Гуманизированные антитела к ox40 и способы их применения

Изобретение относится к области биохимии, в частности к выделенному антителу или его антигенсвязывающему фрагменту, которое может специфически связаться с ОХ40 человека, а также к способу его получения и к композиции, его содержащей. Также раскрыт полинуклеотид для экспрессии вышеуказанного антитела или его антигенсвязывающего фрагмента, а также клетка, вектор, его содержащие. Изобретение также относится к способу лечения злокачественного новообразования у индивида, включающему введение индивидууму эффективного количества антитела или его антигенсвязывающего фрагмента, которое может специфически связаться с ОХ40 человека. Изобретение позволяет эффективно осуществлять лечение злокачественного новообразования. 10 н. и 9 з.п. ф-лы, 46 ил., 12 табл., 12 пр.

 

ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ

[0001] OX40 (CD134; TNFRSF4) представляет собой рецептор фактора некроза опухоли, встречающийся преимущественно на активированных CD4+ и CD8+ T-клетках, регуляторных T-клетках (Treg) и клетках естественных киллерах (NK) (Croft et al., 2009, Immunol Rev. 229:173-91). OX40 имеет один известный эндогенный лиганд, лиганд OX40 (OX40L; CD152; TNFSF4), который существует в тримерной форме и может кластеризовать OX40, что приводить к активным клеточным явлениям передачи сигнала в пределах Т-клеток (там же). Передача сигналов с помощью OX40 на активированных CD4+ и CD8+ T-клетках приводит к повышенной выработке цитокинов, высвобождению гранзимов и перфоринов и экспансии популяций эффекторных Т-клеток и Т-клеток памяти (Jensen et al., 2010, Semin Oncol. 37:524-32). Кроме того, передача сигнала от OX40 в Treg-клетках ингибирует размножение Treg, останавливает индукцию Treg и блокирует супрессорную функцию Treg (Voo et al., 2013, J Immunol. 191:3641-50; Vu et al., 2007, Blood. 110:2501-10).

[0002] В иммуногистохимических исследованиях и ранних анализах с применением проточной цитометрии было показано, что OX40 экспрессируется на T-клетках, проникающих в широкий спектр форм злокачественных опухолей человека (Baruah et al., 2011, Immunobiology 217:668-675; Curti et al, 2013, Cancer Res. 73:7189-98; Ladanyi et al, 2004, Clin Cancer Res. 10:521-30; Petty et al, 2002, Am J Surg. 183:512-8; Ramstad et al, 2000, Am J Surg. 179:400-6; Sarff et al, 2008, Am J Surg.ICOS 195:621-5; обсуждение 625; Vetto et al, 1997, Am J Surg. 174:258-65). Без привязки к какой-либо конкретной теории, экспрессия OX40 на лимфоцитах, проникающих в опухоли, коррелирует с более длительной выживаемостью при некоторых формах злокачественных новообразованиях человека, что указывает на то, что сигналы от OX40 могут играть роль в формировании противоопухолевого иммунного ответа (Ladanyi et al., 2004, Clin Cancer Res. 10:521-30; Petty et al., 2002, Am J Surg. 183:512-8).

[0003] В ряде доклинических мышиных моделей опухолей агонисты OX40, в том числе антитела и слитые белки, представляющие собой лиганды OX40, успешно применялись с обнадеживающими результатами (Kjaergaard et al., 2000, Cancer Res. 60:5514-21; Ndhlovu et al., 2001, J Immunol. 167:2991-9; Weinberg et al., 2000, J Immunol. 164:2160-9). Костимуляция Т-клеток посредством OX40 содействовала противоопухолевой активности, которая в некоторых случаях была длительной, обеспечивая продолжительную защиту от последующего введения опухоли (Weinberg et al., 2000, J Immunol. 164:2160-9). Было показано, что ингибирование Treg-клеток и костимуляция эффекторных T-клеток необходимы для подавления роста опухоли агонистами OX40 (Piconese et al., 2008, J Exp Med. 205:825-39). Было изучено множество стратегий и технологий усиления противоопухолевого эффекта терапии агонистом OX40 посредством комбинаций с вакцинами, химиотерапией, лучевой терапией и иммунотерапией (Jensen et al., 2010, Semin Oncol. 37:524-32; Melero et al., 2013, Clin Cancer Res. 19:997-1008).

КРАТКОЕ ОПИСАНИЕ

[0004] В настоящем раскрытии предусмотрены антитела, которые связываются с OX40, например, OX40 человека. Согласно определенным аспектам предусмотренные антитела являются гуманизированными антителами. Например, в настоящем раскрытии предусмотрено антитело или его антигенсвязывающий фрагмент, которые включают гуманизированную вариабельную область тяжелой цепи (VH) и гуманизированную вариабельную область легкой цепи (VL), где VH включает аминокислотную последовательность формулы:

HFW1-HCDR1-HFW2-HCDR2-HFW3-HCDR3-HFW4,

где HFW1 представляет собой SEQ ID NO: 6 или SEQ ID NO: 7, HCDR1 представляет собой SEQ ID NO: 8, HFW2 представляет собой SEQ ID NO: 9 (WIRX39HPGKGLEX47X48G; где X39 представляет собой Q или K, X47 представляет собой W или Y, а X48 представляет собой I или M), HCDR2 представляет собой SEQ ID NO: 14, SEQ ID NO: 15 или SEQ ID NO: 16, HFW3 представляет собой SEQ ID NO: 17 (RITINX71DTSKNQX78SLQLNSVTPEDTAVYX91CAR; где X71 представляет собой P или R, X78 представляет собой F или Y, а X91 представляет собой Y или F, HCDR3 представляет собой SEQ ID NO: 25, SEQ ID NO: 26 или SEQ ID NO: 27), а HFW4 представляет собой SEQ ID NO: 28, где VL включает аминокислотную последовательность под SEQ ID NO: 29 или SEQ ID NO: 32; и где антитело или его фрагмент могут специфически связываться с OX40 человека. Согласно определенным аспектам аминокислотная последовательность HFW2 представляет собой SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 или SEQ ID NO: 1, и согласно определенным аспектам аминокислотная последовательность HFW3 представляет собой SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 или SEQ ID NO: 24.

[0005] Согласно определенным аспектам VH предусмотренного антитела или его фрагмента включает аминокислотную последовательность под SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 65 или SEQ ID NO: 67. Согласно определенным аспектам VL предусмотренного антитела или его фрагмента включает аминокислотную последовательность под SEQ ID NO: 29, а VL включает аминокислотную последовательность под SEQ ID NO: 59.

[0006] Согласно определенным аспектам предусмотренное антитело или его фрагмент дополнительно включают константную область легкой цепи или ее фрагмент, слитые с C-концом VL, например, константную область каппа-цепи человека или константную область лямбда-цепи человека. Согласно определенным аспектам предусмотренное антитело или его фрагмент дополнительно включают константную область тяжелой цепи или ее фрагмент, слитые с C-концом VH, например, константную область IgG1 человека, константную область IgG4P человека, константную область IgG1TM человека или константную область IgG1 мыши. Согласно определенным аспектам константная область тяжелой цепи представляет собой константную область IgG1 человека. Согласно определенным аспектам предусмотренное антитело или его фрагмент включают аминокислотную последовательность тяжелой цепи под SEQ ID NO: 71 и аминокислотную последовательность легкой цепи под SEQ ID NO: 30. Антигенсвязывающий фрагмент антитела, предусмотренного в настоящем раскрытии, может представлять собой, например, Fv-фрагмент, Fab-фрагмент, F(ab')2-фрагмент, Fab'-фрагмент, dsFv-фрагмент, scFv-фрагмент или sc(Fv)2-фрагмент или любую их комбинацию.

[0007] Согласно определенным аспектам предусмотренное антитело или его фрагмент может специфически связываться с OX40 человека, макака-крабоеда или макака-резуса, например, может специфически связываться с OX40, экспрессируемым на клетках Jurkat, первичных активированных CD4+ или CD8+ T-клетках от человека, макака-крабоеда, макака-резуса или любой их комбинации. Согласно определенным аспектам предусмотренное антитело или его фрагмент не связываются с OX40 мыши или крысы. Согласно определенным аспектам предусмотренное антитело или его фрагмент не вступает в перекрестную реакцию с родственными белками TNFRSF.

[0008] Согласно определенным аспектам предусмотренное антитело или его фрагмент могут характеризоваться аффинностью связывания с OX40 человека, экспрессируемым на первичных активированных CD4+ T-клетках человека, при концентрации от приблизительно 250 пМ до приблизительно 370 пМ согласно измерению с помощью проточной цитометрии, например, приблизительно 312 пМ. Согласно определенным аспектам предусмотренное антитело или его фрагмент могут обеспечивать 20% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC20) при концентрации от приблизительно 63 до приблизительно 93 пМ, 50% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC50) при концентрации от приблизительно 250 до приблизительно 370 пМ, и 90% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC90) при концентрации от приблизительно 2290 до приблизительно 3330 пМ согласно измерению с помощью проточной цитомерии. Например, согласно определенным аспектам EC20 составляет приблизительно 78 пМ, EC50 составляет приблизительно 312 пМ, а EC90 составляет приблизительно 2810 пМ.

[0009] Согласно определенным аспектам предусмотренное антитело или его фрагмент могут характеризоваться аффинностью связывания с OX40 человека, экспрессируемым на сверхэкспрессирующих OX40 клетках Jurkat, при концентрации от приблизительно 250 пМ до приблизительно 600 пМ согласно измерению с помощью проточной цитометрии, например, приблизительно 424 пМ. Согласно определенным аспектам предусмотренное антитело или его фрагмент могут обеспечивать EC20 на сверхэкспрессирующих OX40 клетках Jurkat при концентрации от приблизительно 60 до приблизительно 150 пМ, EC50 на сверхэкспрессирующих OX40 клетках Jurkat при концентрации от приблизительно 250 до приблизительно 600 пМ и EC90 на сверхэкспрессирующих OX40 клетках Jurkat при концентрации от приблизительно 2260 до приблизительно 4380 пМ согласно измерению с помощью проточной цитометрии. Например, согласно определенным аспектам EC20 составляет приблизительно 106 пМ, EC50 составляет приблизительно 424 пМ, а EC90 составляет приблизительно 3820 пМ.

[0010] Согласно определенным аспектам предусмотренное антитело или его фрагмент могут характеризоваться аффинностью связывания с OX40 макака-крабоеда, экспрессируемым на первичных активированных CD4+ T-клетках макака-крабоеда, при концентрации от приблизительно 340 пМ до приблизительно 820 пМ согласно измерению с помощью проточной цитометрии, например, приблизительно 580 пМ. Согласно определенным аспектам предусмотренное антитело или его фрагмент могут характеризоваться аффинностью связывания с OX40 макака-резуса, экспрессируемым на первичных активированных CD4+ T-клетках макака-резус, при концентрации от приблизительно 130 пМ до приблизительно 600 пМ согласно измерению с помощью проточной цитометрии, например, приблизительно 370 пМ.

[0011] Согласно определенным аспектам предусмотренное антитело или его фрагмент могут индуцировать дозозависимую пролиферацию активированных CD4+ T-клеток и дозозависимое высвобождение цитокинов первичными активированными CD4+ T-клетками в анализе с применением планшета. Например, согласно определенным аспектам 20% максимального пролиферативного ответа (EC20) первичных активированных CD4+ T-клеток человека может обеспечиваться при концентрации антитела от приблизительно 14 пМ до приблизительно 28 пМ, 50% максимального пролиферативного ответа (EC50) первичных активированных CD4+ T-клеток человека может обеспечиваться при концентрации антитела от приблизительно 0,3 пМ до приблизительно 130 пМ, а 90% максимального пролиферативного ответа (EC90) первичных активированных CD4+ T-клеток человека может обеспечиваться при концентрации антитела от приблизительно 50 пМ до приблизительно 90 пМ во всех случаях согласно измерению с помощью проточной цитометрии. Согласно определенным аспектам EC20 составляет приблизительно 21 пМ, EC50 составляет приблизительно 28 пМ, а EC90 составляет приблизительно 72 пМ. Цитокином, высвобождаемым первичными активированными CD4+ T-клетками человека, может быть один, два, три или более из, без ограничений, IFNγ, TNFα, IL-5, IL-10, IL-2, IL-4, IL-13, IL-8, IL-12 p70, IL-1β или любой их комбинации, например, IFNγ, TNFα, IL-5, IL-10, IL-13 или любая их комбинация. Согласно определенным аспектам предусмотренное антитело или его фрагмент могут обеспечивать пролиферацию CD4+ T-клеток и высвобождение цитокинов первичными активированными CD4+ T-клетками макака-крабоеда и первичными активированными CD4+ T-клетками макака-резуса.

[0012] Согласно определенным аспектам предусмотренное антитело или его фрагмент могут активировать путь NFκB в экспрессирующих OX40 Т-клетках в присутствии экспрессирующих FcγR клеток. Например, экспрессирующими OX40 Т-клетками могут быть сверхэкспрессирующие OX40 клетки Jurkat с NFκB-люциферазным репортером, которые вырабатывают люциферазу в ответ на стимуляцию сигнального пути NFκB. Согласно определенным аспектам предусмотренное антитело или его фрагмент могут вызывать комплементзависимую или антителозависимую клеточную цитотоксичность в отношении экспрессирующих OX40 клеток. Согласно определенным аспектам предусмотренное антитело или его фрагмент могут связываться с C1q человека и вызывать NK-опосредованную антителозависимую клеточную цитотоксичность в отношении экспрессирующих OX40 клеток.

[0013] Согласно определенным аспектам введение эффективной дозы предусмотренного антитела или его фрагмента субъекту, нуждающемуся в лечении злокачественного новообразования, может подавлять у субъекта рост опухоли. Например, подавление роста опухоли может обеспечиваться в присутствии T-клеток. Согласно определенным аспектам рост опухоли подавляется по меньшей мере на 10%, по меньшей мере на 20%, по меньшей мере на 30%, по меньшей мере на 40% и по меньшей мере на 50%, по меньшей мере на 60% или по меньшей мере на 70% по сравнению с введением изотипически сходного контрольного антитела или его фрагмента.

[0014] В настоящем раскрытии дополнительно предусмотрена композиция, включающую антитело или его фрагмент, описываемые выше, и носитель.

[0015] В настоящем раскрытии дополнительно предусмотрен полинуклеотид, который включает нуклеиновую кислоту, которая кодирует предусмотренное антитело или его фрагмент, или кодирует полипептидную субъединицу предусмотренного антитела или его фрагмента. Согласно определенным аспектам предусмотренный полинуклеотид включает нуклеиновую кислоту под SEQ ID NO: 60, нуклеиновую кислоту под SEQ ID NO: 31, нуклеиновую кислоту под SEQ ID NO: 72 или любую их комбинацию. В настоящем раскрытии дополнительно предусмотрен вектор, который включает предусмотренный полинуклеотид, и клетка-хозяин, которая включает предусмотренный полинуклеотид или предусмотренный вектор. Согласно другому аспекту в настоящем раскрытии предусмотрен способ получения антитела или его фрагмента, при этом способ включает культивирование предусмотренной клетки-хозяина в условиях, при которых экспрессируются антитело или его фрагмент, кодируемые полинуклеотидом, и извлечение антитела или его фрагмента.

[0016] Согласно дополнительным аспектам в настоящем раскрытии предусмотрен способ содействия выживанию или пролиферации активированных T-клеток, при этом способ включает приведение активированных Т-клеток в контакт с предусмотренным антителом или его фрагментом, и при этом антитело или его фрагмент могут специфически связываться с OX40 на поверхности T-клеток.

[0017] Согласно дополнительным аспектам в настоящем раскрытии предусмотрен способ индуцирования высвобождения цитокинов из активированных T-клеток, при этом способ включает приведение активированных Т-клеток в контакт с предусмотренным антителом или его фрагментом, и при этом антитело или его фрагмент могут специфически связываться с OX40 на поверхности T-клеток. Согласно определенным аспектам высвобождаемым цитокином может быть один, два, три или более из, без ограничений, IFNγ, TNFα, IL-5, IL-10, IL-2, IL-4, IL-13, IL-8, IL-12 p70, IL-1β или любой их комбинации, например, IFNγ, TNFα, IL-5, IL-10, IL-13 или любая их комбинация. Согласно определенным аспектам активированными T-клетками являются активированные CD4+ T-клетки, активированные CD8+ T-клетки или их комбинация. Согласно определенным аспектам активированными CD4+ T-клетками являются CD4+ T-клетки человека, CD4+ T-клетки макака-крабоеда, CD4+ T-клетки макака-резуса или их комбинация.

[0018] Согласно дополнительным аспектам в настоящем раскрытии предусмотрен способ содействия активации T-клеток, при этом способ предусматривает приведение Т-клеток в контакт с предусмотренным антителом или его фрагментом, при этом антитело или его фрагмент могут специфически связываться с OX40 на поверхности T-клеток. Согласно определенным аспектам активацию T-клеток можно измерить при помощи стимуляции пути передачи сигнала NFκB. Согласно определенным аспектам T-клетками являются активированные CD4+ T-клетки, активированные CD8+ T-клетки или их комбинация. Согласно определенным аспектам активированными CD4+ T-клетками являются CD4+ T-клетки человека, CD4+ T-клетки макака-крабоеда, CD4+ T-клетки макака-резуса или их комбинация. Согласно определенным аспектам приведение в контакт включает введение субъекту эффективного количества антитела или его фрагмента.

[0019] Согласно дополнительным аспектам в настоящем раскрытии предусмотрен способ лечения злокачественного новообразования у субъекта, при этом способ включает введение субъекту, нуждающемуся в лечении, эффективного количества предусмотренного антитела или его фрагмента, или предусмотренной композиции. Согласно определенным аспектам злокачественное новообразование представляет собой солидную опухоль. Согласно определенным аспектам введение антитела или его фрагмента или композиции может подавлять рост опухоли, может содействовать уменьшению размеров опухоли или как то, так и другое. Согласно определенным аспектам подавление роста опухоли достигается в присутствии T-клеток.

[0020] Согласно дополнительным аспектам в настоящем раскрытии предусмотрен способ усиления иммунного ответа у субъекта, при этом способ включает введение субъекту, нуждающемуся в лечении, терапевтически эффективного количества предусмотренного антитела или его фрагмента, или предусмотренной композиции.

[0021] В способах лечения, предусмотренных в настоящем раскрытии, субъектом, подлежащим лечению, может быть субъект-человек.

[0022] Согласно определенным аспектам предусмотренное антитело или его фрагмент могут связываться с эпитопом OX40 человека, который находится в пределах аминокислот в положениях 108-146 из SEQ ID NO: 91. Согласно определенным аспектам эпитоп включает по меньшей мере аминокислоты лейцин в положении 116 (L116) и аланин в положении 126 (A126) из SEQ ID NO: 91. Согласно определенным аспектам предусмотренное антитело или его фрагмент могут связываться с вариантом OX40 мыши, который имеет аминокислотную последовательность под SEQ ID NO: 92, за исключением мутации Q113L и мутации V124A.

[0023] В настоящем раскрытии дополнительно предусмотрен выделенный пептид, состоящий из 100 аминокислот или меньше, при этом пептид может специфически связываться предусмотренным антителом или его фрагментом. Согласно определенным аспектам пептид включает аминокислоты в положениях 116-126 из SEQ ID NO: 91. Согласно определенным аспектам пептид включает аминокислоты в положениях 108-146 из SEQ ID NO: 91, за исключением одной, двух, трех, четырех, пяти или шести замен, делеций или вставок одной аминокислоты в любом положении, за исключением L116 и A126.

КРАТКОЕ ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ/ФИГУР

[0024] Фигура 1. Мутации в гуманизированных VH-областях 9B12: числа в кодовом названии клона представляют положение аминокислоты в VH, согласно нумерации Кабат. Mab 1, 2, 5 и 8 представляют химерные варианты VH, спаренные с гуманизированной VL. Mab 10-17 представляют собой гуманизированные варианты VH с обратными мутациями в мышиную последовательность. Mab 18-27 представляют собой варианты, сконструированные для устранения потенциальных факторов неустойчивости в последовательности. Вариабельные области Mab24 и mAb27 прививали на различные константные области тяжелой цепи с получением изотипических вариантов под названиями mAb28-30 и mAb31-32, mAb37 соответственно.

[0025] Фигура 2A-D. Связывание OX40mAb24 и 9B12 с OX40, экспрессируемым на поверхности первичных активированных CD4+ T-клеток человека. MFI=средняя интенсивность флуоресценции меченного AlexaFluor® 647 вторичного антитела к антителу человека, связывающегося с OX40mAb24 (2A-B), или меченного AlexaFluor® 488 вторичного антитела к антителу мыши, связывающегося с 9B12 (2C-D), на первичных CD4+ T-клетках человека.

[0026] Фигура 3A-F. Связывание OX40mAb24 и 9B12 с OX40 человека, экспрессируемым на поверхности T-клеток Jurkat. MFI=средняя интенсивность флуоресценции меченного AlexaFluor® 647 вторичного антитела к антителу человека, связывающегося с OX40mAb24 (3A-C), или меченного AlexaFluor® 488 вторичного антитела к антителу мыши, связывающегося с 9B12 (3D-F), на T-клетках Jurkat.

[0027] Фигура 4A-B. Связывание OX40mAb24 с экспрессирующими TNFRSF клетками HEK293 и экспрессирующими OX40 Т-клетками Jurkat. (4A) Транзиентная экспрессия представителей TNFRSF, как указано слева от гистограмм, в клетках HEK293, и связывание с TNFRSF-специфическими mAb или с OX40mAb24, как указано над гистограммами. Гистограмма серого цвета, связывание конъюгированного с флуорохромом антитела изотипического контроля для TNFRSF-специфического mAb, или связывание меченного AlexaFluor® 647 вторичного антитела козы к Ig человека в качестве контроля для OX40mAb24; незакрашенная гистограмма, связывание TNFRSF-специфического mAb или OX40mAb24. (4B): Связывание OX40mAb24 с экспрессирующими OX40 клетками Jurkat в качестве положительного контроля. Гистограмма серого цвета, контрольное связывание меченого AlexaFluor® 647 вторичного антитела козы к Ig человека; незакрашенная диаграмма, связывание OX40mAb24.

[0028] Фигура 5A-B. Связывание CDR (областей, определяющих комплементарность) OX40mAb24 (OX40mAb29) и 9B12 с рекомбинантными представителями TNFRSF человека, определяемое при помощи ELISA. Результаты ELISA-анализов, показывающие специфическое связывание OX40 с помощью OX40mAb29 (5A) и 9B12 (5B). OX40mAb29 содержит CDR из OX40mAb24. Связывание OX40 антителом сравнивали со связыванием других белков TNFRSF человека.

[0029] Фигура 6. Схематическая диаграмма анализа биоактивности связанного на планшете OX40mAb24. Q=OX40mAb24; ¥=клон OKT3 антитела к CD3 человека.

[0030] Фигуры 7A-C. Пролиферация CD4+ T-клеток человека в ответ на OX40mAb24 и 9B12. (7A) Пролиферация CD4 T-клеток четырех независимых доноров, опосредованная стимуляцией иммобилизованного на планшете OX40mAb24 в комбинации с субмитогенной стимуляцией TCR (антителом к CD3). Перед нанесением на график экспериментальные точки нормализовали относительно нижнего асимптотического значения кривых на основе первичных данных для улучшения наглядности динамического диапазона каждого ответа. (7B) Типичные первичные данные от донора 651, показывающие пролиферацию, обусловленную OX40mAb24 совместно с субмитогенной стимуляцией TCR (антителом к CD3), и соответственное отсутствие пролиферации, опосредуемой контрольным mAb на основе IgG1 человека, R347, растворимым OX40mAb24 при наличии или отсутствии сопутствующей передачи сигнала через TCR, mAb к CD3 отдельно без OX40mAb24 и при помощи связанного на планшете OX40mAb24 в отсутствие mAb к CD3. (7C) Пролиферация CD4 T-клеток четырех независимых доноров, опосредованная стимуляцией с помощью иммобилизованного на планшете 9B12 в комбинации с субмитогенной стимуляцией TCR. Символы, средние значения; планки погрешностей, стандартное отклонение среднего; n=3 технических реплик для OX40mAb24, контрольного mAb для IgG1 человека, R347, и 9B12, все в комбинации с антителом к CD3; n=2 технических реплик для растворимого OX40mAb24 и CD3 в отсутствие OX40mAb24, связанного на планшете OX40mAb24 без антитела к CD3 и растворимого OX40mAb24 без антитела к CD3.

[0031] Фигура 8A-E. Высвобождение цитокинов из CD4+ T-клеток человека в ответ на OX40mAb24. Типичное индуцированное OX40mAb24 высвобождение цитокинов, в том числе (8A) IFNγ, (8B) TNFα (8C) IL-10 (8D) IL-13 и (8E) IL-5, из CD4 T-клеток человека для донора 651. Символы, средние значения; планки погрешностей, стандартное отклонение среднего; n=3 технических реплик для OX40mAb24 и контрольного mAb на основе IgG1 человека, R347, оба в комбинации с антителом к CD3; n=2 технических реплик для растворимого OX40mAb24, растворимого OX40mAb24 без антитела к CD3 и антитела к CD3 в отсутствие OX40mAb24.

[0032] Фигура 9A-E. Высвобождение цитокинов из CD4+ T-клеток человека в ответ на 9B12. Типичное индуцированное 9B12 высвобождение цитокинов, в том числе (9A) IFNγ, (9B) TNFα (9C) IL-10 (9D) IL-13 и (9E) IL-5, из CD4 T-клеток человека для донора 651. Символы, средние значения; планки погрешностей, стандартное отклонение среднего; n=3 технических реплик для 9B12 и контрольного mAb на основе IgG1 мыши, оба в комбинации с антителом к CD3; n=2 технических реплик для растворимого 9B12, растворимого 9B12 без антитела к CD3 и антитела к CD3 в отсутствие 9B12.

[0033] На фигуре 10 представлена схема, иллюстрирующая клеточные системы, применяемые для измерения биоактивности OX40mAb24 и 9B12. Перекрестное сшивание OX40mAb24 экспрессирующими FcγR клетками опосредует кластеризацию и активацию OX40 на клеточной поверхности экспрессирующих OX40 линий клеток Jurkat с NFκB-люциферазным репортером, что приводит к NFκB-опосредованной выработке люциферазы, которую можно измерить в качестве показателя активации OX40. FcγR=рецептор кристаллизующегося фрагмента-гамма; NFκB=ядерный фактор каппа B.

[0034] Фигура 11A-D. Биоактивность OX40mAb24 в экспрессирующих OX40 клетках Jurkat с NFκB репортером в условиях перекрестного сшивания с помощью FcγR и без него. Зависимая от концентрации активность (в RLU) индуцированной OX40mAb24 передачи сигналов с помощью OX40 человека, экспрессируемого на клеточной поверхности линий клеток Jurkat с NFκB-люциферазным репортером в 2-клеточном биологическом анализе. Активность репортера после перекрестного сшивания OX40mAb24 (11A) с помощью экспрессирующих CD32A клеток HEK293 и родительских клеток HEK293 (HEK) или в присутствии (11B) экспрессирующих CD32B клеток HEK293, (11C) клеток Raji B или (11D) CD45+ клеток, выделенных из первичной опухоли легкого. Данные соответствуют остальным результатам, содержащимся в таблице 5-2. mAb=моноклональное антитело, RLU=относительные световые единицы.

[0035] Фигура 12A-D. Биоактивность 9B12 в экспрессирующих OX40 клетках Jurkat с NFκB репортером при применении перекрестного сшивания с помощью FcγR различными типами клеток в анализах биоактивности с 2 типами клеток. Зависимая от концентрации активность (в RLU) 9B12, которое индуцирует передачу сигналов с помощью OX40 человека, экспрессируемого на клеточной поверхности линий клеток Jurkat с NFκB-люциферазным репортером, в биологическом анализе с двумя типами клеток. Активность репортера после перекрестного сшивания 9B12 с помощью (12A) экспрессирующих CD32A клеток HEK293, (12B) экспрессирующих CD32B клеток HEK293, (12C) клеток Raji B или (12D) CD45+ клеток, выделенных из первичной опухоли легкого. Данные соответствуют остальным результатам, содержащимся в таблице 5-3. mAb=моноклональное антитело; RLU=относительные световые единицы.

[0036] Фигура 13A-B. Опосредованная клетками-естественными киллерами антителозависимая клеточная цитотоксичность OX40mAb24, эксперимент 1. (13A) Специфический киллинг экспрессирующих OX40 активированных CD4+ T-клеток NK-клетками человека от аллогенных, слева, или аутологичных, справа, пар доноров NK и CD4+ T-клеток с применением 10 мкг/мл 9B12, OX40mAb24 или вариантов OX40mAb24, IgG1 с тройной мутацией (mAb29) или IgG4P человека (mAb28). (13B) Лизис В-клеток Toledo под действием NK-клеток от доноров 350 и 351 в присутствии ритуксимаба, но не антитела изотипического контроля для IgG1 человека, R347. Технические реплики проводили в трех повторностях. Планки погрешностей представляют стандартную ошибку среднего. ADCC=клеточная цитотоксичность, зависимая от антитела-лекарственного средства; mAb=моноклональное антитело; NK=естественный киллер.

