет собой:

DVQLQESGPGLVKPSQSLSLTCSVTGYSITSHYYWTWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYNCAREGPLYYGNPYWYFDVWGAGTTVTVSS,

и вариабельный участок легкой цепи последовательности SEQ ID NO:109, который представляет собой:

DIQMTQTTSSLSASLGDRVTISCRASQDIDNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDVATYFCQQFNTLPRTFGGGTKLEIK;

(f) вариабельный участок тяжелой цепи последовательности SEQ ID NO:91, который представляет собой:

DVQLQESGPGLVKPSQSLSLTCSVTGYSISSHYYWSWIRQFPGNRLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYNCAREGPLYYGNPYWYFDVWGAGTTVTVSS,

и вариабельный участок легкой цепи последовательности SEQ ID NO:111, который представляет собой:

DIQMTQTTSSLSASLGGSVTISCRASQDIDNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQFNTLPRTFGGGTKLEIK;

или

(g) вариабельный участок тяжелой цепи последовательности SEQ ID NO:93, который представляет собой:

DVQLQESGPGLVKPSQSLSLTCSVTGYSISSHYYWSWIRQFPGNRLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYNCAREGPLYYGNPYWYFDVWGAGTTVTVSS,

и вариабельный участок легкой цепи последовательности SEQ ID NO:113, который представляет собой:

DIQMTQTTSSLSASLGGSVTISCRASQDIDNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQFNTLPRTFGGGTKLEIK.

3. Моноклональное антитело или фрагмент антитела, содержащий его антигенсвязывающий участок, по п.1, продуцируемое любой гибридомой с депозитарным номером NITE BP-1211, NITE BP-1212, NITE BP-1213 или NITE BP-1214, депонированной в депозитарии микроорганизмов для патентных целей (NPMD), National Institute of Technology and Evaluation (NITE), Япония.

4. Моноклональное антитело или фрагмент антитела, содержащий его антигенсвязывающий участок, по любому из пп.1-3, которое также является химерным или гуманизированным.

5. Моноклональное антитело или фрагмент антитела, содержащий его антигенсвязывающий участок, по любому из пп.1-3, содержащее

тяжелую цепь с последовательностью SEQ ID NO:121 и

легкую цепь с последовательностью SEQ ID NO:123.

6. Применение моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5 для лечения или профилактики заболевания, вызванного активированными В-клетками.

7. Применение по п.6, где заболеванием является аутоиммунное заболевание.

8. Применение по п.6, где заболеванием является аллергическое заболевание.

9. Способ обнаружения активированных В-клеток, включающий:

a) стадию приведения моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5 в контакт с исследуемыми клетками; и

b) стадию обнаружения моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, который связывается с клетками.

10. Реагент для обнаружения активированных В-клеток, содержащий моноклональное антитело или фрагмент антитела, содержащий его антигенсвязывающий участок, по любому из пп.1-5, где PLD4 представляет собой PLD4 человека.

11. In vitro способ супрессии активированных В-клеток, включающий стадию приведения одного из следующих компонентов в контакт с активированными В-клетками:

(a) моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5 и

(b) иммуноглобулина, в котором привиты определяющие комплементарность участки моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5.

12. In vivo способ супрессии активированных В-клеток, включающий стадию введения любого из следующих компонентов в живой организм:

(a) моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5 и

(b) иммуноглобулина, в котором привиты определяющие комплементарность участки моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5.

13. Способ по п.11 или 12, где активность активированных В-клеток является активностью продукции антител.

14. Применение моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5 или иммуноглобулина, в котором привиты определяющие комплементарность участки моноклонального антитела по пп.1-5, для супрессии активированных В-клеток.

15. Применение по п.14, где активность активированных В-клеток является активностью продукции антител.

16. Применение моноклонального антитела или фрагмента антитела, содержащего его антигенсвязывающий участок, по любому из пп.1-5 для лечения заболевания, вызванного активированными В-клетками.



 

Похожие патенты:

Изобретение относится к медицине, а именно к хирургии, и может быть использовано для оценки риска развития осложнений в раннем послеоперационном периоде у больных с дисплазией соединительной ткани.

Изобретение относится к области биохимии. Способ определения протеолитической активности ферментов по гидролизу субстрата, иммобилизованного в полиакриламидном геле, включающий приготовление геля, инкубацию образцов в контакте с гелем, окрашивание геля кумасси и фотографирование геля, отличается тем, что поддерживающей средой является гель полиакриламида, содержащий 3,9% акриламида, 0,1% метиленбисакриламида, 1% желатина и 0,05М трис-буферный раствор в качестве растворителя, в котором отсутствуют лунки для нанесения образца, а образцы в объеме 200 мкл помещаются в лунки стандартного 96-луночного иммунологического планшета, планшет соединяется с гелем таким образом, чтобы обеспечить контакт образцов с гелем без смешивания образцов между собой, определение производится в течение 20 минут, при этом для количественного определения ферментативной активности используется определение среднего значения цвета в цветовой модели RGB участков изображения, соответствующих зонам контакта с гелем отдельных образцов, с последующим пересчетом полученных значений в единицы ферментативной активности с помощью предварительно полученной калибровочной формулы.

Изобретение относится к медицине, а именно к акушерству и гинекологии, и может быть использовано для оценки риска преждевременных родов у женщин с привычным невынашиванием беременности.

Изобретение относится к технологиям производства и использования сорбентов, применяемых в том числе для медицинских целей, а именно для экстракорпоральной терапии больных с сепсисом с использованием сорбции биологических жидкостей.