[0037] Фигура 14A-B. Опосредованная клетками-естественными киллерами антителозависимая клеточная цитотоксичность OX40mAb24, эксперимент 2. (14A) Специфический киллинг экспрессирующих OX40 активированных CD4+ T-клеток NK-клетками человека от аллогенных, слева, или аутологичных, справа, пар доноров NK и CD4+ T-клеток с применением 10 мкг/мл контрольного антитела для IgG1 человека, R347, 9B12, OX40mAb24, вариантов OX40mAb24, IgG4P человека (mAb28) или IgG1 с тройной мутацией (mAb29). (14B) Лизис В-клеток Toledo под действием NK-клеток от доноров 558 и 589 в присутствии ритуксимаба, но не антитела изотипического контроля для IgG1 человека, R347. Технические реплики проводили в трех повторностях. Планки погрешностей представляют стандартную ошибку среднего. ADCC=клеточная цитотоксичность, зависимая от антитела-лекарственного средства; mAb=моноклональное антитело; NK=естественный киллер.

[0038] Фигура 15A-D. Оценка опосредованной клетками-естественными киллерами антителозависимой клеточной цитотоксичности OX40mAb24 и 9B12, эксперимент 3. (15A-B) Специфический киллинг экспрессирующих OX40 CD4 T-клеток человека, опосредованный OX40mAb24, но не 9B12, с применением первичных NK-клеток человека от двух различных доноров, как указано. (15C-D) Лизис В-клеток Toledo под действием NK-клеток от доноров 363 и 504 в присутствии ритуксимаба, но не антитела изотипического контроля для IgG1 человека, R347. Технические реплики проводили в двух повторностях. Планки погрешностей представляют стандартную ошибку среднего. ADCC=клеточная цитотоксичность, зависимая от антитела-лекарственного средства; mAb=моноклональное антитело; NK=естественный киллер.

[0039] Фигура 16A-D. Оценка опосредованной клетками-естественными киллерами антителозависимой клеточной цитотоксичности OX40mAb24, эксперимент 4. (16A-B) Специфический киллинг экспрессирующих OX40 CD4 T-клеток человека, опосредованный OX40mAb24, с применением первичных NK-клеток человека от двух различных доноров, как указано. (16C-D) Лизис В-клеток Toledo под действием NK-клеток от доноров 464 и 532 в присутствии ритуксимаба, но не антитела изотипического контроля для IgG1 человека, R347. Технические реплики проводили в двух повторностях. Планки погрешностей представляют стандартную ошибку среднего. ADCC=клеточная цитотоксичность, зависимая от антитела-лекарственного средства; mAb=моноклональное антитело; NK=естественный киллер.

[0040] Фигура 17A-B. Оценка опосредованной клетками-естественными киллерами антителозависимой клеточной цитотоксичности OX40mAb24, эксперимент 5. Специфический киллинг экспрессирующих OX40 CD4+T-клеток человека, опосредованный OX40mAb24, с применением первичных NK-клеток человека от доноров 601 (панель A) и 602 (панель B), как указано. Планки погрешностей представляют стандартную ошибку среднего. ADCC=клеточная цитотоксичность, зависимая от антитела-лекарственного средства; mAb=моноклональное антитело; NK=естественный киллер.

[0041] Фигура 18A-B. Оценка связывания OX40mAb24 и 9B12 с очищенным белком C1q человека. Указанные концентрации очищенного белка C1q человека вводили на биосенсорный чип. Холостая проба представляет собой внесение только среды в виде PBS/0,005% Tween 20. Панель A: связывание OX40mAb24 с очищенным C1q человека. Панель B: связывание 9B12 с очищенным C1q человека.

[0042] Фигура 19A-B. Активность OX40mAb24 в анализах биоактивности в отношении экспрессирующих OX40 макака-крабоеда/макака-резуса клеток Jurkat с NFκB-люциферазой, клон B2, и В-клеток макака-резуса, LCL8664. Зависимая от концентрации индукция активности NFκB под действием OX40mAb24 (в RLU) в экспрессирующей OX40 макака-крабоеда/макака-резуса линии клеток Jurkat с NFκB-люциферазным репортером, объединенной с линией В-клеток макака-резуса, LCL8664. Данные представлены для 2 независимых анализов с 4 повторностями для каждой экспериментальной точки. Планки погрешностей, представляющие стандартную ошибку среднего, не видны из-за масштаба. RLU=относительные световые единицы.

[0043] Фигура 20A-B. Активность 9B12 в анализах биоактивности в отношении экспрессирующих OX40 макака-крабоеда/макака-резуса клеток Jurkat с NFκB-люциферазной, клон B2, и В-клеток макака-резуса, LCL8664. Зависимая от концентрации индукция активности NFκB под действием 9B12 (в RLU) в экспрессирующей OX40 макака-крабоеда/макака-резуса линии клеток Jurkat с NFκB-люциферазным репортером, объединенной с линией В-клеток макака-резуса, LCL8664. Данные представлены для 2 независимых анализов с 4 повторностями для каждой экспериментальной точки. Планки погрешностей представляют стандартную ошибку среднего. RLU=относительные световые единицы.

[0044] Фигура 21A-B. Активность OX40mAb24 и 9B12 в анализе биоактивности с участием экспрессирующих OX40 макака-крабоеда/макака-резуса клеток Jurkat с NFκB-люциферазной, клон B2, и экспрессирующих Fc-гамма-рецептор иммунных клеток макака-резуса. Зависимая от концентрации индукция активности NFκB под действием OX40mAb24 (панель A) и 9B12 (панель B) (в RLU) в экспрессирующей OX40 макака-крабоеда/макака-резуса линии клеток Jurkat с NFκB-люциферазным репортером в комбинации с экспрессирующими Fcγ-рецептор иммунными клетками макака-резуса. Две повторности на экспериментальную точку. RLU=относительные световые единицы.

[0045] Фигура 22A-D. OX40mAb24 и 9B12 вызывают пролиферацию первичных CD4 T-клеток макака-резуса. OX40mAb24 (22A-B) и 9B12 (22C-D) индуцировали клеточное деление у первичных активированных CD4+ T-клеток макака-резуса. Данные представлены для 2 независимых анализов с лунками в трех повторностях. Планки погрешностей представляют стандартную ошибку среднего.

[0046] Фигура 23A-B. Влияние OX40mAb24 и 9B12 на рост клеток A375 в ксенотрансплантантной мышиной модели - эксперимент 1. В день 1 шести мышам NOD/SCID в каждой группе трансплантировали SC клетки A375, смешанные с линиями аллореактивных CD4+ и CD8+ T-клеток человека в соотношении E:T 1:6. OX40mAb24 (23A) и 9B12 (23B), а также изотипический контроль (23A-B) вводили IP в дни 3, 5, 7, 10 и 12. Приведены средние значения объемов опухолей. Сравнение животных, обработанных OX40mAb24 (23A) или обработанных 9B12 (23B), и животных, обработанных изотипическим контролем, проводили в день 25 и 18 соответственно, а межгрупповые различия анализировали в отношении статистической значимости при помощи критерия суммы рангов Манна-Уитни. Планки погрешностей представляют стандартную ошибку среднего. *: TGI > 68%, P < 0,05 в сравнении с группой изотипического контроля. E:T=соотношение эффектор-мишень; IP внутрибрюшинно; NOD/SCID=мыши с инсулинозависимым диабетом/тяжелым комбинированным иммунодефицитом; SC=подкожно; TGI=подавление роста опухоли.

[0047] Фигура 24A-B. Влияние OX40mAb24 и 9B12 на рост клеток A375 в ксенотрансплантантной мышиной модели - эксперимент 2. В день 1 шести мышам NOD/SCID в каждой группе трансплантировали SC клетки A375, смешанные с линиями аллореактивных CD4+ и CD8+ T-клеток человека в соотношении E:T 1:6. OX40mAb24 (24A) и 9B12 (24B), а также изотипический контроль (24A-B) вводили IP в дни 3, 5, 7, 10 и 12. Приведены средние значения объемов опухолей. Сравнение животных, обработанных OX40mAb24 (12A) или обработанных 9B12 (12B), и животных, обработанных изотипическим контролем, проводили в день 18, а межгрупповые различия анализировали в отношении статистической значимости при помощи критерия суммы рангов Манна-Уитни. Планки погрешностей представляют стандартную ошибку среднего. #: TGI ≥ 75%, P ≤ 0,0004 в сравнении с группой изотипического контроля. *: TGI=53%, P ≤ 0,05 в сравнении с группой изотипического контроля. E:T=соотношение эффектор-мишень; IP внутрибрюшинно; NOD/SCID=мыши с инсулинозависимым диабетом/тяжелым комбинированным иммунодефицитом; SC=подкожно; TGI=подавление роста опухоли.

[0048] Фигура 25. Влияние OX40mAb24 на рост клеток A375 в ксенотрансплантантной мышиной модели - эксперимент 3. В день 1 шести мышам NOD/SCID в каждой группе трансплантировали SC клетки A375, смешанные с линиями аллореактивных CD4+ и CD8+ T-клеток человека в соотношении E:T 1:6. OX40mAb24 вводили IP в дни 3, 6, 8, 10 и 13. Приведены средние значения объемов опухолей. Сравнение животных, обработанных OX40mAb24, и животных, обработанных изотипическим контролем, проводили в день 28, а межгрупповые различия анализировали в отношении статистической значимости при помощи критерия суммы рангов Манна-Уитни. Планки погрешностей представляют стандартную ошибку среднего. *: TGI=75%, P < 0,05 в сравнении с группой изотипического контроля; E:T=соотношение эффектор-мишень; IP=внутрибрюшинно; NOD/SCID=мыши с инсулинозависимым диабетом/тяжелым комбинированным иммунодефицитом; SC=подкожно; TGI=подавление роста опухоли.

[0049] Фигура 26A-B. Влияние OX86 mIgG2a на рост линии клеток CT26 в сингенной мышиной модели. В день 1 десяти мышам BALB/c в каждой группе инокулировали SC клетки CT26. Контроль (отрицательный контроль) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 9 и 12 (стрелки на (26A)). Приведены средние (26A) и индивидуальные (26B) значения объемов опухоли. Проводили сравнение животных, обработанных OX86 mIgG2a, и животных, обработанных отрицательным контролем, и межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0. Планки погрешностей представляют стандартную ошибку среднего. *: TGI > 50%, P < 0,0001 в сравнении с группой изотипического контроля в день 21. IP=внутрибрюшинно; SC=подкожно; TGI=подавление роста опухоли.

[0050] Фигура 27A-B. Влияние OX86 mIgG2a на рост линии клеток CT26 в сингенной мышиной модели. В день 1 двенадцати мышам BALB/c в каждой группе инокулировали SC клетки CT26. Исследуемый препарат (OX86 mIgG2a) вводили IP в дни 13 и 16 (стрелки на (27A)). Приведены средние (27A) и индивидуальные (27B) значения объемов опухоли. Проводили сравнение животных, обработанных OX86 mIgG2a, и контрольных животных без обработки, и межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0. Планки погрешностей представляют стандартную ошибку среднего. *: TGI > 50%, P < 0,0001 в сравнении с группой контроля без обработки в день 24. IP=внутрибрюшинно; SC=подкожно; TGI=подавление роста опухоли.

[0051] Фигура 28A-B. Влияние OX86 mIgG2a на рост линии клеток MCA205 в сингенной мышиной модели. В день 1 четырнадцати мышам C57BL/6 в каждой группе инокулировали SC клетки MCA205. Контрольный препарат (изотипический контроль) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 11 и 14. Приведены средние (28A) и индивидуальные (28B) значения объемов опухоли. Проводили сравнение животных, обработанных OX86 mIgG2a, и животных, обработанных изотипическим контролем, и межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0. Планки погрешностей представляют стандартную ошибку среднего. *: TGI > 50%, P < 0,0001 в сравнении с группой изотипического контроля в день 27. IP=внутрибрюшинно; SC=подкожно; TGI=подавление роста опухоли.

[0052] Фигура 29A-B. Влияние OX86 mIgG2a на рост линии клеток 4T1 в сингенной мышиной модели. В день 1 двенадцати мышам BALB/c в каждой группе инокулировали S клетки 4T1. Контрольный препарат (изотипический контроль) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 13, 16, 20 и 23. Приведены средние (29A) и индивидуальные (29B) значения объемов опухоли. Проводили сравнение животных, обработанных OX86 mIgG2a, и животных, обработанных изотипическим контролем, и межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0. Планки погрешностей представляют стандартную ошибку среднего. IP=внутрибрюшинно; SC=подкожно; TGI=подавление роста опухоли.

[0053] Фигура 30. Выравнивание аминокислотных последовательностей внеклеточных доменов молекул OX40 человека и мыши. OX40 человека (эталонная последовательность NCBI NP_003318.1) на 60% идентичен последовательности OX40 мыши (эталонная последовательность NCBI NP_035789.1). Выравнивание выполняли при помощи способа Clustal W. Подробно представлены внеклеточные домены OX40. Аминокислоты, которые отличаются в CRD3-домене человека и мыши, показаны стрелками. Два критических остатка эпитопа L116 и A126 заключены в рамку. CRD=домен с высоким содержанием цистеина.

[0054] Фигура 31. Номенклатура и схематическое изображение химерных вариантов OX40 человека/мыши. Химерные варианты OX40 человека/мыши были разработаны путем перестановки различных доменов или остатков из OX40 мыши (тонкая линия) в OX40 человека (толстая линия) (KO) или аминокислот из OX40 человека в OX40 мыши (KI). Мутации отдельных аминокислот или комбинаций показаны красными (KO) и зелеными (KI) стрелками. CRD=домены с высоким содержанием цистеина; KI=нокин; KO=нокаут; TM=трансмембранный домен.

[0055] Фигура 32A-C. FACS-анализ связывания OX40mAb24 с химерными вариантами OX40 человека/мыши. Все варианты получали с помощью транзиентной экспрессии в клетках 293F для определения характеристик связывания при помощи FACS-анализа с применением OX40mAb24 и его исходного mAb мыши, 9B12. Уровни экспрессии контролировали с применением поликлональных антител к OX40 человека и мыши. (A) С помощью химерных вариантов с заменами доменов выявили, что CRD3-домен является эпитоп-содержащим доменом. OX40mAb24 и 9B12 не связывают KO-варианты, кодирующие CRD3-домен мыши (KO_CRD3 и KO_CRD3+4), и распознают KI-вариант (KI_CRD3), кодирующий CRD3-домен человека. (B) Кроме того, с помощью мутирования отдельных аминокислот или их комбинаций, отличающихся CRD3-домене человека и мыши, определили, что критическими остатками эпитопа являются L116 и A126 в CRD3 (фигура 11-1). Связывание OX40mAb24 и 9B12 не происходило при замещении остатков L116 и A126 из молекулы человека на эквивалентные остатки из молекулы мыши (KO_L116+A126). (C) KI-варианты/варианты с приобретением функции подтверждают значимость этих двух критических остатков. Привитие L116, A126 или их комбинации в OX40 мыши приводило к связыванию с помощью OX40mAb24 и 9B12.

[0056] Фигура 33A-D. Уровни экспрессии Ki67 и ICOS в CD4+ T-клетках периферической крови и селезенки после введения OX86 mIgG2a мышам, ранее не подвергавшимся воздействию. Семи мышам BALB/c, ранее не подвергавшимся воздействию, в каждой группе вводили внутрибрюшинно в день 1 контрольные препараты (солевой раствор и изотипический контроль для IgG2a, NIP228) и исследуемый препарат (OX86 mIgG2a) при указанных уровнях дозы. Забор крови (панели A и C) проводили в указанные дни, а селезенки в пяти группах вырезали в день 10. Уровни экспрессии Ki67 (панель A и B) и ICOS (панели C и D) в CD4+ T-клетках измеряли при помощи проточной цитометрии. Средние значения процентной доли CD4-клеток крови, экспрессирующих Ki67 (панель A) и ICOS (панель C), показаны для каждой группы. Процентная доля CD4-клеток селезенки, экспрессирующих Ki67 (панель B) и ICOS (панель D), нанесена на график для каждого животного из отдельных групп. Планки погрешностей представляют стандартную ошибку среднего. *: P ≤ 0,05 отмечены на панелях A и C; P-значения, обладающие значимостью, приведены для каждой группы в панелях B и D.

[0057] Фигура 34A-B. Корреляция экспрессии Ki67 и ICOS на CD4+ T-клетках периферической крови и селезенки после введения OX86 mIgG2a мышам, не подвергавшимся воздействию. Сравнение проводили между процентной долей Ki67- и ICOS-положительных CD4 T-клеток, выделенных из периферической крови (панель A) и селезенок (панель B) отдельных животных, показанных на фигуре 12-1, через 10 дней после обработки контрольными препаратами (солевой раствор и изотипический контроль для IgG2a, NIP228) и исследуемым препаратом (OX86 mIgG2a) при указанных уровнях дозы. Измерения для отдельных мышей наносили на график. Линейный регрессионный анализ выполняли с применением программного обеспечения GraphPad Prism 6.0 в отношении полученной группы из наборов данных для определения линии наилучшего соответствия для этих данных. Коэффициент детерминации (r2) и значимость того, что наклон линии не равен нулю (P-значение), представлены на каждом графике.

[0058] Фигура 35A-D. Уровни экспрессии Ki67 и ICOS в CD8+ T-клетках периферической крови и селезенки после введения OX86 mIgG2a мышам, ранее не подвергавшимся воздействию. Семи мышам BALB/c, ранее не подвергавшимся воздействию, в каждой группе вводили внутрибрюшинно в день 1 контрольные препараты (солевой раствор и изотипический контроль для IgG2a, NIP228) и исследуемый препарат (OX86 mIgG2a) при указанных уровнях дозы. Забор крови (панели A и C) проводили в указанные дни, а селезенки в пяти группах вырезали в день 10. Уровни экспрессии Ki67 (панель A и B) и ICOS (панели C и D) в CD8+ T-клетках измеряли при помощи проточной цитометрии. Средние значения процентной доли CD8-клеток крови, экспрессирующих Ki67 (панель A) и ICOS (панель C), показаны для каждой группы. Процентная доля CD8-клеток селезенки, экспрессирующих Ki67 (панель B) и ICOS (панель D), нанесена на график для каждого животного из отдельных групп. Планки погрешностей представляют стандартную ошибку среднего. *: P ≤ 0,05 отмечены на панелях A и C; P-значения, обладающие значимостью, приведены для каждой группы в панелях B и D.

[0059] Фигура 36A-B. Корреляция экспрессии Ki67 и ICOS на CD8+ T-клетках периферической крови и селезенки после введения OX86 mIgG2a мышам, не подвергавшимся воздействию. Сравнение проводили между процентной долей Ki67 и ICOS-положительных CD8+ T-клеток, выделенных из периферической крови (панель A) и селезенок (панель B) отдельных животных, показанных на фигуре 12-1, через 10 дней после обработки контрольными препаратами (солевой раствор и изотипический контроль для IgG2a, NIP228) и исследуемым препаратом (OX86 mIgG2a) при указанных уровнях дозы. Измерения для отдельных мышей наносили на график. Линейный регрессионный анализ выполняли с применением программного обеспечения GraphPad Prism 6.0 в отношении полученной группы из наборов данных для определения линии наилучшего соответствия для этих данных. Коэффициент детерминации (r2) и значимость того, что наклон линии не равен нулю (P-значение), представлены на каждом графике.

[0060] Фигура 37A-D. Влияние OX86 IgG2a мыши на рост линии клеток CT26 в сингенной мышиной модели при отсутствии ингибиторных (Fcgr2b-/-) или активирующих (Fcer1g-/-) Fc-гамма рецепторов. Группам из восьми мышей Balb/c, полученных с помощью генной инженерии, направленной на отсутствие ингибиторного Fcγ рецептора IIb (Fcgr2b-/-; панели A и B) или активирующих Fcγ рецепторов (Fcer1g-/-; панели C и D), инокулировали SC клетки CT26 в день 1. Контрольные препараты (солевой раствор/без обработки и мутант D265A OX86 mIgG1/изотипический контроль) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 4 и 7. Приведены средние (панель A и C) и индивидуальные (панель B и D) значения объемов опухоли. Проводили сравнение животных, обработанных OX86 mIgG2a, а также животных без обработки и животных, обработанных изотипическим контролем, и межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0. Планки погрешностей представляют стандартную ошибку среднего. SC=подкожно; IP=внутрибрюшинно; TGI=подавление роста опухоли.

[0061] Фигура 38A-D. Влияние OX86 IgG2a мыши на рост линии клеток MCA205 в сингенной мышиной модели с отсутствием ингибиторных (Fcgr2b-/-) или активирующих (Fcer1g-/-) Fc-гамма рецепторов. Группам из восьми мышей C57BL/6, полученных с помощью осуществления генетической мутации, направленной на отсутствие ингибиторного Fcγ рецептора IIb (Fcgr2b-/-; панели A и B) или активирующих Fcγ рецепторов (Fcer1g-/-; панели C и D), инокулировали SC клетки MCA205 в день 1. Контрольные препараты (солевой раствор/без обработки и мутант D265A OX86 mIgG1/изотипический контроль) и исследуемый препарат (mOX40L FP) вводили IP в дни 4 и 7. Приведены средние (панель A и C) и индивидуальные (панель B и D) значения объемов опухоли. Проводили сравнение животных, обработанных mOX40L FP, а также животных без обработки и животных, обработанных изотипическим контролем, и межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0. Планки погрешностей представляют стандартную ошибку среднего. *: TGI ≥ 95%, P ≤ 0,023 по сравнению с группами без обработки и группами изотипического контроля в день 20 исследования. SC=подкожно; IP=внутрибрюшинно; TGI=подавление роста опухоли

[0062] Фигура 39A-B. Уровни экспрессии Ki67 в CD4+ T-клетках, выделенных из периферической крови, селезенки и опухоли CT26 после введения OX86 IgG2a мыши мышам с отсутствием ингибиторных (Fcgr2b-/-) или активирующих (Fcer1g-/-) Fc-гамма рецепторов. Группам из четырех мышей Balb/c, полученных с помощью генной инженерии, направленной на отсутствие ингибиторного Fcγ рецептора IIb (Fcgr2b-/-; панели A) или активирующих Fcγ рецепторов (Fcer1g-/-; панели B), инокулировали SC клетки CT26 в день 1; это исследование является независимым от исследования, представленного на фигуре 12-5, но проводилось аналогично. Контрольные препараты (солевой раствор/без обработки и мутант D265A OX86 mIgG1/изотипический контроль) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 4 и 7. Кровь, селезенку и опухоли получали в день 14 в случае панели A и в день 13 в случае панели B. Уровни экспрессии Ki67 в CD4+ T-клетках измеряли при помощи проточной цитометрии. Символы представляют процентную долю Ki67-положительных CD4+ T-клеток из каждой ткани индивидуальных мышей; горизонтальная полоса отображает средние значения для каждой группы. Межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0, и они указаны с помощью горизонтальной полосы с рассчитанными P-значениями. SC=подкожно; IP=внутрибрюшинно.

[0063] Фигура 40A-B. Уровни экспрессии Ki67 в CD8+ T-клетках, выделенных из периферической крови, селезенки и опухоли CT26 после введения OX86 IgG2a мыши мышам с отсутствием ингибиторных (Fcgr2b-/-) или активирующих (Fcer1g-/-) Fc-гамма рецепторов. Группам из четырех мышей Balb/c, полученных с помощью генной инженерии, направленной на отсутствие ингибиторного Fcγ рецептора IIb (Fcgr2b-/-; панели A) или активирующих Fcγ рецепторов (Fcer1g-/-; панели B), инокулировали SC клетки CT26 в день 1; это исследование является независимым от исследования, представленного на фигуре 12-5, но проводилось аналогично. Контрольные препараты (солевой раствор/без обработки и мутант D265A OX86 mIgG1/изотипический контроль) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 4 и 7. Кровь, селезенки и опухоль получали в день 14 в случае панели A и в день 13 в случае панели B. Уровни экспрессии Ki67 в CD8+ T-клетках измеряли при помощи проточной цитометрии. Символы представляют процентную долю Ki67-положительных CD8+ T-клеток из каждой ткани индивидуальных мышей; горизонтальная полоса представляет средние значения. Межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0, и они указаны с помощью горизонтальной полосы с рассчитанными P-значениями. SC=подкожно; IP=внутрибрюшинно.

[0064] Фигура 41A-B. Уровни экспрессии Ki67 в CD4+ T-клетках, выделенных из дренирующего лимфатического узла, селезенки и опухоли MCA205 после введения OX86 IgG2a мыши мышам с отсутствием ингибиторных (Fcgr2b-/-) или активирующих (Fcer1g-/-) Fc-гамма рецепторов. Группам из четырех мышей C57BL/6, полученных с помощью генной инженерии, направленной на отсутствие ингибиторного Fcγ рецептора IIb (Fcgr2b-/-; панели A) или активирующих Fcγ рецепторов (Fcer1g-/-; панели B), инокулировали SC клетки MCA205 в день 1; исследование является независимым от исследования, представленного на фигуре 12-6, но проводилось аналогично. Контрольные препараты (солевой раствор/без обработки и мутант D265A OX86 mIgG1/изотипический контроль) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 4 и 7. Дренирующие лимфатические узлы, селезенки и опухоль получали в день 20 в случае панели B. Уровни экспрессии Ki67 в CD4+ T-клетках измеряли с помощью проточной цитометрии. Символы представляют процентную долю Ki67-положительных CD4+ T-клеток из каждой ткани индивидуальных мышей; горизонтальная полоса представляет средние значения. Межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0, и они указаны с помощью горизонтальной полосы с рассчитанными P-значениями. SC=подкожно; IP=внутрибрюшинно.

[0065] Фигура 42A-B. Уровни экспрессии Ki67 в CD8+ T-клетках, выделенных из дренирующего лимфатического узла, селезенки и опухоли MCA205 после введения OX86 IgG2a мыши мышам с отсутствием ингибиторных (Fcgr2b-/-) или активирующих (Fcer1g-/-) Fc-гамма рецепторов. Группам из четырех мышей C57BL/6, полученных с помощью генной инженерии, направленной на отсутствие ингибиторного Fcγ рецептора IIb (Fcgr2b-/-; панели A) или активирующих Fcγ рецепторов (Fcer1g-/-; панели B), инокулировали SC клетки MCA205 в день 1; это исследование является независимым исследованию, представленному на фигуре. 12-6, но проведилось аналогично. Контрольные препараты (солевой раствор и контроль на основе мутанта D265A mOX40L FP ) и исследуемый препарат (OX86 mIgG2a) вводили IP в дни 4 и 7. Дренирующие лимфатические узлы, селезенки и опухоль получали в день 20. Уровни экспрессии Ki67 на CD8+ T-клетках измеряли с помощью проточной цитометрии. Символы представляют процентную долю Ki67-положительных CD8+ T-клеток из каждой ткани индивидуальных мышей; горизонтальная полоса представляет средние значения. Межгрупповые различия анализировали в отношении статистической значимости при помощи однофакторного ANOVA с применением программного обеспечения GraphPad Prism 6.0, и они указаны с помощью горизонтальной полосы с рассчитанными P-значениями. SC=подкожно; IP=внутрибрюшинно.

[0066] Фигура 43A-B. Снижение числа регуляторных T-клеток с помощью OX40mAb24. Панель A: Процентные доли CD4+Foxp3+ Treg клеток человека, измеренные в периферической крови мышей с приживленными иммунными клетками человека непосредственно перед иммунизацией KLH и обработкой контролем, NIP228 huIgG1 (huIgG1), или OX40mAb24. «Без mAb» показывает отсутствие иммунизации и отсутствие обработки с помощью mAb. Панель B: Процентные доли CD4+FoxP3+ Treg клеток человека в периферической крови мышей из тех же самых групп после иммунизации и обработки с помощью mAb. Статистические p-значения представлены на основе однофакторного ANOVA. Hu=человек; mAb=моноклональное антитело; Treg=регуляторные T-клетки.

[0067] Фигура 44A-D. Экспансия эффекторных CD4 T-клеток и CD4 T-клеток памяти относительно регуляторных T-клеток после обработки с помощью OX40mAb24. Соотношения CD4+ T-клеток человека к Treg клеткам человека в периферической крови мышей с приживленными иммунными клетками человека либо до обработки (слева), либо после обработки (справа) путем иммунизации KLH с последующей введением NIP228 huIgG1 mAb (huIgG1) или OX40mAb24, как указано для всех CD4+ (панель A); эффекторных CD4+ Т-клеток (Teff) (панель B); эффекторных CD4+ Т-клеток памяти (Tem) (панель C) и центральных CD4+ Т-клеток памяти (Tcm) (панель D). «Без mAb» показывает отсутствие иммунизации, а также отсутствие обработки с помощью mAb. Статистические p-значения представлены на основе однофакторного ANOVA. Hu=человек; mAb=моноклональное антитело; Tcm=центральная Т-клетка памяти; Teff=эффекторная T-клетка; Tem=эффекторная T-клетка памяти.