Изобретение относится к технологиям использования сорбентов, применяемых в том числе для медицинских целей, а именно для экстракорпоральной терапии больных с сепсисом с использованием сорбции биологических жидкостей.

Изобретение относится к медицине, а именно к кардиологии, и может быть использовано для прогнозирования повышения роста артериальной жесткости у пациентов, получающих липидснижающую терапию.
Изобретение относится к медицине, а именно к онкологии, и может быть использовано для прогнозирования течения патологического процесса у больных локальным почечно-клеточным раком почки после хирургического лечения.

Изобретение используется в патологической анатомии, эндокринологии, хирургии. Способ дифференциальной диагностики заболеваний щитовидной железы заключается в том, что проводят гистоэнзиматическое исследование фермента тиреопероксидазы (ТПО) в щитовидной железе и по активности ТПО диагностируют диффузный токсический зоб, многоузелковый токсический зоб, фолликулярную аденому в состоянии эутиреоза, аденокарциному.

Изобретение относится к области медицины, а именно к офтальмологии, и предназначено для прогнозирования необходимости проведения лазерной коагуляции при ретинопатии недоношенных.

Изобретение относится к области популяционной генетики и предназначено для поддержания жизнеспособности популяций животных или растений на урбанизированных территориях.

Изобретение относится к области биохимии, в частности к применению композиции, содержащей моноклональное антитело или его фрагмент против MASP-3, которое специфически связывается с частью MASP-3 человека и ингибирует созревание фактора D, для получения лекарственного средства для лечения субъекта.

Изобретение относится к биохимии. Описано выделенное антитело или его антигенсвязывающий фрагмент для доставки цитотоксина, содержащие домен CH1 IgG, где домен CH1 IgG содержит остаток аспарагина в положении аминокислоты 114 в соответствии с нумерацией Kabat, где боковая цепь указанного остатка аспарагина связана с гликаном.

Изобретение относится к биотехнологии. Описан способ лечения воспалительного заболевания, включающий введение нуждающемуся в этом индивидууму антитела к ENO1, где антитело специфически связывается с эпитопом на ENO1 и ингибирует активность ENO1 в качестве рецептора плазминогена, где эпитоп расположен в области, состоящей из последовательности 296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS336 (SEQ ID NO:39) ENO1 человека, где воспалительное заболевание выбрано из группы, состоящей из рассеянного склероза, ревматоидного артрита, болезни Крона, язвенного колита, системной красной волчанки, хронической обструктивной болезни легких (ХОБЛ), астмы, аллергии, псориаза, атеросклероза и их сочетания.

Изобретение относится к области биотехнологии, конкретно к иммуногенным эпитопам URLC10, и может быть использовано в медицине для лечения пациента, страдающего раком.

Настоящее изобретение относится к области иммунологии. Предложены способы очистки слитого белка.

Изобретение относится к биотехнологии и представляет собой клетку-хозяина для получения выделенного антитела или его антигенсвязывающего фрагмента, которое специфически связывает PCSK9.

Настоящее изобретение относится к биотехнологии, а именно к получению терапевтических и диагностических антител. Заявлен полипептид антитела со специфичностью связывания для калликреина-2 человека (hK2).

Изобретение относится к биотехнологии, конкретно к получению модифицированных экзотоксинов Pseudomonas, и может быть использовано в медицине для противоопухолевой терапии.

Изобретение относится к биотехнологии. Предложены клетка-хозяин E.coli для получения анти-VEGF антитела или антигенсвязывающего фрагмента анти-VEGF, свободных от ошибки включения норлейцина, клетка-хозяин E.coli для получения антитела против фактора D или антигенсвязывающего фрагмента против фактора D, свободных от ошибки включения норлейцина, и Клетка-хозяин E.coli для получения анти-МЕТ антитела или антигенсвязывающего фрагмента анти-МЕТ, свободных от ошибки включения норлейцина.

Группа изобретений относится к иммунологии. Предложены гуманизированное моноклональное антитело к фактору D человека или его антигенсвязывающий фрагмент, его нуклеотидная последовательность, клетка и вектор, которые несут эти антитела, способ его получения и применение для получения композиций для лечения заболеваний и нарушений, ассоциированных с избыточной или неконтролируемой активацией системы комплемента.

Изобретение относится к медицине и предназначено для комплексного лечения язвенного колита. Используют ректальные суппозитории, содержащие раствор витамина Д3 водный - 1500 ME; полиэтиленгликоль 1500 - 0,3 г; полиэтиленгликоль 6000 - 0,5 г; эмульгатор Т-2 - 0,1 г; кремофор RH-40 - 1,15 г; лутрол F-127 - 0,55 г.

Изобретение относится к области биохимии, в частности к моноклональному антителу или фрагменту антитела, содержащему его антигенсвязывающий участок, которое связывается с белком фосфолипазы D4, а также его применению для лечения или профилактики заболевания, вызванного активированными В-клетками, для супрессии активированных В-клеток, а также для лечения заболевания, вызванного активированными В-клетками. Также раскрыт способ обнаружения активированных В-клеток, а также реагент для обнаружения активированных В-клеток, содержащий вышеуказанное антитело или его фрагмент. Изобретение также относится к in vitro способу супрессии активированных В-клеток, включающему применение антитела, связывающего с PLD4, или его фрагмента. Изобретение позволяет эффективно осуществлять лечение или профилактику заболевания, вызванного активированными В-клетками. 8 н. и 8 з.п. ф-лы, 7 ил., 4 пр.

Наверх