[0068] Фигура 45A-B. Повышенное соотношение эффекторных CD8+ Т-клеток к регуляторным CD8+ Т-клеткам у мышей, обработанных с помощью OX40mAb24. Соотношения эффекторных CD8+ Т-клеток человека к CD8+ Treg клеткам человека в периферической крови мышей с приживленными иммунными клетками человека либо до обработки (слева), либо после обработки (справа) путем иммунизации KLH с последующей обработкой с помощью NIP228 huIgG1 mAb (huIgG1) или OX40mAb24, как указано. «Без mAb» показывает отсутствие иммунизации, а также отсутствие обработки с помощью mAb. Статистическое p-значение представлено на основе однофакторного ANOVA, сравнивающего все группы, как указано. Hu=человек; mAb=моноклональное антитело; Teff=эффекторная T-клетка; Treg=регуляторная T-клетка.

[0069] Фигуры 46A-C. Повышенные уровни CD25 (рецептор IL-2) на CD8+ T-клетках у мышей, обработанных с помощью OX40mAb24. Процентная доля CD25 (рецептор IL-2)-положительных клеток человека среди CD8+ T-клеток человека в периферической крови мышей с приживленными иммунными клетками человека либо после обработки(слева), либо до обработки (справа), заключающейся в отсутствии обработки («без mAb») или иммунизации KLH с последующей обработкой с помощью NIP228 huIgG1 mAb (huIgG1) или OX40MAB24, как указано, для (A) всех CD8+ Т-клеток ; (B) эффекторных CD8+ Т-клеток (Teff), (C) эффекторных CD8+ Т-клеток памяти (Tem). «Без mAb» показывает отсутствие иммунизации, а также отсутствие обработки с помощью mAb. Статистические p-значения представлены на основе однофакторного ANOVA. Hu=человек; mAb=моноклональное антитело; Teff=эффекторная T-клетка; Tem=эффекторная T-клетка памяти.

ПОДРОБНОЕ ОПИСАНИЕ

[0070] Вовлечение рецептора OX40 на T-клетках, например, CD4+ T-клетках во время или непосредственно после примирования антигеном приводит к усиленному ответу T-клеток, например, CD4+ T-клеток, на антиген. В контексте настоящего раскрытия термин "вовлечение" относится к связыванию с рецептором OX40 или стимуляции по меньшей мере одного вида активности, опосредуемой им. Например, вовлечение рецептора OX40 на антиген-специфических T-клетках, например, CD4+ T-клетках, может привести к повышенной пролиферации T-клеток по сравнению с ответом на антиген отдельно и повышенной выработке цитокинов. Усиленный ответ на антиген может сохраняться в течение значительно более продолжительного периода времени, чем в отсутствие вовлечения рецептора OX40. Таким образом, стимуляция посредством рецептора OX40 усиливает антиген-специфический иммунный ответ благодаря интенсификации распознавания Т-клетками антигенов, например, опухолевых антигенов.

[0071] Агонисты ОX40 могут усиливать антиген-специфические иммунные ответы у субъекта, такого как субъект-человек, при введении субъекту во время или вскоре после примирования T-клеток антигеном. Агонисты OX40 включают лиганды OX40 ("OX40L"), такие как растворимые белки слияния на основе OX40L и антитела к OX40 или их фрагменты. Конкретным примером является гуманизированное антитело, которое специфически связывается с OX40, вызывая тем самым передачу сигнала. В настоящем раскрытии предусмотрен ряд гуманизированных моноклональных антител к OX40. Также описаны нуклеиновые кислоты, включающие полинуклеотидные последовательности, которые кодируют такие антитела. В настоящем раскрытии также предусмотрены способы усиления антиген-специфического иммунного ответа у субъекта с применением гуманизированных моноклональных антител к OX40.

ОПРЕДЕЛЕНИЯ

[0072] Следует отметить, что форма единственного числа объекта относится к одному или нескольким таким объектам; например, подразумевается, что "связывающая молекула" представляет одну или несколько связывающих молекул. В связи с этим, формы единственного числа, термины "один или несколько" и "по меньшей мере один" можно использовать в данном документе взаимозаменяемо.

[0073] Кроме того, "и/или" там, где оно употребляется в данном документе, следует рассматривать как конкретное раскрытие каждого из двух указанных свойств или компонентов с другим или без него. Таким образом, подразумевается, что термин "и/или", при употреблении в данном документе в такой фразе, как "А и/или В", включает "А и В", "А или В", "А" (отдельно) и "В" (отдельно). Аналогично, подразумевается, что термин "и/или", при употреблении в такой фразе, как "А, В и/или С", охватывает каждый из следующих вариантов осуществления: А, В и С; А, В или С; А или С; А или В; В или С; А и С; А и В; В и С; А (отдельно); В (отдельно) и С (отдельно).

[0074] Если не определено иное, технические и научные термины, используемые в данном документе, имеют то же значение, которое обычно понимает специалист в данной области техники, к которой относится настоящее раскрытие. Например, Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; и Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, обеспечивают специалиста общим словарем многих терминов, используемых в настоящем раскрытии.

[0075] Единицы, префиксы и символы обозначены в принятой форме системы единиц (СИ). Числовые диапазоны включают числа, определяющие диапазон. Если не указано иное, то аминокислотные последовательности записаны слева направо в направлении от амино- к карбокси-концу. Приведенные в данном документе заголовки не ограничивают различные аспекты или аспекты настоящего раскрытия, которые могут быть поняты со ссылкой на описание в целом. Соответственно, термины, приведенные непосредственно ниже, более полно определены посредством ссылки на описание во всей своей полноте.

[0076] Как используется в данном документе, термин "не встречающееся в природе" вещество, композиция, объект и/или любая комбинация веществ, композиций или объектов, или любые их грамматические варианты, представляет собой условный термин, который в явной форме исключает, но только исключает, такие формы вещества, композиции, объекта и/или любой комбинации веществ, композиций или объектов, которые являются или которые в любое время могут представлять собой, определяться или пониматься экспертом или административным или судебным органом как "встречающиеся в природе".

[0077] Как используется в данном документе, подразумевается, что выражение "полипептид" охватывает "полипептид" в единственном числе, а также "полипептиды" во множественном числе, и относится к молекуле, состоящей из мономеров (аминокислот), линейно связанных амидными связями (также известными как пептидные связи). Термин "полипептид" относится к любой цепи или цепям из двух или более аминокислот и не относится к конкретной длине продукта. Таким образом, пептиды, дипептиды, трипептиды, олигопептиды, "белок", "аминокислотная цепь" или любой другой термин, используемый для обозначения цепи или цепей из двух или более аминокислот, включены в определение "полипептида", и термин "полипептид" можно использовать вместо любого из этих терминов или взаимозаменяемо с любым из них. Также подразумевается, что термин "полипептид" относится к продуктам постэкспрессионных модификаций полипептида, включающих без ограничений гликозилирование, ацетилирование, фосфорилирование, амидирование и дериватизацию с помощью известных защитных/блокирующих групп, протеолитическое расщепление или модификацию с помощью не встречающихся в природе аминокислот. Полипептид может происходить из биологического источника или быть получен с помощью рекомбинантной технологии, но не обязательно быть транслирован из обозначенной последовательности нуклеиновой кислоты. Он может быть получен любым способом, в том числе путем химического синтеза.

[0078] Размер полипептида, раскрытого в данном документе, может составлять приблизительно 3 или более, 5 или более, 10 или более, 20 или более, 25 или более, 50 или более, 75 или более, 100 или более, 200 или более, 500 или более, 1000 или более или 2000 или более аминокислот. Полипептиды могут характеризоваться определенной трехмерной структурой, хотя они не обязательно характеризуются такой структурой. Полипептиды с определенной трехмерной структурой называются свернутыми, а полипептиды, не обладающие определенной трехмерной структурой, а скорее способные принимать большое число различных конформаций, называются несвернутыми. Как используется в данном документе, термин гликопротеин относится к белку, связанному по меньшей мере с одним углеводородным фрагментом, который присоединен к белку посредством кислородсодержащей или азотсодержащей боковой цепи аминокислоты, например, серина или аспарагина.

[0079] Под "выделенным" полипептидом или его фрагментом, вариантом или производным подразумевается полипептид, который не находится в своем естественном окружении. Не подразумевается какой-либо конкретный уровень очистки. Например, выделенный полипептид может быть удален из своей нативной или естественной окружающей среды. Полученные рекомбинантным путем полипептиды и белки, экспрессируемые в клетках-хозяевах, считаются выделенными, как раскрыто в данном документе, как и нативные или рекомбинантные полипептиды, которые были отделены, фракционированы или частично или в значительной степени очищены при помощи любой подходящей методики.

[0080] Как используется в данном документе, термин "не встречающийся в природе" полипептид или любые его грамматические варианты, представляет собой условный термин, который в явной форме исключает, но только исключает, такие формы полипептида, которые являются или которые в любое время могут представлять собой, определяться или пониматься экспертом или административным или судебным органом как "встречающиеся в природе".

[0081] Другие полипептиды, раскрытые в данном документе, представляют собой фрагменты, производные, аналоги или варианты вышеупомянутых полипептидов и любую их комбинацию. Термины "фрагмент", "вариант", "производное" и "аналог", как раскрыто в данном документе, включают любые полипептиды, которые сохраняют по меньшей мере некоторые из свойств соответствующего нативного антитела или полипептида, например, специфическое связывание с антигеном. Фрагменты полипептидов включают, например, протеолитические фрагменты, а также делеционные фрагменты, в дополнение к специфическим фрагментам антител, описанным в других частях данного документа. Например, варианты полипептида включают фрагменты, как описано выше, а также полипептиды с измененными аминокислотными последовательностями вследствие аминокислотных замен, делеций или вставок. Согласно определенным аспектам варианты могут быть не встречающимися в природе. Не встречающиеся в природе варианты могут быть получены при помощи методик мутагенеза, известных из уровня техники. Вариантные полипептиды могут содержать консервативные или неконсервативные аминокислотные замены, делеции или добавления. Производные представляют собой полипептиды, которые были изменены таким образом, чтобы характеризоваться дополнительными признаками, не обнаруживаемыми у исходного полипептида. Примеры включают белки слияния. Вариантные полипептиды также могут называться в данном документе "аналогами полипептидов". Как используется в данном документе, "производное" полипептида может также обозначать заявленный полипептид с одной или несколькими аминокислотами, химически дериватизированными путем осуществления реакции функциональной боковой группы. Также в качестве "производных" включены такие пептиды, которые содержат одно или несколько производных двадцати стандартных аминокислот. Например, пролин может быть заменен 4-гидроксипролином; лизин может быть заменен 5-гидроксилизином; гистидин может быть заменен 3-метилгистидином; серин может быть заменен гомосерином; и лизин может быть заменен орнитином.

[0082] "Консервативная аминокислотная замена" представляет собой таковую, при которой одна аминокислота замещается другой аминокислотой со сходной боковой цепью. Семейства аминокислот со сходными боковыми цепями были определены в данной области техники и включают основные боковые цепи (например, лизин, аргинин, гистидин), кислые боковые цепи (например, аспарагиновую кислоту, глутаминовую кислоту), незаряженные полярные боковые цепи (например, аспарагин, глутамин, серин, треонин, тирозин, цистеин), неполярные боковые цепи (например, глицин, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан), бета-разветвленные боковые цепи (например, треонин, валин, изолейцин) и ароматические боковые цепи (например, тирозин, фенилаланин, триптофан, гистидин). Например, замена тирозина фенилаланином является консервативной заменой. Согласно определенным вариантам осуществления консервативные замены в последовательностях полипептидов и антител по настоящему раскрытию не подавляют связывание полипептида или антитела, содержащего данную аминокислотную последовательность, с антигеном, с которым связывается связывающая молекула. Способы выявления нуклеотидных и аминокислотных консервативных замен, которые не приводят к устранению связывания с антигенами, хорошо известны из уровня техники (см., например, Brummell et al., Biochem. 32: 1180-1 187 (1993); Kobayashi et al., Protein Eng. 12(10):879-884 (1999); и Burks et al., Proc. Natl. Acad. Sci. USA 94:.412-417 (1997)).

[0083] Предполагается, что термин "полинуклеотид" охватывает нуклеиновую кислоту в форме единственного числа, а также нуклеиновые кислоты в форме множественного числа, и относится к выделенной молекуле или конструкции нуклеиновой кислоты, например, матричной РНК (mRNA), cDNA или плазмидной ДНК (pDNA). Полинуклеотид может содержать обычную фосфодиэфирную связь или необычную связь (например, амидную связь, такую как встречается в пептидных нуклеиновых кислотах (PNA)). Термины "нуклеиновая кислота" или "последовательность нуклеиновой кислоты" относятся к любому одному или нескольким сегментам нуклеиновой кислоты, например, фрагментам ДНК или РНК, присутствующим в полинуклеотиде.

[0084] Под "выделенной" нуклеиновой кислотой или полинуклеотидом подразумевается любая форма нуклеиновой кислоты или полинуклеотида, которая отделена от своей нативной окружающей среды. Например, полинуклеотид, очищенный с помощью геля, или рекомбинантный полинуклеотид, кодирующий полипептид, содержащийся в векторе, можно считать "выделенным". Также считается "выделенным" сегмент полинуклеотида, например, ПЦР-продукт, который был сконструирован с целью получения сайтов рестрикции для клонирования. Дополнительные примеры выделенного полинуклеотида включают рекомбинантные полинуклеотиды, содержащиеся в гетерологичных клетках-хозяевах, или очищенные (частично или в значительной степени) полинуклеотиды в ненативном растворе, таком как буфер или солевой раствор. Выделенные молекулы РНК включают in vivo или in vitro РНК-транскрипты полинуклеотидов, при этом данный транскрипт не представляет собой таковой, который бы встречался в природе. Выделенные полинуклеотиды или нуклеиновые кислоты дополнительно включают такие молекулы, полученные синтетически. Кроме того, полинуклеотид или нуклеиновая кислота могут представлять собой или могут содержать регуляторный элемент, такой как промотор, сайт связывания рибосомы или терминатор транскрипции.

[0085] Как используется в данном документе, "не встречающийся в природе" полинуклеотид или любые его грамматические варианты, представляет собой условное определение, которое в явной форме исключает, но только исключает, такие формы полинуклеотида, которые являются или которые в любое время могут представлять собой, определяться или пониматься экспертом или административным или судебным органом как "встречающееся в природе".

[0086] Как используется в данном документе, "кодирующая область" представляет собой часть нуклеиновой кислоты, состоящую из кодонов, транслируемых в аминокислоты. Хотя "стоп-кодон" (TAG, TGA или TAA) не транслируется в аминокислоту, он может считаться частью кодирующей области, однако любые фланкирующие последовательности, например, промоторы, сайты связывания рибосомы, терминаторы транскрипции, интроны и т.п., не являются частью кодирующей области. Две или более кодирующие области могут присутствовать в одной полинуклеотидной конструкции, например, в одном векторе, или в отдельных полинуклеоидных конструкциях, например, в отдельных (различных) векторах. Кроме того, любой вектор может содержать одну кодирующую область или может содержать две или более кодирующие области, например, один вектор может отдельно кодировать вариабельную область тяжелой цепи иммуноглобулина и вариабельную область легкой цепи иммуноглобулина. Также вектор, полинуклеотид или нуклеиновая кислота могут включать гетерологичные кодирующие области, либо слитые, либо неслитые с другой кодирующей областью. Гетерологичные кодирующие области включают без ограничений области, кодирующие специализированные элементы или мотивы, такие как секреторный сигнальный пептид или гетерологичный функциональный домен.

[0087] Согласно определенным вариантам осуществления полинуклеотид или нуклеиновая кислота представляют собой ДНК. В случае ДНК полинуклеотид, содержащий нуклеиновую кислоту, которая кодирует полипептид, обычно может содержать промотор и/или другие элементы, осуществляющие контроль транскрипции или трансляции, функционально связанные с одной или несколькими кодирующими областями. Функциональная связь наблюдается тогда, когда кодирующая область для продукта гена, например, полипептида, связана с одной или несколькими регуляторными последовательностями таким образом, чтобы экспрессия продукта гена находилась под влиянием или контролем регуляторной последовательности(ей). Два фрагмента ДНК (такие как область, кодирующая полипептида, и промотор, связанный с ней) "функционально связаны", если индуцирование функции промотора приводит к транскрипции мРНК, кодирующей требуемый продукт гена, и если природа связи между двумя фрагментами ДНК не препятствует способности последовательностей, регулирующих экспрессию, управлять экспрессией продукта гена или не препятствует способности ДНК-матрицы транскрибироваться. Таким образом, промоторная область будет функционально связанной с нуклеиновой кислотой, кодирующей полипептид, если промотор способен воздействовать на транскрипцию данной нуклеиновой кислоты. Промотор может представлять собой промотор, специфический в отношении клеток, который управляет транскрипцией ДНК по существу в заранее определенных клетках. Другие элементы контроля транскрипции, кроме промотора, например, энхансеры, операторы, репрессоры и сигналы терминации транскрипции, могут быть функционально связанными с полинуклеотидом для управления транскрипцией, специфической в отношении клеток.

[0088] Специалистам в данной области известны различные области контроля транскрипции. Они включают без ограничений области контроля транскрипции, функционирующие в клетках позвоночных, такие как без ограничений промоторные и энхансерные сегменты цитомегаловирусов (немедленно-ранний промотор вместе с интроном-A), вируса обезьян 40 (ранний промотор) и ретровирусов (таких как вирус саркомы Рауса). Другие области контроля транскрипции включают таковые, происходящие из генов позвоночных, таких как ген актина, белка теплового шока, бычьего гормона роста и кроличьего ß-глобина, а также другие последовательности, способные контролировать экспрессию генов в эукариотических клетках. Дополнительные подходящие области контроля транскрипции включают тканеспецифические промоторы и энхансеры, а также лимфокин-индуцируемые промоторы (например, промоторы, индуцируемые интерферонами или интерлейкинами).

[0089] Аналогично, специалистам в данной области известны различные элементы контроля трансляции. Они включают без ограничений сайты связывания рибосомы, кодоны инициации и терминации трансляции и элементы, происходящие из пикорнавирусов (в частности, участок внутренней посадки рибосомы или IRES, также называемый CITE-последовательностью).

[0090] Согласно другим вариантам осуществления полинуклеотидом может быть РНК, например, в форме матричной РНК (mRNA), транспортной РНК или рибосомальной РНК.

[0091] Кодирующие области полинуклеотидов и нуклеиновых кислот могут быть связаны с дополнительными кодирующими областями, которые кодируют секреторные или сигнальные пептиды, которые направляют секрецию полипептида, кодируемого полинуклеотидом, раскрываемых в данном документе. Согласно гипотезе сигнальной последовательности белки, секретируемые в клетках млекопитающих, имеют сигнальный пептид или секреторную лидерную последовательность, отщепляющуюся от зрелого белка после начала экспорта растущей белковой цепи через гранулярный эндоплазматический ретикулум. Специалистам в данной области известно, что полипептиды, секретируемые клетками позвоночных, могут иметь сигнальный пептид, слитый с N-концом полипептида, который отщепляется от полного или "полноразмерного" полипептида с получением секретируемой или зрелой формы полипептида. Согласно определенным вариантам осуществления применяют нативный сигнальный пептид, например, сигнальный пептид тяжелой цепи или легкой цепи иммуноглобулина, или функциональное производное этой последовательности, которое сохраняет способность управлять секрецию полипептида, функционально связанного с ним. В качестве альтерантивы можно применять гетерологичный сигнальный пептид млекопитающих или его функциональное производное. Например, лидерная последовательность дикого типа может быть замещена лидерной последовательностью тканевого активатора плазминогена (TPA) человека или ß-глюкуронидазы мыши.

[0092] В данном документе раскрыты определенные связывающие молекулы или их антигенсвязывающие фрагменты, варианты или производные. Если специально не ссылаются на полноразмерные антитела, термин "связывающая молекула" охватывает полноразмерные антитела, а также антигенсвязывающие субъединицы, фрагменты, варианты, аналоги или производные таких антител, например, сконструированных молекул или фрагментов антител, которые связывают антиген аналогично молекулам антител, но в которых использован другой остов.

[0093] Как используется в данном документе, термин "связывающая молекула" относится в своем самом широком смысле к молекуле, которая специфически связывается с рецептором, например, эпитопом или антигенной детерминантой. Как дополнительно описано в данном документе, связывающая молекула может содержать один или несколько "антигенсвязывающих доменов", описанных в данном документе. Неограничивающим примером связывающей молекулы является антитело или его фрагмент, которые сохраняют антиген-специфическое связывание.

[0094] Как используется в данном документе, термины "связывающий домен", "рецептор-связывающий домен" или "антигенсвязывающий домен" относятся к области связывающей молекулы, которая необходима и достаточна для специфического связывания с эпитопом. Например, "Fv," например, вариабельная область тяжелой цепи и вариабельная область легкой цепи антитела, либо в виде двух отдельных полипептидных единиц, либо в виде одной цепи, считается "связывающим доменом". Другие связывающие домены включат без ограничений вариабельную область тяжелой цепи (VHH) антитела, происходящего из вида верблюдовых, или шесть определяющих комплементарность областей (CDR) иммуноглобулина, экспрессируемых в гетерологическом каркасе, например, другой зародышевой линии или виде, или в другом остове, например, остове фибронектина. "Связывающая молекула", как описано в данном документе, может включать один, два, три, четыре, пять, шесть, семь, восемь, девять, десять, одиннадцать, двенадцать или более "антигенсвязывающих доменов".

[0095] Термины "антитело" и "иммуноглобулин" можно применять в данном документе взаимозаменяемо. Антитело (или его фрагмент, вариант или производное, раскрытые в данном документе) включает по меньшей мере вариабельный домен тяжелой цепи (в случае видов верблюдовых) или по меньшей мере вариабельные домены тяжелой цепи и легкой цепи. Основные структуры иммуноглобулинов в системах позвоночных относительно хорошо изучены. См., например, Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988). Если не указано иное, термин "антитело" охватывает все, находящееся в диапазоне от небольшого антигенсвязывающего фрагмента антитела до полноразмерного антитела, например, IgG-антитело, которое включает две полные тяжелые цепи и две полные легкие цепи, IgA-антитело, которое включает четыре полные тяжелые цепи и четыре полные легкие цепи и необязательно включает J-цепь и/или секреторный компонент, или IgM-антитело, которое включает десять или двенадцать полных тяжелых цепей и десять или двенадцать полных легких цепей и необязательно включает J-цепь.

[0096] Как будет обсуждаться более подробно ниже, термин "иммуноглобулин" включает разнообразные широкие классы полипептидов, которые могут отличаться биохимически. Специалистам в данной области будет понятно, что тяжелые цепи классифицируются как гамма, мю, альфа, дельта или эпсилон (γ, μ, α, δ, ε), при этом внутри некоторых из них имеются собственные подклассы (например, γ1-γ4 или α1-α2)). Именно природа данной цепи определяет "класс" антитела, такой как IgG, IgM, IgA, IgG или IgE соответственно. Подклассы иммуноглобулинов (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1, IgA2 и т.д., хорошо охарактеризованы и, как известно, обеспечивают функциональную специализацию. Модифицированные варианты каждого из этих классов и изотипов легко различит специалист в данной области в свете настоящего раскрытия и, соответственно, они все находятся в объеме настоящего раскрытия.

[0097] Легкие цепи классифицируются либо как каппа, либо как лямбда (κ, λ). Каждый класс тяжелой цепи может быть связан либо с легкой каппа-цепью, либо с легкой лямбда-цепью. Обычно легкая и тяжелая цепи ковалентно связаны друг с другом, и "хвостовые" участки двух тяжелых цепей связаны друг с другом ковалентными дисульфидными связями или нековалентными связями, когда иммуноглобулины получают с помощью гибридом, В-клеток или с помощью генетически сконструированных клеток-хозяев. В тяжелой цепи аминокислотные последовательности расположены от N-конца на раздвоенных концах Y-конфигурации к C-концу в нижней части каждой цепи. Основная структура определенных антител, например, IgG-антител, включает две субъединицы тяжелой цепи и две субъединицы легкой цепи, соединенные ковалентно с помощью дисульфидных связей с образованием "Y"-образной структуры, также называемой в данном документе "H2L2"-структура.

[0098] Как легкая, так и тяжелая цепи подразделяются на области структурной и функциональной гомологии. Термин "константный" и "вариабельный" используют в отношении функции. В связи с этим будет понятно, что вариабельные домены из частей как вариабельной области легкой цепи (VL), так и вариабельной области тяжелой цепи (VH), определяют распознавание антигена и специфичность в его отношении. Наоборот, константные домены легкой цепи (CL) и тяжелой цепи (CH1, CH2 или CH3) обеспечивают биологические свойства, такие как секреция, способность к переносу через плаценту, связывание Fc-рецептором, связывание с комплементом и т. п. Согласно правилу нумерация доменов константной области возрастает по мере удаления от антигенсвязывающего участка или амино-конца антитела. N-концевая часть представляет собой вариабельную область, а на C-концевой части находится константная область; в CH3-домене (или CH4 в случае IgM) и CL-домене фактически находится карбокси-конец тяжелой и легкой цепи соответственно.

[0100] Как указано выше, связывающий домен, например, вариабельная область антитела, обеспечивает то, что связывающая молекула селективно распознает и специфически связывает рецептор или эпитоп на антигене. Иными словами, VL-домен и VH-домен или подмножество определяющих комплементарность областей (CDR) связывающей молекулы, например, антитела, объединяют с образованием вариабельной области, которая определяет трехмерный антигенсвязывающий участок. Более конкретно, антигенсвязывающий участок определяется тремя CDR на каждой из VH- и VL-цепей. Определенные антитела образуют более крупные структуры. Например, IgA может образовывать молекулу, которая включает две единицы H2L2, J-цепь и секреторный компонент, все из которых соединены ковалентно с помощью дисульфидных связей, а IgM может образовывать пентамерную или гексамерную молекулу, которая включает пять или шесть единиц H2L2 и необязательно J-цепь, соединенные ковалентно с помощью дисульфидных связей.

[0101] Шесть "определяющих комплементарность областей" или "CDR", присутствующих в антигенсвязывающем домене антитела, представляют собой короткие несмежные последовательности аминокислот, которые расположены определенным образом с образованием связывающего домена, когда антитело принимает свою трехмерную конфигурацию в водной среде. Остальные аминокислоты в связывающем домене, называемые "каркасными" или "FW"-областями, характеризуются меньшей межмолекулярной вариабельностью. Каркасные области главным образом принимают β-складчатую конформацию, а CDR образуют петли, которые соединяются с β-складчатой структурой и, в некоторых случаях, образуют ее часть. Таким образом, функцией каркасных областей является образование остова, который обеспечивает позиционирование CDR в правильной ориентации с помощью нековалентных взаимодействий между цепями. Связывающий домен, образованный позиционированными CDR, образует поверхность, комплементарную эпитопу на иммунореактивном антигене. Эта комплементарная поверхность содействует нековалентному связыванию антитела с его когнатным эпитопом. Аминокислоты, которые составляют CDR и каркасные области соответственно, может легко идентифицировать для каждой указанной вариабельной области тяжелой или легкой цепи специалист в данной области, поскольку они были определены многими различными способами (см., "Sequences of Proteins of Immunological Interest," Kabat, E., et al., U.S. Department of Health and Human Services, (1983); и Chothia and Lesk, J. Mol. Biol., 196:901-917 (1987), которые включены в данный документ при помощи ссылки во всей своей полноте).

[0102] В случае, когда существует два или более определений термина, который используется и/или принят в данной области техники, подразумевается, что определение термина, применяемого в данном документе, включает все такие значения, если в явном виде не указано обратное. Конкретным примером является применение термина "определяющая комплементарность область" ("CDR") для описания несмежных антигенсвязывающих участков, обнаруживаемых в вариабельной области полипептидов как тяжелой, так и легкой цепи. Эти конкретные области были описаны, например, в Kabat et al., U.S. Dept. of Health and Human Services, "Sequences of Proteins of Immunological Interest" (1983) и в Chothia et al., J. Mol. Biol. 196:901-917 (1987), которые включены в данный документ посредством ссылки. Определения по Kabat и Chothia включают перекрывания или подмножества аминокислот при сравнении друг с другом. Тем не менее, подразуемаевается, что применение каждого определения (или других определений, известных специалистам в данной области) для обозначения CDR антитела или его варианта находится в объеме термина, определенного и применяемого в данном документе, если не указано иное. Соответствующие аминокислоты, которые составляют CDR, как определено согласно каждой из вышеупомянутых ссылок, изложены ниже в таблице 1 для сравнения. Точные номера аминокислот, которые составляют определенную CDR, будут варьировать в зависимости от последовательности и размера CDR. Специалисты в данной области могут стандартным образом определить, какие аминокислоты входят в конкретную CDR с учетом аминокислотной последовательности вариабельной области антитела.

Таблица 1. Определения CDR1

По Kabat По Chothia
VH CDR1 31-35 26-32
VH CDR2 50-65 52-58
VH CDR3 95-102 95-102
VL CDR1 24-34 26-32
VL CDR2 50-56 50-52
VL CDR3 89-97 91-96

1Нумерация всех определений CDR в таблице 1 находится в соответствии с методами нумерации, изложенными в Kabat et al. (см. ниже).

[0103] Kabat et al. также определили систему нумерации для тяжелой и легкой цепей антител, например, последовательностей вариабельных доменов антител, которая применима для любого антитела. Специалист в данной области может однозначно соотнести эту систему "нумерации по Kabat" с любой последовательностью вариабельного домена, без использования каких-либо экспериментальных данных, помимо самой последовательности. Как используется в данном документе, "нумерация по Kabat" относится к системе нумерации, изложенной в Kabat et al., U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest" (1983). В случае, когда применение системы нумерации по Kabat явно не упоминается, все равно для всех аминокислотных последовательностей в настоящем раскрытии применяется последовательная нумерация.

[0104] Связывающие молекулы, например, антитела или их антигенсвязывающие фрагменты, варианты или производные, включат без ограничений поликлональные, моноклональные, человеческие, гуманизированные или химерные антитела, одноцепочечные антитела, эпитоп-связывающие фрагменты, например, Fab, Fab' и F(ab')2, Fd, Fv, одноцепочечные Fv (scFv), одноцепочечные антитела, связанные дисульфидными связями Fv (sdFv), фрагменты, содержащие либо VL-домен, либо VH-домен, фрагменты, получаемые при помощи библиотеки экспрессии Fab. scFv-молекулы известны в данной области техники и описаны, например, в патенте США № 5892019. Молекулы иммуноглобулинов или антител, охватываемые настоящим раскрытием, могут принадлежать к любому типу (например, IgG, IgE, IgM, IgD, IgA и IgY), классу (например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2) или подклассу молекул иммуноглобулинов.

[0105] Под "специфически связывается", как правило, подразумевают то, что связывающая молекула, например, антитело или его фрагмент, вариант или производное, связывается с эпитопом посредством своего антигенсвязывающего домена, и что связывание подразумевает некоторую комплементарность между антигенсвязывающим доменом и эпитопом. Согласно этому определению, говорится, что связывающая молекула "специфически связывается" с эпитопом, если она связывается с этим эпитопом при помощи своего антигенсвязывающего домена с большей легкостью, чем она бы связывалась со случайным, неродственным, эпитопом. Выражение "специфичность" применяется в данном документе для обозначения относительной аффинности, с которой определенная связывающая молекула связывается с определенным эпитопом. Например, можно говорить, что связывающая молекула "A" характеризуется более высокой специфичностью в отношении данного эпитопа, чем связывающая молекула "B", или можно говорить, что связывающая молекула "A" связывается с эпитопом "C" с более высокой специфичностью, чем с родственным эпитопом "D".

[0106] Можно сказать, что связывающая молекула, например, антитело или его фрагмент, вариант или производное, раскрытая в данном документе, связывает целевой антиген со скоростью диссоциации (k(off)) меньшей или равной, например, 5 X 10-2 с-1, 10-2 с-1, 5 X 10-3 с-1, 10-3 с-1, 5 X 10-4 с-1, 10-4 с-1, 5 X 10-5 с-1 или 10-5 с-1, 5 X 10-6 с-1, 10-6 с-1, 5 X 10-7 с-1 или 10-7 с-1.

[0107] Можно сказать, что связывающая молекула, например, антитело или антигенсвязывающий фрагмент, вариант или производное, раскрытая в данном документе, связывает целевой антиген со скоростью (k(on)) большей или равной, например, 103 M-1 с-1, 5 X 103 M-1 с-1, 104 M-1 с-1, 5 X 104 M-1 с-1, 105 M-1 с-1, 5 X 105 M-1 с-1, 106 M-1 с-1, или 5 X 106 M-1 с-1, или 107 M-1 с-1.

[0108] Говорится, что связывающая молекула, например, антитело или его фрагмент, вариант или производное, конкурентно ингибирует связывание эталонного антитела или его антигенсвязывающего фрагмента с данным эпитопом, если она предпочтительно связывается с этим эпитопом в такой степени, что она в некоторой степени блокирует связывание эталонного антитела или антигенсвязывающего фрагмента с эпитопом. Конкурентное ингибирование можно определить с помощью любого способа, известного из уровня техники, например, с помощью конкурентных ELISA-анализов. Можно сказать, что связывающая молекула конкурентно ингибирует связывание эталонного антитела или антигенсвязывающего фрагмента с данным эпитопом по меньшей мере на 90%, по меньшей мере на 80%, по меньшей мере на 70%, по меньшей мере на 60% или по меньшей мере на 50%.

[0109] Как используется в данном документе, термин "аффинность" обозначает показатель силы связывания индивидуального эпитопа с одним или несколькими связывающими доменами, например, молекулы иммуноглобулина. См., например, Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988) на страницах 27-28. Как используется в данном документе, термин "авидность" обозначает общую стабильность комплекса между группой связывающих доменов и антигеном. См., например, Harlow на страницах 29-34. Авидность связана как с аффинностью индивидуальных связывающих доменов в группе в отношении специфических эпитопов, так и с валентностями иммуноглобулинов и антигена. Например, взаимодействие между бивалентным моноклональным антителом и антигеном с высокоповторяющейся структурой эпитопа, такой как полимер, характеризовалось бы высокой авидностью. Взаимодействие между бивалентным моноклональным антителом и рецептором, присутствующим с высокой плотностью на клеточной поверхности, также характеризовалось бы высокой авидностью.

[0110] Связывающие молекулы или их антигенсвязывающие фрагменты, варианты или производные, раскрытые в данном документе, могут также быть описаны или охарактеризованы с точки зрения их перекрестной реактивности. Как используется в данном документе, термин "перекрестная реактивность" обозначает способность связывающей молекулы, например, антитела или его фрагмента, варианта или производного, специфического в отношении одного антигена, реагировать со вторым антигеном; является показателем родства между двумя различными антигенными веществами. Таким образом, связывающая молекула является перекрестно реактивной, если она связывается с эпитопом, отличным от того, который индуцировал ее образование. Эпитоп, приводящие к перекрестной реакции, как правило, содержит множество таких же комплементарных структурных признаков индуцирующего эпитопа, а в некоторых случаях действительно может лучше соответствовать, чем оригинальный эпитоп.

[0111] Связывающую молекулу, например, антитело или его фрагмент, вариант или производное, можно также описывать или характеризовать с точки зрения аффинности ее связывания с антигеном. Например, связывающая молекула может связываться с антигеном при константе диссоциации или KD, составляющей не более, например, 5×10-2 M, 10-2 M, 5×10-3 M, 10-3 M, 5×10-4 M, 10-4 M, 5×10-5 M, 10-5 M, 5×10-6 M, 10-6 M, 5×10-7 M, 10-7 M, 5×10-8 M, 10-8 M, 5×10-9 M, 10-9 M, 5×10-10 M, 10-10 M, 5×10-11 M, 10-11 M, 5×10-12 M, 10-12 M, 5×10-13 M, 10-13 M, 5×10-14 M, 10-14 M, 5×10-15 M или 10-15 M.

[0112] Фрагменты антител, в том числе одноцепочечные антитела или другие связывающие домены могут существовать отдельно или в комбинации с одним или несколькими из следующего: шарнирной области, CH1-, CH2-, CH3- или CH4-доменов, J-цепи или секреторного компонента. Также охвачены антигенсвязывающие фрагменты, которые могут включать любую комбинацию вариабельной области(ей) с одним или несколькими из шарнирной области, CH1-, CH2-, CH3- или CH4-доменов, J-цепи или секреторного компонента. Связывающие молекулы, например, антитела или их антигенсвязывающие фрагменты, могут происходить из любых животных, в том числе птиц и млекопитающих. Антитела могут быть антителами человека, мыши, осла, кролика, козы, морской свинки, верблюда, ламы, лошади или курицы. Согласно другому варианту осуществления вариабельная область может происходить из хрящевых рыб (например, из акул). Как используется в данном документе, антитела "человека" включают антитела, имеющие аминокислотную последовательность из иммуноглобулина человека, и включают антитела, выделенные из библиотек иммуноглобулинов человека или из животных, трансгенных по одному или нескольким иммуноглобулинам человека, и которые в некоторых случаях могут экспрессировать эндогенные иммуноглобулины, а некоторых случаях не могут, как описано ниже и, например, в патенте США № 5939598 от Kucherlapati et al.

[0113] Как используется в данном документе, термин "субъединица тяжелой цепи" включает аминокислотные последовательности, происходящие из тяжелой цепи иммуноглобулина, при этом связывающая молекула, например, антитело, содержащая субъединицу тяжелой цепи, включает по меньшей мере одно из следующего: VH-домена, CH1-домена, шарнирного (например, верхней, средней и/или нижней области шарнира) домена, CH2-домена, CH3-домена, CH4-домена или их варианта или фрагмента. Например, связывающая молекула, например, антитело или его фрагмент, вариант или производное, может включать, в дополнение к VH-домену, CH1-домен; CH1-домен, шарнир и CH2-домен; CH1-домен и CH3-домен; CH1-домен, шарнир и CH3-домен; или CH1-домен, шарнирный домен, CH2-домен и CH3-домен. Согласно определенным аспектам связывающая молекула, например, антитело или его фрагмент, вариант или производное, может включать в дополнение к VH-домену, CH3-домен и CH4-домен; или CH3-домен, CH4-домен и J-цепь. Кроме того, у связывающей молекулы для применения в настоящем раскрытии могут отсутствовать определенные части константной области, например, весь CH2-домен или его часть. Специалисту в данной области будет понятно, что эти домены (например, субъединица тяжелой цепи) могут быть модифицированы так, что они отличаются аминокислотной последовательностью от исходной молекулы иммуноглобулина.

[0114] Субъединицы тяжелой цепи связывающей молекулы, например, антитела или его связывающего фрагмента, могут включать домены, происходящие из молекул различных иммуноглобулинов. Например, субъединица тяжелой цепи полипептида может включать CH1-домен, происходящий из IgG1-молекулы, и шарнирную область, происходящую из IgG3-молекулы. Согласно другому примеру субъединица тяжелой цепи может включать шарнирную область, происходящую частично из IgG1-молекулы и частично из IgG3-молекулы. В другом примере субъединица тяжелой цепи может содержать химерный шарнир, происходящий частично из IgG1-молекулы и частично из IgG4-молекулы.

[0115] Как используется в данном документе, термин "субъединица легкой цепи" включает аминокислотные последовательности, происходящие из легкой цепи иммуноглобулина. Субъединица легкой цепи включает по меньшей мере один из VL- или CL- (например, Cκ или Cλ) доменов.

[0116] Связывающие молекулы, например, антитела или их антигенсвязывающие фрагменты, варианты или производные, могут быть описаны или охарактеризованы с точки зрения эпитопа(ов) или части(ей) антигена, которые они распознают или с которыми специфически связываются. Участок целевого антигена, который специфически взаимодействует с антигенсвязывающим доменом антитела, представляет собой "эпитоп", или "антигенную детерминанту". Целевой антиген может содержать один эпитоп или по меньшей мере два эпитопа, и может включать любое число эпитопов, в зависимости от размера, конформации и типа антигена.

[0117] Как указано ранее, структуры субъединиц и трехмерная конфигурация константных областей различных классов иммуноглобулинов хорошо известны. Как используется в данном документе, термин "VH-домен" включает амино-концевой вариабельный домен тяжелой цепи иммуноглобулина, а термин "CH1-домен" включает первый (наиболее близкий к амино-концу) домен константной области тяжелой цепи иммуноглобулина. CH1-домен примыкает к VH-домену и является амино-концевым по отношению к шарнирной области молекулы тяжелой цепи типичного иммуноглобулина.

[0118] Как используется в данном документе, термин "CH2-домен" включает часть молекулы тяжелой цепи, которая продолжается, например, от приблизительно аминокислоты 244 до аминокислоты 360 IgG-антитела при использовании стандартных схем нумерации (аминокислоты 244-360, система нумерации по Kabat; и аминокислоты 231-340, EU-система нумерации; см. Kabat EA et al. в цитируемой работе). CH3-домен продолжается от CH2-домена до C-конца молекулы IgG и содержит примерно 108 аминокислот. Определенные классы иммуноглобулинов, например, IgM, дополнительно включают CH4-область.

[0119] Как используется в данном документе, термин "шарнирная область" включает часть молекулы тяжелой цепи, которая соединяет CH1-домен с CH2-доменом. Эта шарнирная область содержит примерно 25 аминокислот и является гибкой, что, таким образом, позволяет двум N-концевым антигенсвязывающим областям двигаться независимо.

[0120] Как используется в данном документе, термин "дисульфидная связь" включает ковалентную связь, образованную между двумя атомами серы. Аминокислота цистеин содержит тиольную группу, которая может образовывать дисульфидную связь или мостик со второй тиольной группой. В определенных молекулах IgG CH1- и CL-области связаны с помощью дисульфидной связи, а две тяжелые цепи связаны с помощью двух дисульфидных связей в положениях, соответствующих 239 и 242 согласно системе нумерации по Kabat (положение 226 или 229, EU-система нумерации). Согласно определенным аспектам, предусмотренным в данном документе, Fc-домен IgG4 человека, можно подвергнуть мутации в шарнирной области, чтобы обеспечить образование дисульфидной связи между двумя шарнирными областями, в частности, мутацию замены серина на пролин в положении 228 (по EU-нумерация). Fc-домены IgG4 человека, содержащие мутацию S228P, называются в данном документе "Fc-домены IgG4P".

[0121] Как используется в данном документе, "Fc-TM область" представляет собой Fc-область IgG человека, которая содержит аминокислотные замены L234F, L235E и P331S, пронумерованные согласно EU-индексу, изложенному в Kabat, и она характеризуется ослабленной или подавленной эффекторной (ADCC и/или CDC) функцией, ослабленным или подавленным связыванием с Fc-рецепторами и/или ослабленной или подавленной токсичностью. См., например, публикацию заявки на патент США № 2011/0059078, которая включена в данный документ посредством ссылки во всей своей полноте.

[0122] Как используется в данном документе, термин "химерное антитело" относится к антителу, в котором иммунореактивная область или участок получен или происходит от первого вида, а константная область (которая может быть интактной, неполной или модифицированной) получена от второго вида. Согласно некоторым вариантам осуществления целевая связывающая область или участок будет происходить от источника, не являющегося человеком (например, из мыши или примата), а константная область является человеческой.

[0123] Выражения "мультиспецифическое антитело" или "биспецифическое антитело" относится к антителу, которое имеет связывающие домены для двух или более различных эпитопов в пределах одной молекулы антитела. Можно разработать другие связывающие молекулы с двумя специфичностями связывания, в дополнение к канонической структуре антитела. Связывание эпитопов с помощью биспецифических или мультиспецифических антител может быть одновременным или последовательным. Триомы и межвидовые гибридомы представляют собой два примера линий клеток, которые могут секретировать биспецифические антитела. Биспецифические антитела также могут быть разработаны с помощью способов рекомбинации. (Ströhlein and Heiss, Future Oncol. 6:1387-94 (2010); Mabry and Snavely, IDrugs. 13:543-9 (2010)). Биспецифическое антитело также может представлять собой диатело.

[0124] Как используется в данном документе, термин "сконструированное антитело" относится к антителу, в котором вариабельный домен в одной из тяжелой и легкой цепи или в обеих был изменен посредством по меньшей мере частичной замены одной или нескольких аминокислот либо в CDR, либо в каркасных областях. Согласно определенным аспектам полный набор CDR из антитела с известной специфичностью можно привить в каркасные области гетерологичного антитела. Хотя альтернативные CDR могут происходить из антитела одного класса или даже подкласса, что и антитело, из которого происходят каркасные области, CDR также могут происходить из антитела другого класса, например, из антитела от другого вида. Сконструированное антитело, в котором одну или несколько "донорных" CDR из антитела, не являющегося антителом человека, с известной специфичностью прививают в каркасную область тяжелой или легкой цепи человека, называют в данном документе "гуманизированным антителом". Согласно определенным аспектам не все CDR замещают полным комплектом CDR из вариабельной области донора, и при этом антигенсвязывающая способность донора все еще может быть перенесена в вариабельные домены реципиента. С учетом пояснений, изложенных, например, в патентах США №№ 5585089, 5693761, 5693762 и 6180370, получение функционального сконструированного или гуманизированного антитела либо путем проведения стандартных экспериментов, либо путем тестирования методом проб и ошибок будет находиться вполне в пределах компетенции специалистов в данной области.

[0125] Как используется в данном документе, термин "сконструированный" включает манипуляцию с молекулами нуклеиновых кислот и полипептидов посредством способов синтеза (например, с помощью рекомбинантных методик, in vitro синтеза пептидов, с помощью ферментативного или химического сочетания пептидов или некоторых комбинаций этих методик).

[0126] Как используется в данном документе, термины "связанный", "слитый" или "слияние" или другие грамматические эквиваленты могут использоваться взаимозаменяемо. Эти термины относятся к соединению вместе двух или более элементов или компонентов с помощью любых способов, включая способы химической коньюгации или рекомбинации. "Слияние в рамке считывания" относится к соединению двух или более полинуклеотидных открытых рамок считывания (ORF) с образованием непрерывной более длинной ORF так, что сохраняется трансляционная рамка считывания исходных ORF. Таким образом, рекомбинантный белок слияния представляет собой единый белок, содержащий два или более сегментов, которые соответствуют полипептидам, кодируемым исходными ORF (такие сегменты обычно не соединены подобным образом в природе). Несмотря на то, что полученная таким образом рамка считывания является непрерывной на всем протяжении слитых сегментов, сегменты могут быть физически или пространственно разделены с помощью, например, внутрирамочной линкерной последовательности. Например, полинуклеотиды, кодирующие CDR вариабельной области иммуноглобулина, могут быть слитыми внутри рамки, но разделены полинуклеотидом, кодирующим по меньшей мере одну каркасную область иммуноглобулина или дополнительные области CDR, при условии, что "слитые" CDR транслируются совместно в виде части непрерывного полипептида.

[0127] В контексте полипептидов "линейная последовательность" или "последовательность" представляет собой порядок аминокислот в полипептиде в направлении от амино-конца к карбокси-концу, при котором аминокислоты, расположенные рядом друг с другом в последовательности, являются смежными в первичной структуре полипептида. Часть полипептида, которая является "амино-концевой" или "N-концевой" относительно другой части полипептида, представляет собой такую часть, которая находится раньше в последовательной полипептидной цепи. Часть полипептида, которая является "карбокси-концевой" или "C-концевой" относительно другой части полипептида, представляет собой такой участок, который находится позже в последовательной полипептидной цепи. Например, в типичном антителе вариабельный домен является "N-концевым" относительно константной области, а константная область является "C-концевой" относительно вариабельного домена.

[0128] Термин "экспрессия", как используется в данном документе, относится к процессу, с помощью которого из гена образуется биохимическое вещество, например, полипептид. Процесс предусматривает любое проявление функционального присутствия гена в клетке, включая без ограничений нокдаун гена, а также как транзиентную экспрессию, так и стабильную экспрессию. Он включает без ограничений транскрипцию гена в матричную РНК (mRNA) и трансляцию такой mRNA в полипептид(ы). Если конечный требуемый продукт представляет собой биохимическое вещество, то экспрессия включает образование такого биохимического вещества и любых предшественников. Экспрессия гена приводит к образованию "продукта гена". Как используется в данном документе, продуктом гена может быть либо нуклеиновая кислота, например, матричная РНК, образуемая при транскрипции гена, либо полипептид, который транслируется из транскрипта. Продукты генов, описанные в данном документе, дополнительно включают нуклеиновые кислоты с посттранскрипционными модификациями, например, полиаденилированием, или полипептиды с посттрансляционными модификациями, например, метилированием, гликозилированием, добавлением липидов, ассоциацией с другими белковыми субъединицами, протеолитическим расщеплением и т. п.

[0129] Термины, такие как "осуществление лечения", или "лечение", или "лечить", или "облегчение", или "облегчать" относятся к терапевтическим мероприятиям, таким как излечение, замедление развития, ослабление симптомов и/или приостановка или замедление прогрессирования существующего диагностированного патологического состояния или нарушения. Термины, такие как "предупреждать", "предупреждение", "избегать", "сдерживание" и т. п. относятся к профилактическим или превентивным мероприятиям, которые предупреждают развитие недиагностированного целевого патологического состояния или нарушения. Таким образом, к "нуждающимся в лечении" могут относиться те, кто уже имеет нарушение; те, кто предрасположен к нарушению; и те, у кого нарушение следует предупредить.

[0130] OX40, или "рецептор OX40" представляет собой белок (также имеющий другие названия - CD134, представитель 4 суперсемейства рецепторов фактора некроза опухоли и ACT-35), экспрессируемый на поверхности активированных T-клеток, например, CD4+ и CD8+ T-клеток, а также на Foxp3+CD4+ регуляторных T-клетках (Treg). Наивные CD4+ и CD8+ T-клетки не экспрессируют OX40 (Croft, M., (2010) Ann Rev Immunol 28:57-78).

[0131] "Лиганд OX40" ("OX40L") (также имеющий другие названия - представитель 4 суперсемейства лигандов фактора некроза опухоли, gp34, TAX транскрипционно активируемый гликопротеин 1 и CD252) встречается главным образом на антигенпрезентирующих клетках (APC) и может быть индуцирован на активированных B-клетках, дендритных клетках (DC), клетках Лангерганса, плазмацитоидных DC и макрофагах (там же). Другие клетки, в том числе активированные T-клетки, NK-клетки, тучные клетки, эндотелиальные клетки и гладкомышечные клетки, могут экспрессировать OX40L в ответ на воспалительные цитокины (там же). OX40L специфически связывается с рецептором OX40. Белок человека описан в публикации согласно PCT № WO 95/21915. OX40L мыши описан в патенте США № 5457035. OX40L экспрессируется на поверхности клеток и содержит внутриклеточный, трансмембранный и внеклеточный рецептор-связывающий домен. Функционально активная растворимая форма OX40L может быть получена путем удаления внутриклеточного и трансмембранного доменов, как описано, например, в патентах США №№ 5457035 и 6312700 и WO 95/21915, раскрытия которых включены в данный документ во всех отношениях. Функционально активной формой OX40L является форма, которая сохраняет способность специфично связываться с OX40, иными словами, которая обладает "рецептор-связывающим доменом" для OX40. Способы определения способности молекулы или производного OX40L специфично связываться с OX40 обсуждаются ниже. Способы получения и применения OX40L и его производных (таких как производные, содержащие OX40-связывающий домен) описаны в WO 95/21915, где также описываются белки, содержащие растворимую форму OX40L, соединенные с другими пептидами, такими как Fc-области иммуноглобулинов ("Ig") человека, которые можно получать для облегчения очистки лиганда OX40 из культивируемых клеток или для повышения стабильности молекулы после in vivo введения млекопитающему (см. также патент США № 5457035 и публикацию согласно PCT № WO 2006/121810, обе из которых включены в данные документ посредством ссылки во всей своей полноте).

[0132] Под "субъектом", или "индивидом", или "животным", или "пациентом", или "млекопитающим" подразумевается любой субъект, в частности, субъект-млекопитающее, которому необходим провести диагностику, прогнозирование или терапию. Субъекты-млекопитающие включают людей, домашних животных, сельскохозяйственных животных, а также животных зоопарков, животных, используемых в спорте, или домашних животных, таких как собаки, кошки, морские свинки, кролики, крысы, мыши, лошади, свинья, коровы, медведи и т. д.

[0133] Как используется в данном документе, фразы, такие как "субъект, который получит пользу от терапии" и "животное, нуждающееся в лечении", включают субъектов, таких как субъекты-млекопитающие, которые получат пользу от введения гуманизированного антитела к OX40. Такие антитела можно применять, например, для процедур диагностики и/или для лечения или предупреждения заболевания, например, злокачественного новообразования.

ГУМАНИЗИРОВАННЫЕ АНТИТЕЛА К OX40 И ИХ АНТИГЕНСВЯЗЫВАЮЩИЕ ФРАГМЕНТЫ

[0134] Настоящее раскрытие относится к антителам, например, гуманизированным антителам, которые специфически связываются с OX40. Согласно определенным аспектам антитело или его фрагмент, предусматриваемые в данном документе, могут быть выделенными. Согласно определенным аспектам антитело или его фрагмент, предусматриваемые в данном документе, могут быть фактически чистыми. Согласно определенным аспектам антитело или его фрагмент, предусматриваемые в данном документе, могут не встречаться в природе.

[0135] Согласно определенным аспектам в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие VH и VL из OX40mAb5, OX40mAb8, OX40mAb10, OX40mAb11, OX40mAb12, OX40mAb13, OX40mAb14, OX40mAb15, OX40mAb16, OX40mAb17, OX40mAb18, OX40mAb19, OX40mAb20, OX40mAb21, OX40mAb22, OX40mAb23, OX40mAb24, OX40mAb25, OX40mAb25a, OX40mAb26, OX40mAb27, OX40mAb28, OX40mAb29, OX40mAb30, OX40mAb31, OX40mAb32 или OX40mAb37. Согласно определенным аспектам в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие тяжелую цепь и легкую цепь из OX40mAb5, OX40mAb8, OX40mAb10, OX40mAb11, OX40mAb12, OX40mAb13, OX40mAb14, OX40mAb15, OX40mAb16, OX40mAb17, OX40mAb18, OX40mAb19, OX40mAb20, OX40mAb21, OX40mAb22, OX40mAb23, OX40mAb24, OX40mAb25, OX40mAb25a, OX40mAb26, OX40mAb27, OX40mAb28, OX40mAb29, OX40mAb30, OX40mAb31 или OX40mAb32.

[0136] Согласно определенным аспектам в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие VH антитела и VL антитела, где VL содержит аминокислотную последовательность, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной аминокислотной последовательности под SEQ ID NO: 29 или SEQ ID NO: 32.

[0137] Согласно определенным аспектам в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие VH антитела и VL антитела, где VL содержит SEQ ID NO: 29 или SEQ ID NO: 32.

[0138] В настоящем раскрытии дополнительно предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие VH антитела и VL антитела, где VH содержит аминокислотные последовательности VH-CDR1, VH-CDR2 и VH-CDR3, которые идентичны или идентичны за исключением замен, делеций или вставок восьми, семи, шести, пяти, четырех, трех, двух или одной аминокислоты в одной или нескольких VH-CDR: аминокислотной последовательности VHCDR1 под SEQ ID NO: 8, аминокислотной последовательности VHCDR2 под SEQ ID NO: 14, SEQ ID NO: 15 или SEQ ID NO: 16 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 25, SEQ ID NO: 26 или SEQ ID NO: 27.

[0139] В настоящем раскрытии дополнительно предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие VH антитела и VL антитела, где VH содержит аминокислотную последовательность формулы:

HFW1-HCDR1-HFW2-HCDR2-HFW3-HCDR3-HFW4,

где HFW1 представляет собой SEQ ID NO: 6 или SEQ ID NO: 7, HCDR1 представляет собой SEQ ID NO: 8, HFW2 представляет собой SEQ ID NO: 9, HCDR2 представляет собой SEQ ID NO: 14, SEQ ID NO: 15 или SEQ ID NO: 16, HFW3 представляет собой SEQ ID NO: 17, HCDR3 представляет собой SEQ ID NO: 25, SEQ ID NO: 26 или SEQ ID NO: 27, а HFW4 представляет собой SEQ ID NO: 28. Согласно определенным аспектам аминокислотная последовательность HFW2 представляет собой SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 или SEQ ID NO: 13. Согласно определенным аспектам аминокислотная последовательность HFW3 представляет собой SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 или SEQ ID NO: 24.

[0140] Кроме того, в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие VH антитела и VL антитела, где VL содержит аминокислотную последовательность, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной аминокислотной последовательности под SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 65 или SEQ ID NO: 67.

[0141] Согласно одному аспекту в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие VH антитела и VL антитела, где VL содержит аминокислотную последовательность под SEQ ID NO: 29, а VH содержит аминокислотную последовательность под SEQ ID NO: 59.

[0142] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут включать, в дополнение к VH и VL, константную область тяжелой цепи или ее фрагмент. Согласно определенным аспектам константная область тяжелой цепи представляет собой константную область тяжелой цепи человека, например, константную область IgG человека, например, константную область IgG1 человека или константную область IgG4 человека. Как описано в других частях данного документа, согласно определенным аспектам константная область тяжелой цепи или ее фрагмент, например, константная область IgG человека или его фрагмента, может включать одну или несколько аминокислотных замен по сравнению с константной областью IgG дикого типа, при этом модифицированный IgG характеризуется одним или несколькими требуемыми свойствами по сравнению с константной областью IgG дикого типа. Например, константной областью IgG человека может быть константная область IgG4P или константная область IgG1-TM, как описано в других частях данного документа.

[0143] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут включать, в дополнение к VH и VL, и необязательно константную область тяжелой цепи или ее фрагмент, константную область легкой цепи или ее фрагмент. Согласно определенным аспектам константная область легкой цепи представляет собой константную область легкой каппа- или лямбда-цепи, например, константную область каппа-цепи человека или константную область лямбда-цепи человека. Согласно конкретному аспекту константная область легкой цепи представляет собой константную область каппа-цепи человека.

[0144] Согласно определенным аспектам в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, содержащие тяжелую цепь антитела или его фрагмент и легкую цепь антитела или его фрагмент, где тяжелая цепь содержит аминокислотную последовательность под SEQ ID NO: 71, а легкая цепь содержит аминокислотную последовательность под SEQ ID NO: 30.

[0145] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут быть, например, моноклональными, поликлональными, рекомбинантными, мультиспецифическими или любой их комбинацией. Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент могут представлять собой, например, Fv-фрагмент, Fab-фрагмент, F(ab')2-фрагмент, Fab'-фрагмент, dsFv-фрагмент, scFv-фрагмент, sc(Fv)2-фрагмент, Fd-фрагмент, связанный дисульфидной связью Fv-фрагмент, V-NAR-домен, IgNar, интратело, IgGΔCH2, минитело, F(ab')3-фрагмент, тетратело, триатело, диатело, однодоменное антитело, DVD-Ig, Fcab-фрагмент, mAb2-фрагмент, (scFv)2-фрагмент или scFv-Fc-фрагмент.

[0146] Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут специфически связываться с OX40 человека, макака-крабоеда или макака-резуса. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут специфически связываться с поверхностью первичных CD4 T-клеток человека, макака-крабоеда или макака-резуса или клеток Jurkat. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут специфически связываться с OX40, экспрессируемым на активированных CD4+ или CD8+ T-клетках от человека, макака-крабоеда, макака-резуса или любой их комбинации. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут специфически связываться с OX40, экспрессируемым на первичных активированных CD4+ T-клетках от человека, макака-крабоеда, макака-резуса или любой их комбинации. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, не связываются с OX40 мыши или крысы. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, не вступают в перекрестную реакцию с родственными белками TNFRSF, например, белками TNFRSF, приведенными в таблице 3-1 в примере 3 ниже.

[0147] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут содержать одно или несколько консервативных аминокислотных изменений, например, до десяти консервативных изменений (например, две замещенные аминокислоты, три замещенные аминокислоты, четыре замещенные аминокислоты или пять замещенных аминокислот и т. д.), при условии, что эти изменения могут быть выполнены в полипептиде без изменения биохимической функции гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, например, специфического связывания с OX40, вызывая тем самым передачу сигнала. Например, одно или несколько консервативных изменений могут быть выполнены в рецептор-связывающем домене антитела, предусматриваемого в данном документе, без блокирования его способности связываться с OX40.

[0148] Кроме того, часть полипептидного домена может быть удалена без нарушения или устранения всех из его функций. Аналогично, в полипептидной цепи могут быть выполнены вставки и добавления, например, путем добавления эпитопных меток, без нарушения или устранения его функций, как описано ниже. Другие модификации, которые могут быть выполнены без существенного нарушения одной или нескольких функций полипептида, включают, например, in vivo или in vitro химические или биохимические модификации, при которых включаются нестандартные аминокислоты. Такие модификации включают, например, ацетилирование, карбоксилирование, фосфорилирование, гликозилирование, мечение, например, радионуклидами, и различные ферментативные модификации, как будет без труда понятно специалистам в данной области. Из уровня техники хорошо известны различные способы мечения полипептидов, а также метки, пригодные для таких целей, и они включают радиоактивные изотопы, такие как 32P, флуорофоры, хемилюминесцентные средства, ферменты и антитела к лигандам.

[0149] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут дополнительно включать гетерологичное средство, например, стабилизирующее средство, модификатор иммунного ответа или детектируемое средство. В определенных аспектах гетерологичное средство содержит одну или несколько дополнительных полипептидных последовательностей, слитых с полипептидной субъединицей посредством пептидной связи, как, например, сигнальную последовательность (например, секреторную сигнальную последовательность), линкерную последовательность, аминокислотный маркер или метку или пептидную или полипептидную последовательность, которые облегчают очистку. Согласно определенным аспектам гетерологичный полипептид может быть слит с N-концом или C-концом субъединицы либо тяжелой цепи антитела, либо легкой цепи антитела, или ее фрагментом, при условии, что функциональные характеристики доменов сохранены.

[0150] Согласно определенным аспектам гетерологичное средство может быть химически конъюгировано с гуманизированным антителом к OX40 или его антигенсвязывающим фрагментом, предусматриваемыми в данном документе. Иллюстративные гетерологичные средства, которые могут быть химически конъюгированы с полипептидной субъединицей, включают без ограничений линкеры, лекарственные средства, токсины, визуализирующие средства, радиоактивные соединения, органические и неорганические полимеры и любые другие композиции, которые могут обеспечивать требуемую активность, которая не обеспечивается полипептидной субъединицей самой по себе. Специфические средства включают без ограничений полиэтиленгликоль (PEG), цитотоксическое средство, радионуклид, визуализирующее средство, биотин.

[0151] Согласно определенным аспектам в настоящем раскрытии предусмотрены определенные антитела к OX40 для применения в качестве контролей или инструментов для исследования. Например, в настоящем раскрытии предусмотрено гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, как описано выше, в которых VH и VL слиты с тяжелой цепью IgG1 мыши и легкой каппа-цепью мыши соответственно. Эта "обратная химера" пригодна для in vivo определения характеристик у макак-резусов. В другом примере VH-область в гуманизированном антителе к OX40, предусматриваемом в данном документе, может быть присоединена к различным константным областям тяжелой цепи с измененными эффекторными функциями, например, IgG4P человека или IgG1TM человека, описанным в других частях данного документа.

[0152] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут специфически связываться с OX40, экспрессируемым на первичных активированных T-клетках, например, первичных активированных CD4+ T-клетках, первичных активированных CD8+ T-клетках и/или регуляторных T-клетках от человека, макака-крабоеда, макака-резуса или любой их комбинации. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, например, OX40mAb24, может связываться с OX40, экспрессируемым на первичных активированных CD4+ T-клетках человека, с аффинностью связывания от приблизительно 0,01 пМ до приблизительно 1 нМ, например, от приблизительно 1 пМ до приблизительно 500 пМ, например, от приблизительно 100 пМ до приблизительно 400 пМ, например, от приблизительно 250 пМ до приблизительно 370 пМ, во всех случаях согласно измерению с помощью проточной цитометрии. Например, гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент могут связываться с OX40 человека, экспрессируемым на первичных активированных CD4+ T-клетках человека, с аффинностью связывания приблизительно 0,1 пМ, приблизительно 0,5 пМ, приблизительно 1 пМ, приблизительно 10 пМ, приблизительно 50 пМ, приблизительно 100 пМ, приблизительно 150 пМ, приблизительно 200 пМ, приблизительно 250 пМ, приблизительно 275 пМ, приблизительно 300 пМ, приблизительно 325 пМ, приблизительно 350 пМ, приблизительно 370 пМ, приблизительно 400 пМ, приблизительно 425 пМ, приблизительно 450 пМ, приблизительно 475 пМ, приблизительно 500 пМ, приблизительно 550 пМ, приблизительно 600 пМ, приблизительно 650 пМ, приблизительно 700 пМ, приблизительно 750 пМ или приблизительно 1 нМ, во всех случаях согласно измерению с помощью проточной цитометрии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут связываться с OX40 человека, экспрессируемым на первичных активированных CD4+ T-клетках человека, с аффинностью связывания, составляющей приблизительно 312 пМ. Аффинность связывания может быть измерена с помощью ряда различных способов и/или приборов, и значения относительной аффинности связывания могут варьировать в зависимости от способа или устройства, как будет хорошо понятно средним специалистам в данной области.

[0153] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут занимать или приводить к перекрестному сшиванию некоторых или всех молекул OX40 на поверхности клетки, например, первичной активированной CD4+ T-клетки человека. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут связываться с OX40 человека, экспрессируемым на первичных активированных CD4+ T-клетках человека, и могут обеспечивать 20% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC20) при концентрации от приблизительно 0,01 пМ до приблизительно 1 нМ, например, от приблизительно 0,1 пМ до приблизительно 500 пМ, например, от приблизительно 1 пМ до приблизительно 200 пМ, например, от приблизительно 10 пМ до приблизительно 100 пМ, например, от приблизительно 50 пМ до приблизительно 100 пМ, например, от приблизительно 63 пМ до приблизительно 93 пМ, например, приблизительно 1 пМ, приблизительно 10 пМ, приблизительно 20 пМ, приблизительно 30 пМ, приблизительно 40 пМ, приблизительно 50 пМ, приблизительно 60 пМ, приблизительно 70 пМ, приблизительно 78 пМ, приблизительно 80 пМ, приблизительно 90 пМ, приблизительно 100 пМ или приблизительно 150 пМ, во всех случаях согласно измерению c помощью проточной цитометрии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут обеспечивать 20% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC20) при концентрации приблизительно 78 пМ согласно измерению с помощью проточной цитометрии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут связываться с OX40 человека, экспрессируемым на первичных активированных CD4+ T-клетках человека, и могут обеспечивать 50% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC50) при концентрации от приблизительно 0,01 пМ до приблизительно 1 нМ, например, от приблизительно 1 пМ до приблизительно 500 пМ, например, от приблизительно 100 пМ до приблизительно 400 пМ, например, от приблизительно 250 пМ до приблизительно 370 пМ, например, приблизительно 100 пМ, приблизительно 150 пМ, приблизительно 200 пМ, приблизительно 250 пМ, приблизительно 275 пМ, приблизительно 300 пМ, приблизительно 325 пМ, приблизительно 350 пМ, приблизительно 370 пМ, приблизительно 400 пМ, приблизительно 425 пМ, приблизительно 450 пМ, приблизительно 475 пМ или приблизительно 500 пМ, во всех случаях согласно измерению с помощью проточной цитометрии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут обеспечивать 50% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC50) при концентрации приблизительно 312 пМ согласно измерению с помощью проточной цитометрии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент могут связываться с OX40 человека, экспрессируемым на первичных активированных CD4+ T-клетках человека, и могут обеспечивать 90% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC90) при концентрации от приблизительно 100 пМ до приблизительно 100 нМ, например, от приблизительно 500 пМ до приблизительно 10 нМ, например, от приблизительно 1 нМ до приблизительно 500 нМ, например, от приблизительно 2 нМ до приблизительно 4 нМ, например, приблизительно 1 нМ, приблизительно 2 нМ, приблизительно 3 нМ, приблизительно 4 нМ или приблизительно 5 нМ, согласно измерению с помощью проточной цитометрии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут обеспечивать 90% занятость рецепторов на первичных активированных CD4+ T-клетках человека (EC90) при концентрации от приблизительно 2290 пМ до приблизительно 3330 пМ, например, приблизительно 2810 пМ, согласно измерению с помощью проточной цитометрии.

[0154] Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут связываться с OX40 человека, экспрессируемым на сверхэкспрессирующих OX40 клетках Jurkat, с аффинностью связывания от приблизительно 250 пМ до приблизительно 600 пМ, например, приблизительно 424 пМ, согласно измерению с помощью проточной цитометрии.

[0155] Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент могут связываться с OX40 человека, экспрессируемым на сверхэкспрессирующих OX40 клетках Jurkat, и могут обеспечивать EC20 при концентрации от приблизительно 60 до приблизительно 150 пМ, EC50 при концентрации от приблизительно 250 до приблизительно 600 пМ и EC90 при концентрации от приблизительно 2260 до приблизительно 4390 пМ согласно измерению с помощью проточной цитометрии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут связываться с OX40 человека, экспрессируемым на сверхэкспрессирующих OX40 клетках Jurkat, и могут обеспечивать EC20 при концентрации приблизительно 106 пМ, EC50 при концентрации приблизительно 424 пМ, и EC90 при концентрации приблизительно 3820 пМ согласно измерению с помощью проточной цитометрии.

[0156] Согласно другому примеру гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут связываться с OX40 макака-крабоеда, экспрессируемым на первичных активированных CD4+ T-клетках макака-крабоеда, с аффинностью связывания от приблизительно 340 пМ до приблизительно 820 пМ, например, приблизительно 580 пМ, согласно измерению с помощью проточной цитометрии. Согласно другому примеру гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут связываться с OX40 макака-резуса, экспрессируемым на первичных активированных CD4+ T-клетках макака-резуса, с аффинностью связывания от приблизительно 130 пМ до приблизительно 600 пМ, например, приблизительно 370 пМ, согласно измерению с помощью проточной цитометрии.

[0157] Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут индуцировать дозозависимую пролиферацию активированных CD4+ T-клеток в анализе с применением планшета. Например, в in vitro анализе гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, предусматриваемые в данном документе, например, OX40mAb24, 20% максимального пролиферативного ответа (EC20) первичных активированных CD4+ T-клеток человека может обеспечиваться при концентрации антитела от приблизительно 14 пМ до приблизительно 28 пМ, например, приблизительно 21 пМ, 50% максимального пролиферативного ответа (EC50) первичных активированных CD4+ T-клеток человека может обеспечиваться при концентрации антитела от приблизительно 0,3 пМ до приблизительно 130 пМ, например, приблизительно 28 пМ, и 90% максимального пролиферативного ответа (EC90) первичных активированных CD4+ T-клетках человека может обеспечиваться при концентрации антитела от приблизительно 50 пМ до приблизительно 90 пМ, например, приблизительно 72 пМ, во всех случаях согласно измерению с помощью проточной цитометрии.

[0158] Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут индуцировать дозозависимое высвобождение цитокинов из активированных CD4+ T-клеток, например, первичных активированных CD4+ T-клеток человека. Согласно определенным аспектам высвобождаемым цитокином является IFNγ, TNFα, IL-5, IL-10, IL-2, IL-4, IL-13, IL-8, IL-12 p70, IL-1β или любая их комбинация. Согласно определенным аспектам цитокин представляет собой IFNγ, TNFα, IL-5, IL-10, IL-13 или любую их комбинацию. Аналогично, гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут обеспечивать пролиферацию CD4+ T-клеток и высвобождение цитокинов первичными активированными CD4+ T-клетками макака-крабоеда и первичными активированными CD4+ T-клетками макака-резуса.

[0159] Согласно дополнительным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут активировать путь NFκB в экспрессирующих OX40 Т-клетках в присутствии экспрессирующих FcγR клеток. Например, гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут активировать путь NFκB в экспрессирующих OX40 клетках Jurkat с NFκB-люциферазным репортером, которые вырабатывают люциферазу в ответ на стимуляцию сигнального пути NFκB. В качестве альтернативы гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут активировать путь NFκB в клетках, экспрессирующих OX40 человека, OX40 макака-крабоеда или OX40 макака-резуса.

[0160] Согласно еще одному аспекту гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут облегчать лечение злокачественного новообразования, например, путем замедления роста опухоли, остановки роста опухоли или уменьшения размера существующих опухолей, при введении в виде эффективной дозы субъекту, нуждающемуся в лечении злокачественного новообразования. Согласно определенным аспектам облегчение лечения злокачественного новообразования может обеспечиваться в присутствии T-клеток. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, при введении в виде эффективной дозы субъекту, нуждающемуся в лечении, может снижать рост опухоли по меньшей мере на 10%, по меньшей мере на 20%, по меньшей мере на 30%, по меньшей мере на 40% и по меньшей мере на 50%, по меньшей мере на 60% или по меньшей мере на 70% по сравнению с введением изотипически сходного контрольного антитела.

[0161] Согласно еще одним дополнительным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут индуцировать пролиферацию активированных экспрессирующих OX40 Т-клеток посредством связывания с OX40 и в то же самое время вызывать комплементзависимую или антителозависимую клеточную цитотоксичность в отношении экспрессирующих OX40 Т-клеток, например, активированных CD4+ T-клеток, активированных CD8+ T-клеток и/или регуляторных T-клеток. Более того, согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут индуцировать пролиферацию экспрессирующих OX40 Т-клеток, например, экспрессирующих OX40 активированных CD4+, CD8+ T-клеток и/или регуляторных T-клеток, посредством связывания с OX40 и в то же самое время связываться с C1q или вызывать опосредованную NK-клетками антителозависимую клеточную цитотоксичность в отношении экспрессирующих OX40 Т-клеток, например, активированных CD4+ T-клеток, активированных CD8+ T-клеток и/или регуляторных T-клеток.

[0162] Согласно определенным аспектам в настоящем раскрытии предусмотрено антитело к OX40 или его фрагмент, содержащие гуманизированную VH, присоединенную к константой области тяжелой цепи мыши, и гуманизированную VL, присоединенную к константной области легкой цепи мыши, при этом тяжелая цепь содержит SEQ ID NO: 81, а легкая цепь содержит SEQ ID NO: 83. Согласно определенным аспектам константная область тяжелой цепи может представлять собой, например, константную область IgG1 мыши. Согласно определенным аспектам константная область легкой цепи может представлять собой, например, константную область каппа-цепи мыши.

[0163] Согласно определенным аспектам в настоящем раскрытии предусмотрено антитело крысы к OX40 мыши или его антигенсвязывающий фрагмент, содержащие VH крысы и VL крысы, при этом VH содержит аминокислотную последовательность под SEQ ID NO: 85, а VL содержит аминокислотную последовательность под SEQ ID NO: 88. Согласно определенным аспектам данное антитело или его фрагмент дополнительно содержат константную область легкой цепи или ее фрагмент, слитые с C-концом VL. Константная область легкой цепи может представлять собой, например, константную область каппа-цепи мыши. Согласно определенным аспектам данное антитело или его фрагмент дополнительно содержат константную область тяжелой цепи или ее фрагмент, слитый с C-концом VH. Константная область тяжелой цепи может представлять собой, например, константную область IgG2a мыши. Согласно определенным аспектам данное антитело крысы к OX40 мыши содержит аминокислотную последовательность тяжелой цепи под SEQ ID NO: 86 и аминокислотную последовательность легкой цепи под SEQ ID NO: 89. Согласно определенным аспектам антитело крысы к OX40 мыши или его фрагмент, предусматриваемые в данном документе, могут специфически связываться с OX40 мыши. Согласно определенным аспектам введение мыши эффективной дозы антитела крысы к OX40 мыши или его фрагмента, предусматриваемых в данном документе, может подавлять рост линий клеток мышиного рака у мыши.

[0164] Согласно определенным аспектам фрагмент антитела крысы к OX40 мыши, предусматриваемых в данном документе, может представлять собой, например, Fv-фрагмент, Fab-фрагмент, F(ab')2-фрагмент, Fab'-фрагмент, dsFv-фрагмент, scFv-фрагмент или sc(Fv)2-фрагмент или любую их комбинацию.

ПОЛИНУКЛЕОТИДЫ, КОДИРУЮЩИЕ ГУМАНИЗИРОВАННЫЕ АНТИТЕЛА К OX40, ФРАГМЕНТЫ ИЛИ СУБЪЕДИНИЦЫ

[0165] В настоящем раскрытие предусмотрены полинуклеотиды, содержащие последовательности нуклеиновых кислот, которые кодируют гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент. Например, в настоящем раскрытии предусмотрен полинуклеотид или два или более полинуклеотидов, содержащие последовательность нуклеиновой кислоты, которая кодирует гуманизированное антитело к OX40 или субъединицу гуманизированного антитела к OX40, или кодирует антигенсвязывающий фрагмент такого антитела. Полинуклеотиды по настоящему раскрытию могут находиться в форме РНК или в форме ДНК. ДНК включает cDNA, геномную ДНК, например, модифицированную геномную ДНК, и синтетическую ДНК; и может быть двухнитевой или однонитевой, и при этом, если она является однонитевой, то она может представлять собой кодирующую нить или некодирующую (антисмысловую) нить.

[0166] Согласно определенным аспектам полинуклеотид может быть выделенным. Согласно определенным аспектам полинуклеотид может быть фактически чистым. Согласно определенным аспектам полинуклеотид может не встречаться в природе. Согласно определенным аспектам полинуклеотид может представлять собой cDNA или происходить из cDNA. Согласно определенным аспектам полинуклеотид может быть получен рекомбинантным путем. Согласно определенным аспектам полинуклеотид может содержать кодирующую последовательность для зрелого полипептида, слитую в той же самой рамке считывания с полинуклетидом, который способствует, например, экспрессии и секреции полипептида из клетки-хозяина (например, лидерной последовательностью, которая функционирует в качестве секреторной последовательности для контроля транспорта полипептида из клетки). Полипептид с лидерной последовательностью представляет собой белок-предшественник и может иметь лидерную последовательность, отщепляемую клеткой-хозяином с образованием зрелой формы полипептида.

[0167] Согласно определенным аспектам в настоящем раскрытии предусмотрен полинуклеотид, содержащий нуклеиновую кислоту, которая кодирует гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, или полипептидную субъединицу гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, предусматриваемых в данном документе.

[0168] Также предусмотрены полинуклеотиды, содержащие последовательности нуклеиновых кислот, содержащих одну или небольшое число делеций, добавлений и/или замен. Такие изменения могут быть расположены рядом или могут быть распределены в различных положениях в нуклеиновой кислоте. Фактически идентичная последовательность нуклеиновой кислоты может иметь, например, 1, или 2, или 3, или 4, или даже большее число нуклеотидных делеций, добавлений и/или замен. Согласно определенным аспектам одна или более делеций, добавлений и/или замен не меняют рамку считывания, закодированную в полинуклеотидной последовательности, так что при экспрессии этой нуклеиновой кислоты получается модифицированный ("мутантный"), но фактически идентичный полипептид.

[0169] Согласно определенным аспектам в настоящем раскрытии предусмотрен выделенный полинуклеотид, содержащий нуклеиновую кислоту, кодирующую VL антитела, при этом VL содержит аминокислотную последовательность, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной аминокислотной последовательности под SEQ ID NO: 29 или SEQ ID NO: 32. Согласно определенным аспектам полинуклеотид кодирует легкую цепь антитела и содержит нуклеотидную последовательность, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной последовательности нуклеиновой кислоты под SEQ ID NO: 31.

[0170] Согласно определенным аспектам в настоящем раскрытии предусмотрен выделенный полипептид, содержащий нуклеиновую кислоту, кодирующую VL антитела, где VL содержит SEQ ID NO: 29 или SEQ ID NO: 32.

[0171] В настоящем раскрытии дополнительно предусмотрен выделенный полинуклеотид, содержащий нуклеиновую кислоту, кодирующую VH антитела, где VH содержит аминокислотные последовательности VH-CDR1, VH-CDR2 и VH-CDR3, которые идентичны или идентичны, за исключением замен, делеций или вставок восьми, семи, шести, пяти, четырех, трех, двух или одной аминокислоты в одной или нескольких из VH-CDR: аминокислотной последовательности VHCDR1 под SEQ ID NO: 8, аминокислотной последовательности VHCDR2 под SEQ ID NO: 14, SEQ ID NO: 15 или SEQ ID NO: 16 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 25, SEQ ID NO: 26 или SEQ ID NO: 27.

[0172] В настоящем раскрытии дополнительно предусмотрен выделенный полинуклеотид, содержащий нуклеиновую кислоту, кодирующую VH антитела, где VH содержит аминокислотную последовательность формулы:

HFW1-HCDR1-HFW2-HCDR2-HFW3-HCDR3-HFW4,

где HFW1 представляет собой SEQ ID NO: 6 или SEQ ID NO: 7, HCDR1 представляет собой SEQ ID NO: 8, HFW2 представляет собой SEQ ID NO: 9, HCDR2 представляет собой SEQ ID NO: 14, SEQ ID NO: 15 или SEQ ID NO: 16, HFW3 представляет собой SEQ ID NO: 17, HCDR3 представляет собой SEQ ID NO: 25, SEQ ID NO: 26 или SEQ ID NO: 27, а HFW4 представляет собой SEQ ID NO: 28. Согласно определенным аспектам аминокислотная последовательность HFW2 представляет собой SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 или SEQ ID NO: 13. Согласно определенным аспектам аминокислотная последовательность HFW3 представляет собой SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 или SEQ ID NO: 24.

[0173] Более того, в настоящем раскрытии предусмотрен выделенный полинуклеотид, содержащий нуклеиновую кислоту, кодирующую VH антитела, где VH содержит аминокислотную последовательность, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной аминокислотной последовательности под SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 65 или SEQ ID NO: 67. Согласно определенным аспектам полинуклеотид содержит нуклеотидную последовательность, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной последовательности нуклеиновой кислоты под SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 44, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 50, SEQ ID NO: 52, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 58, SEQ ID NO: 60, SEQ ID NO: 62, SEQ ID NO: 64, SEQ ID NO: 66 или SEQ ID NO: 68.

[0174] Согласно определенным аспектам в настоящем изобретении предусмотрен полинуклеотид, содержащий нуклеиновую кислоту под SEQ ID NO: 60, нуклеиновую кислоту под SEQ ID NO: 31, нуклеиновую кислоту под SEQ ID NO: 72 или любую их комбинацию.

[0175] Дополнительно предусмотрен вектор, содержащий полинуклеотид, описанный выше. Подходящие векторы описаны в других частях данного документа и известны специалистам в данной области.

[0176] Согласно определенным аспектам в настоящем раскрытии предусмотрена композиция, например, фармацевтическая композиция, содержащая полинуклеотид или вектор, как описано выше, необязательно дополнительно содержащая один или несколько носителей, разбавителей, наполнителей или других добавок.

[0177] Согласно определенным аспектам в настоящем раскрытии предусмотрена композиция полинуклеотидов, содержащая: полинуклеотид, который содержит нуклеиновую кислоту, кодирующую VH, и полинуклеотид, который содержит нуклеиновую кислоту, кодирующую VL. Согласно данному аспекту VL и VH совместно могут содержать аминокислотную последовательность VL, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной аминокислотной последовательности под SEQ ID NO: 29 или SEQ ID NO: 32, и VH, содержащую: (а) аминокислотные последовательности VH-CDR1, VH-CDR2 и VH-CDR3, которые идентичны или идентичны, за исключением замен, делеций или вставок восьми, семи, шести, пяти, четырех, трех, двух или одной аминокислоты в одной или нескольких из VH-CDR: аминокислотной последовательности VHCDR1 под SEQ ID NO: 8, аминокислотной последовательности VHCDR2 под SEQ ID NO: 14, SEQ ID NO: 15 или SEQ ID NO: 16 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 25, SEQ ID NO: 26 или SEQ ID NO: 27; (b) аминокислотную последовательность формулы:

HFW1-HCDR1-HFW2-HCDR2-HFW3-HCDR3-HFW4,

где HFW1 представляет собой SEQ ID NO: 6 или SEQ ID NO: 7, HCDR1 представляет собой SEQ ID NO: 8, HFW2 представляет собой SEQ ID NO: 9, HCDR2 представляет собой SEQ ID NO: 14, SEQ ID NO: 15 или SEQ ID NO: 16, HFW3 представляет собой SEQ ID NO: 17, HCDR3 представляет собой SEQ ID NO: 25, SEQ ID NO: 26 или SEQ ID NO: 27, а HFW4 представляет собой SEQ ID NO: 28; или (с) аминокислотную последовательность, которая по меньшей мере на 70%, 75%, 80%, 85%, 90%, 95% или 100% идентична эталонной аминокислотной последовательности под SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 65 или SEQ ID NO: 67. В случае VH, содержащей (b), аминокислотной последовательностью HFW2 может быть SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 или SEQ ID NO: 13; и/или аминокислотной последовательностью HFW3 может быть SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 или SEQ ID NO: 24.

[0178] В композиции полинуклеотидов, как описано выше, полинуклеотид, содержащий нуклеиновую кислоту, кодирующую VH, и полинуклеотид, содержащий нуклеиновую кислоту, кодирующую VL, могут находиться в одном векторе или могут находиться на отдельных, неидентичных векторах. Соответственно, в настоящем раскрытии предусмотрен один или несколько векторов, содержащих композицию полинуклеотидов, описанную выше.

[0179] В некоторых случаях композиция полинуклеотидов, кодирующая VH и VL, как описано выше, может кодировать гуманизированное антитело или его антигенсвязывающий фрагмент, который может специфически связываться с OX40, например, OX40 человека, OX40 макака-крабоеда и /или OX40 макака-резуса.

[0180] Согласно определенным аспектам в настоящем раскрытии предусмотрен выделенный полинуклеотид, содержащий нуклеиновую кислоту, которая кодирует антитело к OX40 или его фрагмент, содержащие гуманизированную VH, присоединенную к константой области тяжелой цепи мыши, и гуманизированную VL, присоединенную к константной области легкой цепи мыши, при этом тяжелая цепь содержит SEQ ID NO: 81, а легкая цепь содержит SEQ ID NO: 83. Согласно определенным аспектам константная область тяжелой цепи может представлять собой, например, константную область IgG1 мыши. Согласно определенным аспектам константная область легкой цепи может представлять собой, например, константную область каппа-цепи мыши.

[0181] Согласно определенным аспектам в настоящем раскрытии предусмотрен выделенный полинуклеотид, содержащий нуклеиновую кислоту, которая кодирует антитело крысы к OX40 мыши или его антигенсвязывающий фрагмент, содержащий VH крысы и VL крысы, при этом VH содержит аминокислотную последовательность под SEQ ID NO: 85, а VL содержит аминокислотную последовательность под SEQ ID NO: 88. Согласно определенным аспектам данное антитело или его фрагмент дополнительно содержат константную область легкой цепи или ее фрагмент, слитые с C-концом VL. Константная область легкой цепи может представлять собой, например, константную область каппа-цепи мыши. Согласно определенным аспектам данное антитело или его фрагмент дополнительно содержат константную область тяжелой цепи или ее фрагмент, слитый с C-концом VH. Константная область тяжелой цепи может представлять собой, например, константную область IgG2a мыши. Согласно определенным аспектам данное антитело крысы к OX40 мыши содержит аминокислотную последовательность тяжелой цепи под SEQ ID NO: 86 и аминокислотную последовательность легкой цепи под SEQ ID NO: 89. Согласно определенным аспектам антитело крысы к OX40 мыши или его фрагмент, предусматриваемые в данном документе, могут специфически связываться с OX40 мыши. Согласно определенным аспектам введение мыши эффективной дозы антитела крысы к OX40 мыши или его фрагмента, предусматриваемых в данном документе, может подавлять рост линий клеток мышиного рака у мыши.

[0182] В настоящем раскрытии дополнительно предусмотрена клетка-хозяин, содержащая полинуклеотид, композицию полинуклеотидов или вектор, предусматриваемые выше, где клетка-хозяин в некоторых случаях может экспрессировать антитело или его антигенсвязывающий фрагмент, которые специфически связываются с OX40, например, OX40 человека, OX40 макака-крабоеда или OX40 макака-резуса. Такую клетку-хозяина можно использовать в способе получения антитела или его антигенсвязывающего фрагмента, предусматриваемых в данном документе, при этом способ включает (a) культивирование клетки-хозяина и (b) выделение антитела или его антигенсвязывающего фрагмента, экспрессируемого клеткой-хозяином.

[0183] Также предусмотрены варианты полинуклеотидов. Варианты полинуклеотидов могут содержать изменения в кодирующих областях, некодирующих областях или как в тех, так и в других. Согласно некоторым аспектам варианты полинуклеотидов содержат изменения, которые приводят к "молчащим" заменам, добавлениям или делециям, но не меняют свойства или активность кодируемого полипептида. Согласно некоторым аспектам варианты полинуклеотидов образуются в результате "молчащих" замен вследствие вырожденности генетического кода. Варианты полинуклеотидов можно получать по разным причинам, например, для кодонной оптимизации при экспрессии в конкретном хозяине (изменение кодонов в mRNA человека на кодоны для бактериального хозяина, такого как E. coli). Также преложены векторы и клетки, содержащие полинуклеотиды, описанные в данном документе.

[0184] Согласно некоторым аспектам последовательность ДНК, кодирующая гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, может быть сконструирована при помощи химического синтеза с применением олигонуклеотидного синтезатора. Такие олигонуклеотиды можно конструировать на основе аминокислотной последовательности требуемого полипептида и отбирая те кодоны, которые являются предпочтительными для клетки-хозяина, в которой будут получать рекомбинантный полипептид, представляющий интерес. Для синтеза выделенной полинуклеотидной последовательности, кодирующей выделенный полипептид, представляющий интерес, можно применять стандартные способы. Например, полную аминокислотную последовательность можно применять для конструирования гена с возможной последовательностью, восстановленной по полипептиду. Затем можно синтезировать ДНК-олигомер, содержащий нуклеотидную последовательность, кодирующую конкретный выделенный полипептид. Например, можно синтезировать несколько небольших олигонуклеотидов, кодирующих части требуемого полипептида, а затем лигировать их. Для комплементарной сборки отдельные олигонуклеотиды могут содержать 5'- или 3'-выступающие концы.

[0185] Сразу после сборки (посредством синтеза, сайт-направленного мутагенеза или другого способа) полинуклеотидные последовательности, кодирующие конкретный выделенный полипептид, представляющий интерес, можно вставить в вектор экспрессии и функционально связать с последовательностью контроля экспрессии, подходящей для экспрессии белка в требуемом хозяине. Правильность сборки можно подтвердить, например, с помощью секвенирования нуклеотидов, рестрикционного картирования и/или экспрессии биологически активного полипептида в подходящем хозяине. Для получения высоких уровней экспрессии трансфицированного гена в хозяине ген можно функционально связать или ассоциировать с последовательностями контроля экспрессии на уровне транскрипции и трансляции, которые являются функциональными в выбранном хозяине для экспрессии.

[0186] Согласно определенным аспектам рекомбинантные векторы экспрессии применяют для амплификации и экспрессии ДНК, кодирующей гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент. Рекомбинантные векторы экспрессии представляют собой реплицируемые ДНК-конструкции, которые имеют синтетические или полученные из cDNA фрагменты ДНК, кодирующие полипептидную цепь гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, функционально связанные с подходящими регуляторными элементами транскрипции или трансляции, происходящими из генов млекопитающих, микроорганизмов, вирусов или насекомых. Согласно одному примеру единица транскрипции может содержать сборку из (1) генетического элемента или элементов, принимающих участие в регуляции экспрессии генов, например, промоторов или энхансеров транскрипции, (2) структурной или кодирующей последовательности, которая транскрибируется в mRNA и транслируется в белок, и (3) подходящих последовательностей инициации и терминации транскрипции и трансляции, как подробно описано ниже. Такие регуляторные элементы могут включать последовательность оператора для контроля транскрипции. Дополнительно может предусматриваться способность к репликации в хозяине, обеспечиваемая, например, точкой начала репликации, и ген селекции для облегчения распознавания трансформантов. Области ДНК являются функционально связанными, когда они функционально зависят друг от друга. Например, ДНК сигнального пептида (секреторная лидерная последовательность) функционально связана с ДНК полипептида, если она экспрессируется в виде предшественника, который участвует в секреции полипептида; промотор функционально связан с кодирующей последовательностью, если он контролирует транскрипцию последовательности; или сайт связывания рибосомы функционально связан с кодирующей последовательностью, если он расположен так, чтобы обеспечивать трансляцию. Структурные элементы, предназначенные для применения в дрожжевых системах экспрессии, включают лидерную последовательность, обеспечивающую секрецию из клетки транслируемого белка клеткой-хозяином. В качестве альтернативы, если рекомбинантный белок экспрессируется без лидерной или транспортной последовательности, то белок может включать N-концевой метионин. Впоследствии этот метионин может быть необязательно отщеплен от экспрессированного рекомбинантного белка с образованием конечного продукта.

[0187] Выбор последовательности контроля экспрессии и вектора экспрессии будет зависеть от выбора хозяина. Можно использовать самые разные комбинации хозяин/вектор экспрессии. Пригодные векторы экспрессии для эукариотических хозяев включают, например, векторы, содержащие последовательности контроля экспрессии из SV40, вируса папилломы крупного рогатого скота, аденовируса и цитомегаловируса. Пригодные векторы экспрессии для бактериальных хозяев включают известные бактериальные плазмиды, такие как плазмиды из E. coli, в том числе pCR 1, pBR322, pMB9 и их производные, плазмиды более широкого диапазона хозяев, такие как M13 и нитевидные фаги с однонитевой ДНК.

[0188] Подходящие клетки-хозяева для экспрессии гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента включают клетки прокариот, дрожжей, насекомых и высших эукариот под контролем подходящих промоторов. Прокариоты включают грамотрицательные или грамположительные организмы, например, E. coli или бацилл. Клетки высших эукариот включают устойчивые линии клеток, происходящие от млекопитающих, описанные ниже. Можно также использовать бесклеточные системы трансляции. Дополнительную информацию касательно способов получения белка, в том числе получения антител, можно найти, например, в патентной публикации США № 2008/0187954, патентах США №№ 6413746 и 6660501, и международной патентной публикации № WO 04009823, каждая из которых включена тем самым в данный документ посредством ссылки во всей своей полноте.

[0189] Для экспрессии гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента можно также использовать различные системы культивирования клеток млекопитающих или насекомых. Экспрессию рекомбинантных белков можно осуществлять в клетках млекопитающих, поскольку такие белки в основном правильно свернуты, модифицированы соответствующим образом и полностью функциональны. Примеры подходящих линий клеток-хозяев на основе клеток млекопитающих включают HEK-293 и HEK-293T, линии COS-7 клеток почек обезьян, описанные в Gluzman (Cell 23:175, 1981), и другие линии клеток, в том числе, например, L-клетки, линии клеток C127, 3T3, клетки яичников китайского хомячка (CHO), HeLa и BHK. Векторы экспрессии в клетках млекопитающих могут содержать нетранскрибируемые элементы, такие как точка начала репликации, подходящий промотор и энхансер, связанные с геном, подлежащим экспрессии, а также другие 5'- или 3'-фланкирующие нетранскрибируемые последовательности и 5'- или 3'-нетранслируемые последовательности, такие как участки связывания рибосомы, сайт полиаденилирования, донорный сайт сплайсинга, акцепторный сайт сплайсинга и последовательности терминации транскрипции. Бакуловирусные системы для получения гетерологичных белков в клетках насекомых рассматриваются в Luckow & Summers, BioTechnology 6:47 (1988).

[0190] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, полученные при помощи трансформированного хозяина, можно очистить любым подходящим способом. Такие стандартные способы включают хроматографию (например, ионообменную, аффинную и эксклюзионную колоночную хроматографию), центрифугирование, очистку на основе неодинаковой растворимости или любую другую стандартную методику очистки белков. Аффинные метки, такие как гексагистидин, мальтозосвязывающий домен, последовательность белка оболочки вируса гриппа и глутатион-S-трансфераза, можно присоединять к белку для обеспечения возможности легкой очистки путем пропускания через подходящую аффинную колонку. Выделенные белки можно также физически характеризовать с применением таких методик, как протеолиз, ядерный магнитный резонанс и рентгеноструктурная кристаллография.

[0191] Например, супернатанты из систем, которые секретируют рекомбинантный белок в культуральную среду, можно сначала концентрировать с применением коммерчески доступного фильтра для концентрирования белков, например, блока для ультрафильтрации Amicon или Pellicon от Millipore. После стадии концентрирования концентрат можно нанести на подходящую матрицу для очистки. В качестве альтернативы можно использовать анионообменную смолу, например, матрицу или субстрат с боковыми диэтиламиноэтильными (DEAE) группами. Матрицы могут быть акриламидными, агарозными, декстрановыми, целлюлозными или других типов, обычно используемых для очистки белков. В качестве альтернативы можно использовать стадию катионного обмена. Подходящие катионообменники включают различные нерастворимые матрицы, содержащие сульфопропильные или карбоксиметильные группы. В заключение для дополнительной очистки гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента можно использовать одну или несколько стадий высокоэффективной жидкостной хроматографии с обращенными фазами (RP-HPLC) с использованием гидрофобных сред для RP-HPLC, например, силикагеля с боковыми метильными или другими алифатическими группами. Некоторые или все из вышеизложенных стадий очистки в различных комбинациях можно также использовать для получения гомогенного рекомбинантного белка.

[0192] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, полученный в культуре бактерий, можно выделять, например, путем исходной экстракции из клеточных осадков с последующими одной или несколькими стадиями концентрирования, высаливания, водной ионообменной хроматографии или эксклюзионной хроматографии. На конечных стадиях очистки можно использовать высокоэффективную жидкостную хроматографию (HPLC). Клетки микроорганизмов, используемые для экспрессии рекомбинантного белка, можно разрушать с помощью любого удобного способа, в том числе проведения циклов замораживания-оттаивания, обработки ультразвуком, механического разрушения или применения средств для лизиса клеток.

[0193] Способы, известные из уровня техники для очистки антител и других белков, также включают, например, описанные в патентных публикациях США №№ 2008/0312425, 2008/0177048 и 2009/0187005, каждая из которых тем самым включена в данный документ посредством ссылки во всей своей полноте.

ФАРМАЦЕВТИЧЕСКИЕ КОМПОЗИЦИИ И СПОСОБЫ ВВЕДЕНИЯ

[0194] Способы получения гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента и введения их субъекту, нуждающемуся в этом, предусматриваемые в данном документе, например, для усиления иммунного ответа у пациента со злокачественным новообразованием, например, для подавления или снижения скорости роста опухоли, хорошо известны специалистам в данной области или могут быть легко определены ими. Путь введения гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента может быть, например, пероральным, парентеральным, ингаляционным или местным. Термин парентеральный, как используется в данном документе, включает, например, внутривенное, внутриартериальное, внутрибрюшинное, внутримышечное, подкожное, ректальное или вагинальное введение. Хотя все эти формы введения явно рассматриваются в качестве подходящих форм, другим примером формы для введения будет раствор для инъекций, в частности, для внутривенной или внутриартериальной инъекции или капельного вливания. Обычно подходящая фармацевтическая композиция может содержать без ограничений буфер (например, ацетатный, фосфатный или цитратный), поверхностно-активное вещество (например, полисорбат), стабилизирующее средство (например, человеческий альбумин) и т. д. В других способах, совместимых с идеями данного документа, гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, предусматриваемые в данном документе, могут доставляться непосредственно в локализацию нежелательной клеточной популяции, увеличивая тем самым воздействие терапевтического средства на пораженную ткань.

[0195] Определенные фармацевтические композиции, предусмотренные в данном документе, можно вводить перорально в виде приемлемой лекарственной формы, включающей, например, капсулы, таблетки, водные суспензии или растворы. Определенные фармацевтические композиции также можно вводить при помощи назального аэрозоля или путем ингаляции. Такие композиции можно получать в виде растворов в солевом растворе с использованием бензилового спирта или других подходящих консервантов, стимуляторов абсорбции для повышения биодоступности и/или других традиционных солюбилизирующих или диспергирующих средств.

[0196] Количество гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, которые можно комбинировать с материалами-носителями для получения единичной лекарственной формы, будет варьировать в зависимости от субъекта, подлежащего лечению, и конкретного способа введения. Композицию можно вводить в виде однократной дозы, многократных доз или в течение установленного периода времени в виде инфузии. Схемы дозирования также можно корректировать для обеспечения оптимального требуемого ответа (например, терапевтического или профилактического ответа).

[0197] Под "терапевтически эффективной дозой или количеством" или "эффективным количеством" подразумевается количество гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, которое при введении приводит к положительному терапевтическому ответу с точки зрения лечения пациента с заболеванием или состоянием, подлежащими лечению.

НАБОРЫ

[0198] В настоящем раскрытии дополнительно предусмотрены наборы, которые содержат гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, описанные в данном документе, и которые можно применять для осуществления способов, описанных в данном документе. Согласно определенным вариантам осуществления набор содержит по меньшей мере одно очищенное гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент в одном или нескольких контейнерах. Специалист в данной области без труда поймет, что раскрытое гуманизированное антитело к OX40 можно легко заключать в один из установленных форматов набора, которые хорошо известны в данной области техники.

ИММУНОЛОГИЧЕСКИЕ АНАЛИЗЫ

[0199] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент можно анализировать в отношении специфического и/или селективного связывания с помощью любого способа, известного из уровня техники. Иммунологические анализы, которые можно применять, включают без ограничений системы для конкурентных и неконкурентных анализов с применением таких методик как вестерн-блотинг, радиоиммунологические анализы, ELISA (твердофазный иммуноферментный анализ), анализ флуоресцентных очагов (FFA), иммунологические "сэндвич"-анализы, анализы иммунопреципитации, реакции преципитации, реакции диффузной преципитации в геле, анализы иммунодиффузии, анализы агглютинации, анализы связывания комплемента, иммунорадиометрические анализы, флуоресцентные иммунологические анализы и многие другие. Такие анализы являются стандартными и хорошо известны из уровня техники (см., например, Ausubel et al., eds, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., NY, Vol. 1 (1994), который включен в данный документ посредством ссылки во всей своей полноте).

[0200] Способы и реактивы, подходящие для определения характеристик связывания гуманизированного антитела к OX40, предусматриваемого в данном документе, известны из уровня техники и/или являются коммерчески доступными. Оборудование и программное обеспечение, разработанное для таких кинетических анализов, является коммерчески доступным (например, программное обеспечение BIAcore®, BIAevaluation® от GE Healthcare; программное обеспечение KINEXA® от Sapidyne Instruments).

СПОСОБЫ УСИЛЕНИЯ ИММУННОГО ОТВЕТА И ЛЕЧЕНИЯ

[0201] Усиление антиген-специфического иммунного ответа у субъекта (например, субъекта-млекопитающего, такого как субъект-человек) путем вовлечения OX40 на активированных T-клетках, например, активированных CD4+ T-клетках и/или активированных CD8+ T-клетках, во время или после активации антигеном можно выполнять при помощи самых разных способов. Выбранный способ будет в первую очередь зависеть от типа антигена, в отношении которого необходимо усилить иммунный ответ, и различные доступные способы обсуждаются ниже. Вне зависимости от выбранного способа гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент можно вводить субъекту, например, пациенту-человеку, таким образом, чтобы они оказались у T-клеток субъекта во время или непосредственно после примирования T-клеток антигеном.

[0202] Согласно определенным аспектам в настоящем раскрытии предусмотрен способ содействия выживанию или пролиферации активированных T-клеток, например, активированных CD4+ T-клеток и/или активированных CD8+ T-клеток, предусматривающий приведение активированных T-клеток, например, активированных CD4+ T-клеток и/или активированных CD8+ T-клеток, в контакт с гуманизированным антителом к OX40 или его антигенсвязывающим фрагментом, при условиях, где гуманизированное антитело к OX40 может специфически связываться с OX40 на поверхности T-клеток, например, активированных CD4+ T-клеток и/или активированных CD8+ T-клеток. Согласно определенным аспектам приведение в контакт осуществляется in vitro. Согласно определенным аспектам приведение в контакт осуществляется in vivo, например, посредством введения эффективной дозы гуманизированного антитела к OX40 субъекту, нуждающемуся в лечении. Согласно определенным аспектам приведение в контакт может происходить одновременно с активацией T-клеток, например, активацией антигеном, согласно определенным аспектам приведение в контакт может происходить после активации T-клеток.

[0203] Согласно дополнительным аспектам в настоящем раскрытии предусмотрен способ индуцирования высвобождения цитокинов из активированных T-клеток, например, активированных CD4+ T-клеток и/или активированных CD8+ T-клеток, предусматривающий приведение активированных T-клеток, например, активированных CD4+ T-клеток и/или активированных CD8+ T-клеток, в контакт с гуманизированным антителом к OX40 или его антигенсвязывающим фрагментом, предусматриваемыми в данном документе, при этом гуманизированное антитело к OX40 может специфически связываться с OX40 на поверхности активированных T-клеток, например, активированных CD4+ T-клеток и/или активированных CD8+ T-клеток. Согласно определенным аспектам приведение в контакт осуществляется in vitro. Согласно определенным аспектам приведение в контакт осуществляется in vivo, например, посредством введения эффективной дозы гуманизированного антитела к OX40 субъекту, нуждающемуся в лечении. Согласно определенным аспектам приведение в контакт может происходить одновременно с активацией T-клеток, например, активацией антигеном, согласно определенным аспектам приведение в контакт может происходить после активации T-клеток. Согласно определенным аспектам цитокин может представлять собой IFNγ, TNFα, IL-5, IL-10, IL-2, IL-4, IL-13, IL-8, IL-12 p70, IL-1β или любую их комбинацию. Согласно определенным аспектам цитокин представляет собой IFNγ, TNFα, IL-5, IL-10, IL-13 или любую их комбинацию.

[0204] Согласно определенным аспектам активированные T-клетки, например, активированные CD4+ T-клетки и/или активированные CD8+ T-клетки представляют собой T-клетки человека, T-клетки макака-крабоеда, T-клетки макака-резуса или их комбинацию.

[0205] В настоящем раскрытии дополнительно предусмотрен способ содействия активации T-клеток, включающий приведение T-клеток в контакт с гуманизированным антителом к OX40, предусматриваемым в данном документе, где гуманизированное антитело к OX40 может специфически связываться с OX40 на поверхности T-клеток. Согласно определенным аспектам приведение в контакт происходит в присутствии антигена, например, опухолевого антигена. Согласно определенным аспектам способ дополнительно включает взаимодействие Fc-домена гуманизированного антитела к OX40 с клеткой, экспрессирующей FcγR, например, B-клеткой, моноцитом, макрофагом, миелоидной или плазмацитоидной дендритной клеткой, фоллликулярной дендритной клеткой, клеткой Лангерганса, эндотелиальной клеткой, NK-клеткой, активированной T-клеткой, нейтрофилом, эозинофилом, тромбоцитом, тучной клеткой, CD45+ клеткой из первичной опухоли человека или дренирующего опухоль или недренирующего опухоль лимфатического узла, CD45+ клеткой из других вторичных или третичных лимфатических структур или их комбинацией. Согласно определенным аспектам активацию T-клеток можно измерить по стимуляции пути передачи сигнала NFκB. Согласно определенным аспектам приведение в контакт осуществляется in vitro. Согласно определенным аспектам приведение в контакт осуществляется in vivo, например, посредством введения эффективной дозы гуманизированного антитела к OX40 субъекту, нуждающемуся в лечении.

[0206] В настоящем раскрытии дополнительно предусмотрен способ лечения злокачественного новообразования у субъекта, включающий введение субъекту, нуждающемуся в лечении, эффективного количества гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, или композиции или состава, содержащих гуманизированное антитело к OX40. Согласно определенным аспектам рак представляет собой солидную опухоль. Согласно данному способу введение гуманизированного антитела к OX40 или композиции может подавлять рост опухоли; может содействовать уменьшению размеров опухоли или как то, так и другое. Согласно определенным аспектам подавление роста опухоли обеспечивается в присутствии T-клеток.

[0207] Термины "рак", "опухоль", "раковый" и "злокачественный" относятся к физиологическому состоянию у млекопитающих, которое, как правило, характеризуется нерегулируемым клеточным ростом, или описывает его. Примеры форм злокачественных новообразований включают без ограничений карциному, в том числе формы аденокарциномы, лимфомы, бластомы, меланомы, саркомы и лейкозов. Более конкретные примеры таких форм злокачественного новообразования включают плоскоклеточный рак, мелкоклеточный рак легкого, немелкоклеточный рак легкого, рак желудочно-кишечного тракта, лимфому Ходжкина и неходжкинскую лимфому, рак поджелудочной железы, глиобластому, глиому, рак шейки матки, рак яичников, рак печени, как, например, карциному печени и гепатому, рак мочевого пузыря, рак молочной железы (в том числе гормонально опосредованный рак молочной железы, см., например, Innes et al. (2006) Br. J. Cancer 94:1057-1065), рак толстой кишки, колоректальный рак, карциному эндометрия, миелому (как, например, множественную миелому), карциному слюнной железы, рак почки, как, например, почечно-клеточную карциному и опухоли Вильмса, базальноклеточную карциному, меланому, рак предстательной железы, рак вульвы, рак щитовидной железы, рак яичка, рак пищевода, различные типы рака головы и шеи, в том числе, без ограничения, формы плоскоклеточного рака и формы рака муцинозного происхождения, как, например, муцинозный рак яичников, холангиокарциному (печени) и папиллярную карциному почки.

[0208] В настоящем раскрытии дополнительно предусмотрен способ предупреждения или лечения злокачественного новообразования у субъекта, нуждающегося в этом, включающий введение субъекту эффективного количества гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, композиции или состава, содержащих гуманизированное антитело к OX40, или полинуклеотида, вектора или клетки-хозяина, описанных в данном документе.

[0209] Эффективные дозы композиций для лечения злокачественного новообразования варьируют в зависимости от множества различных факторов, в том числе от способа введения, целевого участка, физиологического состояния пациента, того, является ли пациент человеком или животным, других вводимых лекарственных препаратов, и того, является ли лечение профилактическим или терапевтическим. Обычно пациент является человеком, однако также можно лечить млекопитающих, отличных от человека, в том числе трансгенных млекопитающих. Для оптимизации безопасности и эффективности дозировки для лечения можно подбирать с применением обычных способов, известных специалистам в данной области.

[0210] Композиции по настоящему раскрытию можно вводить любым подходящим способом, например, парентерально, интравентрикулярно, перорально, с помощью спрея для ингаляции, местно, ректально, назально, буккально, вагинально или посредством имплантированного резервуара. Термин "парентеральный", как используется в данном документе, предусматривает методики подкожных, внутривенных, внутримышечных, внутрисуставных, интрасиновиальных, внутригрудинных, интратекальных, внутрипеченочных, внутриочаговых и внутричерепных инъекций или инфузий.

[0211] В настоящем раскрытии дополнительно предусмотрен способ усиления иммунного ответа у субъекта, включающий введение субъекту, нуждающемуся в этом, терапевтически эффективного количества гуманизированного антитела к OX40 или его антигенсвязывающего фрагмента, или композиции или состава, содержащих гуманизированное антитело к OX40.

[0212] Субъектом, подлежащим лечению, может быть любое животное, например, млекопитающее, нуждающееся в лечении, согласно определенным аспектам субъектом является субъект-человек.

[0213] В своей простейшей форме препарат, подлежащий введению субъекту, представляет собой гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент, вводимые в виде традиционной лекарственной формы, которые можно объединять с фармацевтическим наполнителем, носителем или разбавителем, как описано в других частях данного документа.

[0214] Гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент можно вводить любым подходящим способом, как описано в других частях данного документа, например, при помощи IV инфузии. Согласно определенным аспектам гуманизированное антитело к OX40 или его антигенсвязывающий фрагмент можно вводить в опухоль или вблизи опухолевой клетки.

[0215] Все типы опухолей потенциально поддаются лечению при помощи данного подхода, в том числе без ограничения карцинома молочной железы, легкого, поджелудочной железы, яичника, почки, толстой кишки и мочевого пузыря, а также формы меланомы, саркомы и лимфомы.

[0216] Вовлечение рецептора OX40 на активированных T-клетках, например, активированных CD4+ T-клетках и/или активированных CD8+ T-клетках, во время или непосредственно после примирования антигеном приводит к усиленному ответу активированных T-клеток, например, активированных CD4+ T-клеток и/или активированных CD8+ T-клеток, на антиген. В контексте настоящего раскрытия термин "вовлечение" относится к связыванию с рецептором OX40 или стимуляции по меньшей мере одного вида активности, опосредуемой им. Например, вовлечение рецептора OX40 на антиген-специфических активированных T-клетках, например, активированных CD4+ T-клетках и/или активированных CD8+ T-клетках, приводит к повышенной пролиферации T-клеток по сравнению с ответом на антиген отдельно и повышенной выработке цитокинов. Усиленный ответ на антиген может сохраняться в течение значительно более продолжительного периода времени, чем в отсутствие вовлечения рецептора OX40. Таким образом, стимуляция посредством рецептора OX40 усиливает антиген-специфический иммунный ответ благодаря интенсификации распознавания Т-клетками антигенов, например, опухолевых антигенов.

[0217] Агонисты ОX40 могут усиливать антиген-специфические иммунные ответы у субъекта, такого как субъект-человек, при введении субъекту во время или вскоре после примирования T-клеток антигеном. Агонисты OX40 включают лиганды OX40 ("OX40L"), такие как растворимые белки слияния на основе OX40L и антитела к OX40 или их фрагменты. Конкретным примером является гуманизированное антитело, которое специфически связывается с OX40, вызывая тем самым передачу сигнала. В настоящем раскрытии предусмотрен ряд гуманизированных моноклональных антител к OX40. Также описаны нуклеиновые кислоты, включающие полинуклеотидные последовательности, которые кодируют такие антитела. В настоящем раскрытии также предусмотрены способы усиления антиген-специфического иммунного ответа у субъекта с применением гуманизированных моноклональных антител к OX40.

ЭПИТОПЫ OX40

[0218] Часть целевой молекулы, например, полипептида OX40, которая специфически взаимодействует с антигенсвязывающим доменом антитела, представляет собой "эпитоп," или "антигенную детерминанту". Целевая молекула, например, полипептид, может представлять собой один эпитоп, однако, как правило, включает по меньшей мере два эпитопа, а также может включать любое число эпитопов, в зависимости от размера, конформации и типа целевой молекулы.

[0219] Считается, что минимальный размер эпитопа, который может быть связан антителом на целевом полипептиде, составляет приблизительно четыре - пять аминокислот. Эпитопы пептида или полипептида могут содержать по меньшей мере семь, по меньшей девять, по меньшей мере десять или по меньшей мере приблизительно 15 или более аминокислот. Поскольку антитело может распознавать полипептидный антиген в его третичной форме, аминокислоты, составляющие эпитоп, не должны быть смежными. Эпитоп OX40, например, OX40 человека, предусматриваемый в данном документе, может включать по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 15, по меньшей мере 20, по меньшей мере 25 или от приблизительно 10 до приблизительно 30 смежных или несмежных аминокислот из OX40, например, OX40 человека. Согласно определенным аспектам эпитоп OX40, например, OX40 человека, предусматриваемого в данном документе, состоит из пептида, содержащего 100 аминокислот или меньше, 75 аминокислот или меньше, 50 аминокислот или меньше, 40 аминокислот или меньше, 35 аминокислот или меньше, 30 аминокислот или меньше, 25 аминокислот или меньше, 20 аминокислот или меньше или 15 аминокислот или меньше, и может включать по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 15, по меньшей мере 20, по меньшей мере 25 или от приблизительно 10 до приблизительно 30 смежных или несмежных аминокислот из OX40, например, OX40 человека. С другой стороны, эпитоп OX40, например, OX40 человека, предусматриваемого в данном документе, может включать не более 4, не более 5, не более 6, не более 7, не более 8, не более 9, не более 10, не более 15, не более 20, не более 25 аминокислот, или может состоять из от приблизительно 10 до приблизительно 30 смежных или несмежных аминокислот из OX40, например, OX40 человека.

[0220] Согласно определенным аспектам антитело к OX40 или его фрагмент, предусматриваемые в данном документе, связываются с эпитопом OX40, например, OX40 человека, OX40 макака-резуса или OX40 макака-крабоеда, который находится в пределах третьего домена с высоким содержанием цистеина (CRD3) OX40, например, в пределах аминокислот 108-146 OX40 человека (SEQ ID NO: 91), или пептида, который по меньшей мере на 17%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85% и по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 100% идентичен аминокислотам 108-146 из SEQ ID NO: 91. Под "находится в пределах" CRD3 из OX40 подразумевают, что эпитоп может включать 4 или более, 5 или более, 6 или более, 7 или более, 8 или более, 9 или более, 10 или более, 15 или более или 30 или более смежных или несмежных аминокислот из области OX40, состоящей из CRD3-области, например, аминокислот 108-146 из SEQ ID NO: 91, или пептид, который по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85% и по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 100% идентичен аминокислотам 108-146 из SEQ ID NO: 91.

[0221] Согласно определенным аспектам CRD3-пептид OX40, который связывается антителом, предусмотренным в данном документе, сохраняет лейцин в положении, соответствующем аминокислоте 116 из SEQ ID NO:91, и аланин в положении, соответствующем аминокислоте 126 из SEQ ID NO: 91. Например, определенные антитела к OX40 или их фрагменты, предусматриваемые в данном документе, связываются с OX40 человека, но не связываются с OX40 мыши или крысы. CRD3-область OX40 мыши тянется от приблизительно аминокислоты 104 до приблизительно аминокислоты 144 из SEQ ID NO: 92. Аминокислота Q113 из OX40 мыши, SEQ ID NO: 92, соответствует аминокислоте L116 из OX40 человека, SEQ ID NO: 91, а аминокислота V124 из OX40 мыши, SEQ ID NO: 92, соответствует аминокислоте A126 из OX40 человека, SEQ ID NO: 91. Как показано в примере 10, антитело к OX40, предусматриваемое в данном документе, например, OX40mAb24, может связываться с вариантом OX40 мыши, содержащим SEQ ID NO: 92, за исключением мутации Q113L и V124A.

[0222] Согласно определенным аспектам предусмотрен выделенный пептид, при этом пептид состоит из эпитопа, который специфически связывается антителом к OX40, предусматриваемым в данном документе, например, OX40mAb24, или содержит такой эпитоп. Согласно определенным аспектам пептид состоит из 100 аминокислот или меньше, 75 аминокислот или меньше, 50 аминокислот или меньше, 40 аминокислот или меньше, 35 аминокислот или меньше, 30 аминокислот или меньше, 25 аминокислот или меньше, 20 аминокислот или меньше или 15 аминокислот или меньше, и включает по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 15, по меньшей мере 20, по меньшей мере 25 или от приблизительно 10 до приблизительно 30 смежных или несмежных аминокислот из CRD3-области OX40, например, области OX40, которая по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85% и по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 100% идентична аминокислотам 108-146 из SEQ ID NO: 91. Согласно определенным аспектам пептид сохраняет лейцин в положении, соответствующем аминокислоте 116 из SEQ ID NO: 91, и аланин в положении, соответствующем аминокислоте 126 из SEQ ID NO: 91.

[0223] Такой выделенный пептид можно применять, например, для скрининга библиотек на предмет наличия связывающих молекул, которые специфически связываются с OX40, или в качестве иммуногена для индуцирования продукции антител к OX40 в испытуемом животном.

***

[0224] В данном раскрытии используются, если не указано иное, традиционные методики клеточной биологии, культивирования клеток, молекулярной биологии, биологии трансгенных организмов, микробиологии, технологии рекомбинантных ДНК и иммунологии, которые находятся в пределах компетенции специалиста в данной области. Такие методики в полном объеме объясняются в литературе. См., например, Sambrook et al., ed. (1989) Molecular Cloning A Laboratory Manual (2nd ed.; Cold Spring Harbor Laboratory Press); Sambrook et al., ed. (1992) Molecular Cloning: A Laboratory Manual, (Cold Springs Harbor Laboratory, NY); D. N. Glover ed., (1985) DNA Cloning, Volumes I and II; Gait, ed. (1984) Oligonucleotide Synthesis; Mullis et al., патент США № 4683195; Hames and Higgins, eds. (1984) Nucleic Acid Hybridization; Hames and Higgins, eds. (1984) Transcription And Translation; Freshney (1987) Culture Of Animal Cells (Alan R. Liss, Inc.); Immobilized Cells And Enzymes (IRL Press) (1986); Perbal (1984) A Practical Guide To Molecular Cloning; the treatise, Methods In Enzymology (Academic Press, Inc., N.Y.); Miller and Calos eds. (1987) Gene Transfer Vectors For Mammalian Cells, (Cold Spring Harbor Laboratory); Wu et al., eds., Methods In Enzymology, Vols. 154 and 155; Mayer and Walker, eds. (1987) Immunochemical Methods In Cell And Molecular Biology (Academic Press, London); Weir and Blackwell, eds., (1986) Handbook Of Experimental Immunology, Volumes I-IV; Manipulating the Mouse Embryo, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1986); и в Ausubel et al. (1989) Current Protocols in Molecular Biology (John Wiley and Sons, Baltimore, Md.).

[0225] Общие принципы конструирования антител изложены в Borrebaeck, ed. (1995) Antibody Engineering (2nd ed.; Oxford Univ. Press). Общие принципы конструирования белков изложены в Rickwood et al., eds. (1995) Protein Engineering, A Practical Approach (IRL Press at Oxford Univ. Press, Oxford, Eng.). Общие принципы строения антител и связывания антител с гаптенами изложены в: Nisonoff (1984) Molecular Immunology (2nd ed.; Sinauer Associates, Sunderland, Mass.); и Steward (1984) Antibodies, Their Structure and Function (Chapman and Hall, New York, N.Y.). Кроме того, стандартные способы, применяемые в иммунологии, известные из уровня техники и не описанные специально, как правило, соответствуют изложенным в Current Protocols in Immunology, John Wiley & Sons, New York; Stites et al., eds. (1994) Basic and Clinical Immunology (8th ed; Appleton & Lange, Norwalk, Conn.) и Mishell and Shiigi (eds) (1980) Selected Methods in Cellular Immunology (W.H. Freeman and Co., NY).

[0226] Стандартные справочные издания, излагающие общие принципы иммунологии, включают Current Protocols in Immunology, John Wiley & Sons, New York; Klein (1982) J., Immunology: The Science of Self-Nonself Discrimination (John Wiley & Sons, NY); Kennett et al., eds. (1980) Monoclonal Antibodies, Hybridoma: A New Dimension in Biological Analyses (Plenum Press, NY); Campbell (1984) "Monoclonal Antibody Technology" в Laboratory Techniques in Biochemistry and Molecular Biology, ed. Burden et al., (Elsevier, Amsterdam); Goldsby et al., eds. (2000) Kuby Immunology (4th ed.; H. Freemand & Co.); Roitt et al. (2001) Immunology (6th ed.; London: Mosby); Abbas et al. (2005) Cellular and Molecular Immunology (5th ed.; Elsevier Health Sciences Division); Kontermann and Dubel (2001) Antibody Engineering (Springer Verlag); Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Press); Lewin (2003) Genes VIII (Prentice Hall 2003); Harlow and Lane (1988) Antibodies: A Laboratory Manual (Cold Spring Harbor Press); Dieffenbach and Dveksler (2003) PCR Primer (Cold Spring Harbor Press).

[0227] Все из литературных источников, упомянутых выше, а также все литературные источники, упомянутые в данном документе, включены в данный документ при помощи ссылки во всей своей полноте.

[0228] Следующие примеры предлагаются в качестве иллюстрации, но не в качестве ограничения.

ПРИМЕРЫ

[0229] Сокращения и определения терминов приведены в таблице 2.

[0230] Таблица 2. Список сокращений и определений терминов

Сокращение или термин Определение
1A7 Антитело изотипического контроля для IgG1-каппа мыши
9B12 Моноклональное антитело на основе IgG1κ мыши к OX40 человека
A375 Линия клеток меланомы человека
Aa Аминокислота
ADCC Антителозависимая клеточная цитотоксичность
ADPE Разработка антител и белковая инженерия
ANOVA Дисперсионный анализ
Asp Аспарагиновая кислота
BSA Бычий сывороточный альбумин
BLASTP Средство поиска основного локального выравнивания для определения гомологии белковых последовательностей
C Объемы конечных опухолей из контрольной группы
CD Кластер дифференциации
CDC Комплементзависимая цитотоксичность
CD4+, OX40+ CD4-положительный, OX40-положительный
CDR Определяющие комплементарность области
CFA Полный адъювант Фрейнда
CFSE Сукцинимидиловый сложный эфир карбоксифлуоресцеина
CI Доверительный интервал
C1q Компонент комплемента C1q
CR Полный ответ
CRD Домен с высоким содержанием цистеина
Cyno Макак-крабоед
DM-L Среда с градиентом плотности для выделения лимфоцитов
E:T Эффектор-мишень (соотношение)
EC Эффективная концентрация
ECf Эффективная концентрация, обуславливающая f % максимального эффекта
EC20 Эффективная концентрация, обуславливающая 20% максимального эффекта
EC50 Полумаксимальная эффективная концентрация
EC90 Эффективная концентрация, обуславливающая 90% максимального эффекта
F Доля максимального эффекта
FACS Сортировка клеток с активированной флуоресценцией
FBS Фетальная бычья сыворотка
Fc Кристаллизуемый фрагмент
Fcer1g-/- Полученная с помощью генной инженерии линия мышей; у которых отсутствует экспрессия активирующих Fc-гамма рецепторов (Fc-гамма I, III и IV)
Fcgr2b-/- Полученная с помощью генной инженерии линия мышей; у которых отсутствует экспрессия ингибиторного Fc-гамма рецептора IIb
FCS Стандартный формат данных проточной цитометрии
Fcγ Кристаллизуемый фрагмент гамма-цепи
FMO "Флуоресценция минус одно"
FP Белок слияния
G Сила тяжести
H Час
H+L Тяжелая и легкая цепи
HEK293 Линия клеток почек эмбриона человека
Hr Час
HSC Гемопоэтическая стволовая клетка
Hu Человек
ICOS Индуцируемый Т-клеточный костимулятор
IgG Иммуноглобулин
IgG1 Иммуноглобулин G1
IL-2 Интерлейкин 2
IP Внутрибрюшинное
IU Международные единицы
Kd Константа диссоциации при равновесном связывании
KI Нокин
KLH Гемоцианин моллюска Megathura crenulata
KO Нокаут
Kp Равновесная константа диссоциации
Leu Лейцин
M Мышь
mAb Моноклональное антитело
мл Миллилитр
OX40mAb24 Гуманизированное моноклональное антитело на основе IgG1κ к OX40 человека
MFI Средняя интенсивность флуоресценции
mOX40L FP Белок слияния на основе лиганда OX40 мыши и IgG1 мыши
mOX40L FP (Y182A) Белок слияния на основе лиганда OX40 мыши и IgG1 мыши, сконструированный как обладающий пониженной способностью связывания с OX40
NFκB Ядерный фактор-усилитель легкой каппа-цепи у активированных B-клеток
NIP228 Моноклональное антитело на основе IgG1-каппа мыши к 4-гидрокси-3-йод-5-нитрофенилуксусной кислоте
NK Естественный киллер
NOD/SCID Мыши с инсулинозависимым диабетом/тяжелым комбинированным иммунодефицитом
NSG Мыши с генетическим фоном Nod.Cg-Prkdcscid112rgtm/Wy/SzJ
OX40L Лиганд OX40
OX40L FP IgG4P Y180A Белок слияния на основе лиганда OX40 человека и IgG4P, сконструированный как обладающий пониженной способностью связывания с OX40
OX40mAb24 Гуманизированное моноклональное антитело на основе IgG1κ к OX40 человека
OX86 Моноклональное антитело на основе IgG1κ крысы к OX40 мыши
PBMC Мононуклеарные клетки периферической крови
PBS Фосфатно-солевой буферный раствор
PHA-L Фитогемагглютинин-лейкоагглютинин
PI Пропидиум йодид
PK/PD Фармакокинетика/фармакодинамика
RBC Эритроцит
RBCL Лизис эритроцитов
RBD Рецептор-связывающий домен
Rh Рекомбинантный человеческий
RLU Относительные световые единицы
RPMI Среда Мемориального института Розуэлла Парка 1640
ROA Путь введения
SC Подкожно
SD Стандартное отклонение
SEM Стандартная ошибка среднего
Ser Серин
T Объемы конечных опухолей из тестируемой группы
Tcm Центральная T-клетка памяти
TCR T-клеточный рецептор
Teff Эффекторная T-клетка
Tem Эффекторная T-клетка памяти
TGI Подавление роста опухоли
TIL Лейкоцит, проникающий в опухоль
TM Трансмембранный домен
TNFR Рецептор фактора некроза опухоли
TNFRSF Суперсемейство рецепторов фактора некроза опухоли
TRAF2 Ассоциированный с рецептором фактора некроза опухоли фактор 2
Treg Регуляторные T-клетки
мкл Микролитр
мкг Микрограмм
V Объем

ПРИМЕР 1. Гуманизация mAb 9B12 мыши к OX40 человека

[0231] mAb 9B12 мыши гуманизировали путем привития его CDR на выбранные каркасные области зародышевой линии человека. Последовательности вариабельной области тяжелой цепи (VH) и вариабельной области легкой цепи (VL) mAb 9B12 мыши сравнивали с последовательностями антител зародышевой линии человека, доступными в общедоступных базах данных NCBI. Акцепторные каркасные области (FR) человека выявляли на основе максимальной гомологии последовательностей. При выборе оптимальной акцепторной каркасной области учитывали несколько критериев, таких как совпадающие остатки, которые могли бы нарушать связывание (остатки в зоне Верньера, остатки канонических классов и остатки в зоне контакта VH/VL), и потенциальная иммуногенность (низкая частота последовательностей зародышевой линии). Оптимальную гибридную последовательность акцепторной FR человека разрабатывали для VH и VL независимо путем выбора сегмента иммуноглобулина зародышевой линии человека с наибольшей гомологией для каждой индивидуальной каркасной области. Три различные акцепторные последовательности зародышевой линии комбинировали с получением гуманизированного каркасного остова VH, в то время как для VL отбирали две различные акцепторные последовательности зародышевой линии. Акцепторная матрица на основе полностью человеческих последовательностей зародышевой линии, выбранная для VH-цепи (9B12VH-hu), представляла собой комбинацию из IGVH4-34*09 (FR 1), VH4-39 (FR 2), VH6-1(FR 3) и JH4 (FR 4). VL (9B12VL-hu1) представляла собой комбинацию из O18 (FR 1), O18 (FR 2), L23 (FR 3) и JK1 (FR 4). Гомология каркасных областей между последовательностью мыши и акцепторной последовательностью матрицы человека составляла примерно 72% для VH и 77% для VL.

[0232] Остатки каркасных областей мыши, которые могли бы влиять на функциональную конформацию исходной CDR и участвовать в ее поддержании и которые не совпадали с последовательностью зародышевой линии человека, выявляли и выборочно повторно вводили в акцепторную FR человека, чтобы наилучшим образом сохранить аффиность связывания и функциональность 9B12. В данном случае остатки FR мыши 27D, 39K, 47Y, 48M, 71R, 78Y и 91F в VH цепи и 44V и 68R в VL цепи подвергали обратной мутации в матрице на основе последовательностей человека. Для получения гуманизированного антитела остатки CDR, определенные по Kabat, сливали в сконструированные акцепторные каркасы как для VH, так и для VL. Гены двух гуманизированных VH (9B12VH-hu и 9B12VH-hu39K71R) и гены двух VL (9B12VL-hu1 и 9B12VL-hu2) синтезировали с помощью GeneART (Thermo Fisher Scientific, Уолтем, Массачусетс), затем клонировали в полученный в собственной лаборатории вектор экспрессии pOE IgG1.

[0233] Панель гуманизированных вариантов была получена и охарактеризована в анализах связывания и пролиферации с участием T-клеток. Гуманизированные варианты, содержащие несколько аминокислот каркасных областей, восстановленных в мышиные остатки FR в вариабельной области тяжелой цепи, связывались с OX40 на активированных CD4+ T-клетках с сопоставимой аффиностью и подобной активностью (пролиферация T-клеток) относительно 9B12. В вариабельной области легкой цепи, которую спаривали со всеми вариантами гуманизированных VH, были закодированы полностью гуманизированные каркасные области. Для снижения риска иммуногенности число остатков мыши в FR человека для VH дополнительно снижали до 3 или 4, замещая не оказывающие влияния мышиные остатки соответствующими человеческими остатками. С целью устранения потенциальных факторов неустойчивости в последовательности сайт дезамидирования NG в VH-CDR2, сайт связывания интегрина RYD и сайт изомеризации DG в VH-CDR3 заранее удаляли либо независимо, либо в комбинации. С целью избежания ADCC, опосредованной Fc-эффекторной функцией IgG1 человека, на основе ведущих гуманизированных mAb получали Fc-варианты IgG4P и IgG1TM. Полученные варианты IgG4P и IgG1TM проявляли такую же активность связывания с OX40, что и варианты IgG1, однако значительно сниженную ADCC-активность, которая наиболее напоминала активность mAb 9B12 мыши. Таким образом, гуманизированные варианты проявляли аффинность связывания с клетками и in vitro активность, сопоставимые с исходным mAb 9B12 мыши. Аминокислотные различия вариантов гуманизированных VH, все из которых спаривали с гуманизированной VL, приведены на ФИГ. 1.

[0234] Обратную химеру конструировали для определения характеристик in vivo у макак-резусов. Вкратце, VH и VL гуманизированного mAb24 прививали на константные области тяжелой и легкой цепей 9B12 мыши. In vitro характеристики указывали на то, что Fab-части обратной химеры связывались с OX40 человека, сопоставимо с mAb24.

ПРИМЕР 2. Характеристики аффинности связывания и занятости рецепторов у OX40mAb24 в отношении нативного OX40, экспрессируемого на поверхности активированных Т-клеток человека, отличного от человека примата, крысы и мыши

2.1. МАТЕРИАЛЫ

[0235] Материалы, применяемые в данном примере, перечислены в таблице 2-1.

Таблица 2-1. Материалы

Наименование Источник
Антитело козы к IgG (H+L) человека, меченное AlexaFluor® A488 Life Technologies, Карлсбад, Калифорния
Антитело козы к IgG (H+L) мыши, меченное AlexaFluor® A488 Life Technologies, Карлсбад, Калифорния
Антитело козы к IgG (H+L) крысы, меченное AlexaFluor® A488 Life Technologies, Карлсбад, Калифорния
Раствор антибиотиков/противогрибковых средств, 100X Life Technologies, Карлсбад, Калифорния
Антитело к CD134 крысы (клон OX40) Biolegend, Сан-Хосе, Калифорния
Антитело к CD3 крысы BD Biosciences, Сан-Хосе, Калифорния
Антитело к CD134 мыши (клон OX86) MedImmune, Гейтерсберг, Мэриленд
mAb изотипического контроля для IgG1, κ крысы, клон RTK2071 Biolegend, Сан-Хосе, Калифорния
Мышь Balb/C Harlan, Индианаполис, Индиана
Бета-меркаптоэтанол (BME) Life Technologies, Карлсбад, Калифорния
Конканавалин A Sigma, Сент-Луис, Миссури
Этилендиаминтетрауксусная кислота (EDTA) Life Technologies, Карлсбад, Калифорния
Термоинактивированная сыворотка новорожденных телят (FBS) Life Technologies, Карлсбад, Калифорния
Антитело хомячка к CD3 мыши BD Biosciences, Сан-Хосе, Калифорния
Антитело хомячка к CD28 мыши BD Biosciences, Сан-Хосе, Калифорния
IL-2, рекомбинантный человеческий Preprotech, Роки-Хилл, Нью-Джерси
Среда для фракционирования лимфоцитов (LSM) MP Biomedicals, Санта-Ана, Калифорния
Набор для выделения CD4 T-клеток крысы Magcellect R&D Systems, Миннеаполис, Миннесота
Буфер MACS от Miltenyi Miltenyi, Сан-Диего, Калифорния
Набор для выделения CD4 T-клеток мыши Miltenyi, Сан-Диего, Калифорния
mAb изотипического контроля для IgG1, κ мыши, клон MOPC-21 Biolegend, Сан-Хосе, Калифорния
Набор для выделения CD4 T-клеток отличного от человека примата Miltenyi, Сан-Диего, Калифорния
96-луночные планшеты с круглодонными лунками, не обработанные для TC VWR, Раднор, Пенсильвания
Percoll Sigma, Сент-Луис, Миссури
Фитогемагглютинин-лейкоагглютинин (PHA-L) Roche Applied Science, Индианаполис, Индиана
Фосфатно-солевой буферный раствор, pH 7,2 (PBS) Life Technologies, Карлсбад, Калифорния
Набор для обогащения CD4 T-клеток RosetteSep Stem Cell Technologies, Ванкувер, Британская Колумбия
RPMI-1640 Life Technologies, Карлсбад, Калифорния
Крыса Sprague Dawley Harlan, Индианаполис, Индиана
Цельная кровь, антикоагулированная гепарином натрия Программа донорства крови MedImmune, Гейтерсберг, Мэриленд

[0236] В этом примере клеточные анализы равновесного связывания выполняли для измерения кажущейся аффиности связывания OX40mAb24 с OX40, экспрессируемым на клеточной поверхности Т-клеток человека, отличного от человека примата, крысы и мыши. Кроме того, анализы равновесного связывания использовали для определения концентраций OX40mAb24, которые обеспечивают 20%, 50% или 90% занятость рецепторов OX40 человека на активированных CD4+ T-клетках.

[0237] Аналогично OX40mAb24 также определяли концентрации, требуемые для обеспечения 20%, 50% или 90% занятости рецепторов, для связывания 9B12, моноклонального антитела мыши к OX40 человека, от которого происходит OX40mAb24, с OX40 человека и OX40 отличного от человека примата, экспрессируемых на поверхности CD4+ T-клеток, для сравнения связывания OX40mAb24 и 9B12.

2.2. Анализы

2.2.1. Связывание OX40mAb24 с первичными CD4+ T-клетками человека и экспрессирующими OX40 Т-клетками Jurkat

[0238] Кажущуюся константу равновесного связывания (Kd) для связывания OX40mAb24 с OX40 человека, а также концентрации, требуемые для связывания 20%, 50% или 90% рецептора клеточной поверхности OX40 человека в равновесном состоянии, рассчитывали на основании кривых связывания OX40mAb24 с экспрессирующими OX40 активированными первичными CD4+ T-клетками человека или сверхэкспрессирующими OX40 человека Т-клетками Jurkat. Аналогичные эксперименты выполняли в то же самое время для оценки связывания 9B12 с этими клетками, чтобы провести сравнение со значениями для OX40mAb24.

[0239] Первичные CD4+ T-клетки человека сначала выделяли из антикоагулированной гепарином натрия цельной крови, полученной от здоровых доноров в рамках программы донорства крови MedImmune, с применением набора для обогащения CD4+ T-клеток RosetteSep (Stem Cell Technologies, Ванкувер, Британская Колумбия) и модифицированного протокола производителя.

[0240] Первичные CD4+ T-клетки человека культивировали в течение 48 часов с 2 мкг/мл PHA-L и 20 МЕ/мл rhIL-2 для активации T-клеток и повышения экспрессии OX40. Активированные T-клетки, которые характеризовались жизнеспособность >95%, затем применяли в экспериментах по связыванию OX40mAb24. Все доноры представляли собой уникальных индивидуумов; иными словами, повторные эксперименты по связыванию не проводили с CD4+ T-клетками от одного и того же донора.

[0241] Сверхэкспрессирующие OX40 человека клетки Jurkat с NFκB-люциферазой, клон 64, до проведения экспериментов по связыванию культивировали в полной RPMI +10% FBS, без необходимости в активации.

[0242] OX40mAb24 (10 мкг/мл) или 9B12 (10 мкг/мл) разбавляли в виде серии из 2-кратных разбавлений в количестве 17 точек. OX40mAb24 добавляли к 100000 клеткам (активированным первичным CD4+ T-клеткам или сверхэкспрессирующим OX40 человека клеткам Jurkat с NFkB-люциферазой, клон 64) на лунку и инкубировали в течение одного часа при 4°C. Для вычитания фонового связывания клетки инкубировали в присутствии только вторичного антитела. Контрольное моноклональное антитело для IgG1 человека, R347, и изотипический клон MOPC-21 для IgG1 мыши применяли в экспериментах со сверхэкспрессирующими OX40 Т-клетками Jurkat для демонстрации специфичности связывания OX40 антителами OX40mAb24 или 9B12 соответственно. После инкубации клетки трижды промывали с помощью 200 мкл холодного (4°C) буфера FACS и инкубировали с 100 мкл буфера FACS (PBS+2% термоинактивированной сыворотки новорожденных телят), содержащего 10 мкг/мл вторичного антитела козы к IgG человека, меченного AlexaFluor® 647 (для связывания с OX40mAb24), или 10 мкг/мл вторичного антитела козы к IgG мыши, меченного AlexaFluor® 488 (для связывания с 9B12), и 5 мкг/мл пропидиума йодида (PI). После инкубации с вторичным антителом клетки промывали и суспендировали в 100 мкл буфера FACS для анализа методом проточной цитометрии на проточном цитометре BD LSRII, как описано ниже.

2.2.2. Связывание OX40mAb24 с CD4+ T-клетками мыши

[0243] OX40mAb24 исследовали в отношении связывания с OX40 мыши, экспрессируемым на активированных первичных CD4+ T-клетках. Аналогичные эксперименты выполняли в то же самое время для оценки связывания 9B12 с этими клетками, чтобы провести сравнение с OX40mAb24. CD4+ Т-клетки мыши выделяли из собранных селезенок нормальных мышей Balb/C в соответствии со следующим протоколом.

[0244] Селезенки разминали, прижимая к нейлоновому фильтру на 70 мкм, для высвобождения спленоцитов и фильтр промывали с помощью 1 мл полной среды (RPMI-1640 с 10% FBS, 1% раствором антибиотиков/противогрибковых средств и 55 мкМ бета-меркаптоэтанола [BME]). Спленоциты осаждали и супернатант удаляли. Осадок обрабатывали с помощью 5 мл IX буфера для лизиса эритроцитов (RBC) и инкубировали для лизирования RBC. Осмолярность восстанавливали добавлением полной среды по окончанию времени инкубации.

[0245] Клетки осаждали, промывали в буфере MACS Miltenyi (PBS, pH 7,2+0,5% бычьего сывороточного альбумина (BSA)+2 мМ этилендиаминтетрауксусная кислота [EDTA]) и супернатант удаляли. Осадок суспендировали в холодном буфере MACS и проводили подсчет с помощью счетчика ViCell для определения количества и жизнеспособности клеток.

[0246] Выделение CD4+ T-клеток мыши выполняли с помощью набора для обработки Miltenyi (Сан-Диего, Калифорния) в соответствии с инструкциями производителя и выделенные клетки суспендировали в полной среде.

[0247] CD4+ T-клетки мыши (150000 на лунку в 100 мкл полной среды) культивировали в течение ночи в 96-луночных планшетах, которые покрывали антителом хомячка к CD3 мыши и антителом хомячка к CD28 мыши при концентрации каждого 2 мкг/мл для активации T-клеток и индукции экспрессии OX40. Активированные CD4+ T-клетки отбирали из планшета для инкубации и по 100000 клеток переносили в каждую лунку 96-луночного планшета с круглодонными лунками, не обработанного для культур тканей, чтобы провести анализы связывания, и промывали один раз буфером FACS. Связывание выполняли с применением 10 мкг/мл OX40mAb24, 9B12 и антител крысы к OX40 мыши, клон OX86 (положительный контроль), для каждого из которых готовили 3-кратные серийные разбавления в буфере FACS, чтобы получить кривую на основании 10 экспериментальных точек. Для отрицательных контролей из 10 мкг/мл IgG1 человека, R347, IgG1 мыши, MOPC-21, или IgG1 крысы, RTK2071, готовили 6-кратные разбавления, чтобы получить кривую на основании 3 экспериментальных точек. Буфер FACS (50 мкл), содержащий OX40mAb24 или антитела, добавляли к CD4+ T-клеткам в двух повторностях и инкубировали. После инкубации с первичными антителами клетки промывали с помощью 200 мкл буфера FACS при 4°C и инкубировали с 50 мкл буфера FACS, содержащего 10 мкг/мл вторичного антитела козы к антителу человека, меченного AlexaFluor® 488, 10 мкг/мл вторичного антитела козы к антителу мыши, меченного AlexaFluor® 488, или вторичного антитела козы к антителу крысы, меченого AlexaFluor® 488, и 5 мкг/мл PI. После инкубации с вторичными антителами клетки промывали буфером FACS при 4°C (200 мкл на промывку) и суспендировали в 100 мкл буфера FACS для анализа методом проточной цитометрии на проточном цитометре BD LSRII, как описано в разделе 2.3.

2.2.3. Связывание OX40mAb24 с CD4+ T-клетками крысы

[0248] OX40mAb24 исследовали в отношении связывания с OX40 крысы, экспрессируемым на активированных первичных CD4+ T-клетках. Аналогичные эксперименты выполняли в то же самое время с 9B12, чтобы обеспечить сравнение с OX40mAb24. CD4+ клетки крысы выделяли из свежесобранных селезенок нормальных крыс Sprague-Dawley в соответствии с протоколом, описанным выше для выделения спленоцитов мыши, за исключением того, что выделение CD4+ T-клеток крысы выполняли с помощью набора R&D Systems Magellect (Миннеаполис, Миннесота) согласно инструкциям производителя.

[0249] CD4+ T-клетки крысы (1×106 на мл полной среды) культивировали в течение ночи во флаконе для культур клеток T75 с 1 мкг/мл конканавалина A (Con A) и 500 МЕ/мл IL-2 для активации T-клеток и индукции экспрессии OX40 и инкубировали в течение ночи. Активированные CD4+ T-клетки отбирали из флакона и по 100000 клеток переносили в каждую лунку 96-луночного планшета с круглодонными лунками, не обработанного для культуры ткани, чтобы провести анализы связывания, и промывали буфером FACS. Связывание выполняли с применением 10 мкг/мл OX40mAb24, 9B12 или антитела мыши к CD134 крысы, клон OX40 (положительный контроль), для которых готовили 3-кратные серийные разбавления в буфере FACS, чтобы получить кривую на основании 10 экспериментальных точек. Для отрицательных контролей из 10 мкг/мл IgG1 человека, R347, или IgG1 мыши, клон MOPC-21, готовили 6-кратные серийные разбавления, чтобы получить кривую на основании 3 экспериментальных точек. 100 мкл OX40mAb24, контрольного белка, 9B12 или антитела клона OX40 добавляли к CD4+ T-клеткам в двойных повторностях и инкубировали. После инкубации с первичными антителами клетки промывали с помощью буфера FACS при 4°C объемом 200 мкл на промывку и инкубировали с 100 мкл буфера FACS, содержащего 10 мкг/мл вторичного антитела козы и человека, меченного AlexaFluor® 488, или вторичного антитела козы к антителу мыши, меченного AlexaFluor® 488, и 5 мкг/мл PI. После инкубации с вторичными антителами клетки обрабатывали для проточной цитометрии, как описано в разделе 2.3.

2.2.4. Связывание OX40mAb24 с CD4+ T-клетками макака-крабоеда

[0250] OX40mAb24 исследовали в отношении связывания с OX40 макака-крабоеда (cyno), экспрессируемым на активированных первичных CD4+ T-клетках. Аналогичные эксперименты выполняли в то же самое время с 9B12, чтобы обеспечить сравнение со значениями для OX40mAb24. CD4+ T-клетки макака-крабоеда выделяли из антикоагулированной гепарином натрия цельной крови, полученной от здоровых доноров макаков-крабоедов (N=2) из World Wide Primates (Майами, Флорида) в соответствии со следующим протоколом.

[0251] Цельную кровь наслаивали поверх 30 мл 60% Percoll в 50 мл конической центрифужной пробирке. Кровь центрифугировали при 1200 об./мин. в течение 10 минут и мононуклеарные клетки периферической крови (PBMC) собирали на поверхности раздела и промывали холодным (4°C) буфером MACS Miltenyi. Супернатант удаляли и осадок обрабатывали с помощью 5 мл 1X буфера для лизиса эритроцитов и инкубировали. Полную среду (RPMI с 10% FBS и 1% раствора антибиотиков/противогрибковых средств) добавляли к осадку для остановки процесса лизиса по окончанию времени инкубации.

[0252] Клетки осаждали и промывали с помощью 20 мл холодного (4°C) буфера MACS Miltenyi. Супернатант удаляли и клеточный осадок суспендировали в холодном (4°C) буфере MACS и проводили подсчет с помощью счетчика ViCell для определения количества и жизнеспособности клеток.

[0253] Выделение CD4+ T-клеток макака-крабоеда выполняли с помощью набора Miltenyi для отличных от человека приматов в соответствии с инструкциями производителя, затем проводили подсчет CD4+ T-клеток на счетчике ViCell и их суспендировали при концентрации 1×106 на мл в полной среде, как описано выше.

[0254] CD4+ T-клетки макака-крабоеда (1×106 на мл полной среды) инкубировали в течение 48 часов во флаконе для культур клеток T75 с 2 мкг/мл PHA-L и 20 МЕ/мл IL-2 для активации T-клеток и индукции экспрессии OX40. Активированные CD4+ T-клетки отбирали из колбы и по 100000 клеток переносили в каждую лунку 96-луночного планшета с круглодонными лунками, не обработанного для культуры ткани, чтобы провести анализы связывания, и промывали 200 мкл буфера FACS. Связывание выполняли с применением 10 мкг/мл OX40mAb24 или 9B12, для которых готовили 4-кратные серийные разбавления в буфере FACS, чтобы получить кривую на основании 11 экспериментальных точек, или обоих IgG1 человека, R347, или IgG1 мыши, клон MOPC-21 (отрицательные контроли), для которых готовили 6-кратные серийные разбавления, чтобы получить кривую на основании 3 экспериментальных точек. OX40mAb24, 9B12 или контрольный белок добавляли к CD4+ T-клеткам и инкубировали. После инкубации с первичными антителами клетки промывали с помощью холодного (4°C) буфера FACS объемом 200 мкл на промывку и инкубировали с 100 мкл буфера FACS, содержащего 10 мкг/мл вторичного антитела козы к антителу человека, меченного AlexaFluor® 488, или 10 мкг/мл вторичного антитела козы к антителу мыши, меченного AlexaFluor® 488, и 5 мкг/мл PI. После инкубации с вторичными антителами клетки обрабатывали для проточной цитометрии, как описано в разделе 2.3.

2.2.5. Связывание OX40mAb24 с CD4+ T-клетками макака-резуса

[0255] OX40mAb24 исследовали в отношении связывания с OX40 макака-резуса, экспрессируемым на активированных первичных CD4+ T-клетках. Аналогичные эксперименты выполняли в то же самое время с 9B12, чтобы обеспечить сравнение со значениями для OX40mAb24. CD4+ T-клетки макака-резуса выделяли из антикоагулированной гепарином натрия цельной крови, полученной от здоровых доноров макаков-резусов (N=2) из World Wide Primates (Майами, Флорида) в соответствии со следующим протоколом.

[0256] Гепаризированную кровь макаков-резусов (20 мл) разбавляли 1:1 с помощью PBS и наслаивали поверх 15 мл 95% LSM в 50 мл конической центрифужной пробирке. Кровь центрифугировали при 400 x g в течение 30 минут, PBMC собирали на поверхности раздела и дважды промывали холодным буфером MACS Miltenyi. Супернатант удаляли и осадок обрабатывали с помощью 5 мл 1X буфера для лизиса эритроцитов и инкубировали. Полную среду (RPMI с 10% FBS и 1% раствора антибиотиков/противогрибковых средств) добавляли к осадку для остановки процесса лизиса по окончанию времени инкубации. Клетки осаждали и промывали с помощью 20 мл холодного буфера MACS Miltenyi. Супернатант удаляли и осадок суспендировали в холодном буфере MACS и проводили подсчет с помощью счетчика ViCell для определения количества и жизнеспособности клеток. Выделение CD4+ T-клеток макака-резуса выполняли с помощью набора Miltenyi для отличных от человека приматов (Сан-Диего, Калифорния) в соответствии с инструкциями производителя.

[0257] CD4+ T-клетки макака-резуса (1×106 на мл полной среды) культивировали в течение 48 часов во флаконе для культур клеток T75 с 5 мкг/мл Con-A и 1000 МЕ/мл IL-2 для активации T-клеток и индукции экспрессии OX40. Связывание с 100000 активированных CD4+ T-клеток макака-резуса выполняли с применением 10 мкг/мл OX40mAb24 и 9B12, для которых готовили 3-кратные серийные разбавления в буфере FACS, чтобы получить кривую на основании 10 экспериментальных точек (эксперимент 1) или кривую на основании 12 экспериментальных точек (эксперимент 2), и 10 мкг/мл изотипических контролей для человека и мыши, для которых готовили 6-кратные разбавления, чтобы получить 2 экспериментальные точки (эксперимент 1) или 4 экспериментальные точки (эксперимент 2). Связывание вторичного антитела козы к антителу человека, меченного AlexaFluor® 488, и вторичного антитела козы к антителу мыши, меченого AlexaFluor® 488, выполняли как описано выше для CD4+ T-клеток макака-крабоеда, а проточную цитометрию выполняли как описано в разделе 2.3.

2.3. Проточная цитометрия

[0258] Проточную цитометрию в анализах, описанных в разделе 2.1, выполняли с применением проточного цитометра LSRII (Becton-Dickinson, Сан-Хосе, Калифорния). Программное обеспечение для цитометрического анализа Flow Jo (TreeStar, Ашланд, Орегон) применяли для определения связывания с клетками OX40mAb24, 9B12 и контрольного белка. Лунки, содержащие экспрессирующие OX40 клетки (неокрашенные, без PI или вторичного антитела), клетки, связанные только с реактивом на основе вторичных антител, меченных AlexaFluor® 488 или меченных AlexaFluor® 647, или клетки, пермеабилизированные 0,1% раствором сапонина и обработанные с помощью 10 мкг/мл PI, готовили для компенсаторных контролей, окрашенных одним красителем. После компенсации флуоресценции гейтировали живые (PI-отрицательные) клетки и определяли среднюю интенсивность флуоресценции (MFI) вторичного антитела.

2.4. Расчеты

2.4.1. Определение кажущейся равновесной константы диссоциации (Kd)

[0259] GraphPad Prism, версии 5.01 для Windows, от GraphPad Software, Сан-Диего, Калифорния, США, www.graphpad.com, применяли для построения графика MFI связывания OX40mAb24 в зависимости от концентрации белка (M) дляполучения кривых связывания, из которых определяли кажущуюся Kd. Для определения кажущейся Kd связывания OX40mAb24 и 9B12 с OX40 человека, мыши, крысы, макака-крабоеда или макака-резуса использовали уравнение нелинейной регрессии (подбор кривой) для связывания с одним сайтом (специфического).

2.4.2. Определение значений 20%, 50% и 90% занятости рецепторов

[0260] Количество моноклонального антитела (mAb), связанного со своим рецептором, можно оценить исходя из следующей формулы связывания.

Уравнение 1: Рецептор (A)+mAb (B) ↔ комплекс рецептор-mAb (AB)

[0261] Константа диссоциации связывания (Kd) для соответствующего антитела представлена с помощью следующего:

Уравнение 2:

где [A] и [B] представляют концентрации свободного рецептора и антитела соответственно.

Наконец, долю занятости, доля (F) всех молекул рецептора, которые связаны с антителом, можно рассчитать с помощью следующего:

Уравнение 3:

Преобразование уравнения 2 и его подстановка в уравнение 3 приводит к следующему:

Уравнение 4:

Упрощение уравнения 4 приводит к следующему:

Уравнение 5:

Таким образом, в состоянии равновесия можно рассчитать долю всех молекул рецептора, которые связаны с антителом, если известна концентрация свободного mAb и константа диссоциации Kd соответствующего антитела.

Дифференцирование данной формулы для расчета концентрации антитела, требуемой для оценки доли занятости рецепторов, выраженной в виде F, приводит к следующей формуле:

Уравнение 6:

где [B] равняется концентрации mAb, в данном случае OX40mAb24. Эту формулу (уравнение 6) применяли для расчета концентраций OX40mAb24, требуемых для 20, 50 и 90% занятости рецепторов (F=0,20, 0,50 или 0,90), исходя из экспериментов по связыванию, на основании которых рассчитывали значение Kd с применением уравнения нелинейной регрессии (подбор кривой) для связывания с одним сайтом (специфического), как описано выше.

2.5. Статистические методы

[0262] 2-сторонний критерий Стьюдента для независимых выборок с 95% доверительным интервалом и поправкой Уэлча, чтобы учесть наборы данных с различными стандартными отклонениями, использовали в программном обеспечении Graphpad Prism для определения статистически значимых различий между значениями кажущейся Kd или значениями кажущейся занятости рецепторов, определенными для связывания OX40mAb24 с OX40 на активированных первичных CD4 T-клетках человека в сравнении с экспрессирующими OX40 Т-клетками Jurkat. Описательные статистики (т. е., среднее и стандартная ошибка среднего) представлены в итоговых фигурах и таблицах.

2.6. РЕЗУЛЬТАТЫ

2.6.1. Связывание OX40mAb24 с первичными CD4+ T-клетками человека

[0263] OX40mAb24 связывалось с активированными CD4+ T-клетками человека со средним значением кажущейся Kd 312 пМ и значениями 20%, 50% и 90% занятости рецепторов 78,1, 312 и 2810 пМ соответственно; n=6 анализов связывания с шестью независимыми донорами T-клеток (фигуры 2A и 2B и таблица 2-2).

[0264] Для сравнения, 9B12 связывалось с активированными CD4+ T-клетками человека со средним значением Kd 669 пМ и значениями 20%, 50% и 90% занятости рецепторов 167, 669 и 6020 пМ соответственно (фигуры 2C и 2D и таблица 2-2). Таким образом, отношение значений кажущейся Kd для 9B12 и OX40mAb24 составило 2,1 к 1 и это отражает аналогичную аффинность связывания с OX40 человека у мышиных и гуманизированных моноклональных антител.

Таблица 2-2. Значения кажущейся аффинности (Kd) и занятости рецепторов при связывании OX40mAb24 или 9B12 с экспрессирующими OX40 активированными первичными CD4+ T-клетками человека

Связывающий
белок
Число
доноров
Kd (StdErr),
пM
EC20 (StdErr),
пM
EC50 (StdErr),
пM
EC90 (StdErr),
пM
OX40mAb24 6 312 (57,9) 78,1 (14,5) 312 (57,9) 2810 (521)
9B12 6 669 (137) 167 (34,3) 669 (137) 6020 (1230)

EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; Kd=константа диссоциации при равновесном связывании; StdErr=стандартная ошибка среднего.

2.6.2. Связывание OX40mAb24 с линией Т-клеток Jurkat, сконструированной для сверхэкспрессии OX40 человека

[0265] OX40mAb24 связалось с экспрессирующими OX40 T-клетками Jurkat со средним значением Kd 424 пМ и значениями 20%, 50% и 90% занятости рецепторов 106, 424 и 3820 пМ соответственно (фигуры 3A-C и таблица 2-3). Отсутствовали статистически значимые различия значений кажущейся аффиности связывания или занятости рецепторов у OX40mAb24 в отношении OX40, экспрессируемого активированными первичными CD4+ T-клетками человека и сверхэкспрессирующими OX40 Т-клетками Jurkat (p=0,59).

[0266] Для сравнения, 9B12 связывалось с этими клетками со средним значением Kd 726 пМ и значениями 20%, 50% и 90% занятости рецепторов 182, 726 и 6540 пМ соответственно (фигуры 3D-F и таблица 2-3). Следовательно, отношение значений кажущейся Kd для 9B12 и OX40mAb24 составляло 1,7 к 1, что было аналогично отношению, рассчитанному для связывания с OX40 на активированных CD4+ T-клетках человека.

Таблица 2-3. Значения кажущейся аффинности (Kd) и занятости рецепторов при связывании OX40mAb24 или 9B12 со сверхэкспрессирующими OX40 человека клетками Jurkat с NFkB-люциферазой, клон 64

Связывающий
белок
Число
экспериментов
Kd (StdErr),
пM
EC20 (StdErr),
пM
EC50 (StdErr),
пM
EC90 (StdErr),
пM
OX40mAb24 3 424 (173) 106 (43,3) 424 (173) 3820 (1560)
9B12 3 726 (308) 182 (76,9) 726 (308) 6540 (2770)

EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; Kd=константа диссоциации при равновесном связывании; StdErr=стандартная ошибка среднего.

2.6.3. Связывание OX40mAb24 с CD4+ T-клетками мыши или крысы

[0267] Ни OX40mAb24, ни 9B12 не связывались с активированными CD4+ T-клетками мыши или крысы (данные не представлены). Положительное окрашивание активированных CD4+ T-клеток мыши или крысы наблюдали при применении коммерческих антител к OX40 мыши или крысы, клоны OX86 и OX40 соответственно. 9B12 не связывало активированные CD4+ T-клетки мыши или крысы (данные не представлены).

2.6.4. Связывание OX40mAb24 с CD4+ T-клетками макака-крабоеда или макака-резуса

[0268] OX40mAb24 связывалось с активированными клетками макака-крабоеда со средним значением Kd 581 пМ. Kd в отношении молекул макака-крабоеда в 1,9 превышала Kd в отношении молекул человека (таблица 2-4).

[0269] 9B12 связывалось с активированными CD4+ T-клетками макака-крабоеда со средним значением Kd 1088 пМ (таблица 2-4), что давало отношение значений кажущейся Kd у 9B12 и OX40mAb24, составляющее 1,9 к 1.

[0270] OX40mAb24 связывалось с активированными CD4+ T-клетками макака-резуса со средним значением Kd 369 пМ (таблица 2-4). Kd в отношении молекул макака-резуса в 1,2 раза превышала Kd в отношении молекул человека.

[0271] 9B12 связывалось с активированными CD4+ T-клетками макака-резуса со средним значением Kd 713 пМ (таблица 2-4), что давало отношение значений кажущейся Kd у 9B12 и OX40mAb24, составляющее 2,8 к 1.

Таблица 2-4. Кажущаяся аффинность (Kd) связывания OX40mAb24 или 9B12 с активированными экспрессирующими OX40 первичными CD4+ T-клетками макака-крабоеда и макака-резуса

Макак-крабоед Макак-резус
Связывающий белок Число экспериментов Kd (StdErr),
пM
Число экспериментов Kd (StdErr),
пM
OX40mAb24 2 581 (238) 2 369 (236)
9B12 2 1088 (37) 2 713 (559)

Kd=константа диссоциации при равновесном связывании; StdErr=стандартная ошибка среднего.

ПРИМЕР 3. Специфичность связывания OX40mAb24 с OX40 человека

[0272] В данном примере анализы связывания клеток на основе проточной цитометрии выполняли с целью определения специфичности OX40mAb24 в отношении OX40 человека по сравнению к другим представителями TNFRSF человека с родственными аминокислотными последовательностями, которые включали: NGFR (TNFRSF16), LTßR (TNFRSF3), TNFR2 (TNFRSF1ß), GITR (TNFRSF18), CD137 (TNFRSF9) и HVEM (TNFRSF14). Кроме того, специфичность связывания OX40mAb24 с рекомбинантными представителями TNFRSF человека, которые включали упомянутые выше, а также DR6 (TNFRSF21), остеопротегерин (OPG; TNFRSF11B), RANK (TNFRSF11A), FAS (TNFRSF6) и CD40 (TNFRSF5), исследовали в формате ELISA.

3.1. Материалы

[0273] Материалы, применяемые в данном исследовании, перечислены в таблице 3-1.

Таблица 3-1. Материалы

Наименование Источник
Антитело козы к IgG человека (H+L), меченное AlexaFluor® 647 Life Technologies, Карлсбад, Калифорния
Устройство для промывки планшетов BioTek® BioTek®, Винуски, Вермонт
Вектор экспрессии CD137 (TNFRSF9) pCMV6-XL5 Origene Technologies, Inc., Роквилл, Мэриленд
Вектор экспрессии GITR (TNFRSF18) pCMV6-XL5 Origene Technologies, Inc., Роквилл, Мэриленд
Конъюгат антитела козы к легкой каппа-цепи IgG человека с HRP Sigma-Aldrich, Сент-Луис, Миссури
Конъюгат антитела козы к IgG мыши (Fab-специфический) с HRP Sigma-Aldrich, Сент-Луис, Миссури
Вектор экспрессии HVEN (TNFRSF14) pCMV6-XL4 Origene Technologies, Inc., Роквилл, Мэриленд
Lipofectamine 2000 Life Technologies, Карлсбад, Калифорния
Антитело изотипического контроля для IgG1 мыши c AF488 Biolegend, Сан-Диего, Калифорния
Антитело к GITR человека с AF488 Ebioscience, Сан-Диего, Калифорния
Антитело к NGFR человека с AF647 BD, Сан-Хосе, Калифорния
Антитело к CD137 человека с APC BD, Сан-Хосе, Калифорния
Антитело изотипического контроля для IgG1 мыши с APC Biolegend, Сан-Диего, Калифорния
Программное обеспечение Clone Manager v9 Sci-Ed Software, Кэри, Северная Каролина
Фетальная бычья сыворотка (FBS), термоинактивированная Life Technologies, Карлсбад, Калифорния
Вектор экспрессии LTßR (TNFRSF3) pCMV6-XI.4 Origene Technologies, Inc., Роквилл, Мэриленд
96-луночный планшет с плоскодонными лунками MaxiSorp VWR, Раднор, Пенсильвания
Сыворотка новорожденных телят, термоинактивированная Life Technologies, Карлсбад, Калифорния
Вектор экспрессии NGFR (TNFRSF16) pCMV6-XL5 Origene Technologies, Inc., Роквилл, Мэриленд
Антитело к HVEM человека с PE Ebioscience, Сан-Диего, Калифорния
Антитело к LtßR человека с PE R&D systems, Миннеаполис, Миннесота
Антитело к TNFRSF 1B человека с PE BD, Сан-Хосе, Калифорния
Антитело изотипического контроля для IgG1 мыши с PE Biolegend, Сан-Диего, Калифорния
Антитело изотипического контроля для антител крысы с PE Ebioscience, Сан-Диего, Калифорния
PBS, pH 7,2, без кальция и магния Life Technologies, Карлсбад, Калифорния
Рекомбинантный TNFRSF1ß человека (TNFRII) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF3 человека (LTßR) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF4 человека (OX40) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF5 человека (CD40) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF6 человека (FAS) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF9 человека (CD137) Белок, полученный в собственной лаборатории; партия № AMPur19
Рекомбинантный TNFRSF11A человека (RANK) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF11B человека (OPG) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF14 человека (HVEM) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF16 человека (NGFR) R&D systems, Миннеаполис, Миннесота
Рекомбинантный TNFRSF18 человека (GITR) Белок, полученный в собственной лаборатории; партия № LBPur0025
Рекомбинантный TNFRSF21 человека (DR6) R&D systems, Миннеаполис, Миннесота
Вектор экспрессии TNFRSF1ß pCMV6-XL5 Origene Technologies, Inc., Роквилл, Мэриленд
Tween-20 Sigma-Aldrich, Сент-Луис, Миссури

3.2. Методы

3.2.1. Поиск белков с близкой гомологией последовательностей с OX40 человека

[0274] Для выявления белков человека, аминокислотные последовательности которых идентичны OX40 человека, проводили поиск гомологичных последовательностей белка при помощи средства поиска основного локального выравнивания (BLASTP) с применением последовательности белка OX40 (CCDS 11/UniProt P43489). Были выявлены девятнадцать представителей/изоформ семейства TNFRSF. Полноразмерные последовательности этих белков проверяли с применением баз данных CCDS и UniProt (www.uniprot.org). Программное обеспечение Clone Manager, версия 9, применяли для выполнения выравнивания сборок с эталоном OX40 человека с применением матрицы замен Blosum62, чтобы определить процентную долю аминокислотной идентичности между OX40 человека и белками, выявленными в поиске BLASTP (таблица 3-2).

3.2.2. Специфичность связывания OX40mAb24 с OX40 по сравнению с другими представителями TNFRSF, экспрессируемым в клетках HEK293

[0275] кДНК-конструкции, способные управлять экспрессией отдельных представителей TNFRSF после трансфекции в клетки млекопитающих, получали от Origene Technologies, Роквилл, Мэриленд. Эти кДНК-конструкции амплифицировала и очищала группа Protein Sciences в MedImmune, Гейтерсберг, Мэриленд, для применения в транзиентных трансфекциях. Для изучения индивидуальной экспрессии каждого из представителей TNFRSF клетки HEK293 трансфицировали с применением Lipofectamine 2000 (Life Technologies, Карлсбад, Калифорния) в комбинации с 0,5 мкг ДНК вектора экспрессии, кодирующего одного представителя TNFRSF в соответствии с предложенным производителем протоколом для Lipofectamine 2000. Через сорок восемь часов после трансфекции клетки отбирали из планшетов с культурой тканей путем обработки трипсином. Трипсин нейтрализовали добавлением содержащей сыворотку полной среды RPMI-1640 (с 10% FBS), с последующим осаждением клеток центрифугированием и промывками в полной среде. Затем клетки суспендировали в холодном буфере FACS (PBS+2% FBS) и высевали на 96-луночные планшеты, не обработанные для культур ткани, чтобы провести исследования связывания с mAb, специфическими в отношении представителей TNFRSF (таблица 3-3), и OX40mAb24.

[0276] Для проведения связывания антител или OX40mAb24 клетки HEK осаждали, удаляли буфер FACS и клетки суспендировали в буфере FACS, содержащем 2 мкг/мл пропидиума йодида (PI) и либо меченное флуорохромом mAb, специфическое в отношении трансфицированного представителя TNFRSF, в рекомендуемой производителем концентрации, либо OX40mAb24 в концентрации 1 мкг/мл. Для контролей связывания клетки инкубировали отдельно с антителами изотипического контроля, меченными флуорохромом. Клетки инкубировали с антителами в течение 1 часа при 4°C в темноте. После этого клетки, которые инкубировали с меченными флуорохромом моноклональными антителами, промывали в холодном буфере FACS, а затем связавшиеся объекты собирали и анализировали при помощи проточной цитометрии с применением проточного цитометра LSRII (BD Biosciences, Сан-Хосе, Калифорния) и программного обеспечения FlowJo, как описано в разделе 3.2.3. Клетки, которые инкубировали с OX40mAb24, промывали в охлажденном на льду буфере FACS и затем суспендировали с добавлением 25 мкг/мл вторичных антител козы к IgG (H+L) человека, меченных Alexa Fluor® 647, и инкубировали в течение дополнительных 30 минут при 4°C в темноте. Для контроля связывания вторичного антитела клетки инкубировали в отсутствие OX40mAb24, но в присутствии только меченного флуорохромом вторичного антитела. После этого клетки промывали и суспендировали в холодном буфере FACS для анализа на проточном цитометре LSRII.

3.2.3. Анализ методом проточной цитометрии

[0277] Данные стандартного формата проточной цитометрии (FCS) изучали с применением программного обеспечения FlowJo (Ашланд, Орегон). Чтобы проанализировать связывание mAb, клетки сначала гейтировали по жизнеспособным (PI-отрицательным) клеткам, а затем среднюю интенсивность флуоресценции (MFI) объектов откладывали на графике в зависимости от общего числа клеток для получения гистограмм связывания. Геометрическую MFI всех жизнеспособных клеток определяли для каждого образца так, чтобы можно было определить кратное превышение MFI по сравнению с фоном (только антитело изотипического контроля или вторичное антитело).

3.2.4. ELISA специфичности связывания OX40mAb24

[0278] После разбавления исходного раствора белков до 5 мкг/мл в PBS получали серию двукратных разбавлений для восьми экспериментальных точек для каждого рекомбинантного белка TNFRSF человека. Затем по 50 мкл каждого разбавления антигенов переносили в двух повторностях в лунки 96-луночного планшета с плоскодонными лунками MaxiSorp от Nunc и инкубировали в течение ночи при 4°C, чтобы белки адсорбировались на планшете. После этого планшеты промывали трижды с помощью PBS в устройстве для промывки планшетов BioTek®, чтобы удалить несвязавшиеся белки. mAb29 к OX40, 9B12 и контрольные антитела разбавляли в PBS до конечной концентрации 10 мкг/мл и по 50 мкл mAb добавляли в каждую лунку и инкубировали при комнатной температуре в течение одного часа для связывания mAb со связанным на планшете белком. После этого лунки промывали с помощью PBS/Tween-20 0,1% (объем/объем) при помощи устройства для промывания планшетов BioTek®. Конъюгированные с HRP вторичное антитело козы к антителу человека или вторичное антитело козы к антителу мыши в концентрации 10 мкг/мл добавляли в каждую лунку и инкубировали при комнатной температуре в течение 1 часа. После трех промывок в PBS/Tween-20 0,1% в каждую лунку добавляли по 50 мкл субстрата TMB и инкубировали при комнатной температуре в течение 5 минут, чтобы произошло образование колориметрического продукта. Реакции останавливали добавлением в лунки 50 мкл 0,5 молярной H2SO4, и сразу после этого проводили считывание планшетов при 450 нм с применением планшет-ридера Envision C для выявления колориметрического продукта. Результаты наносили на график с помощью программного обеспечения GraphPad Prism для Windows, версия 5.01, а кривые связывания получали с применением нелинейного регрессионного анализа для связывания одного сайта.

3.3. Результаты

[0279] Путем поиска гомологии белковой последовательности в BLASTP на основе OX40 человека выявили 19 белков или изоформ TNFRSF человека, аминокислотная последовательность которых была на 15-27% идентична последовательности полноразмерного OX40. Белки и их процентные доли идентичности последовательности перечислены в таблице 3-2.

Таблица 3-2. Идентичность аминокислотной последовательности двенадцати представителей TNFRSF с наивысшей гомологией с OX40 человека

Представитель TNFRSF Альтернативные названия % идентичности
с OX40
ID последовательности белка
согласно UniProt
TNFRSF11A RANK, CD265 27 Q9Y6Q6, изотип 2 (дельта 7,8,9)
TNFRSF6B DcR3 25 O95407
TNFRSF18 GITR, AITR 25 Q9Y5U5, изотип 2
TNFRSSF10C DCR1, TRAIL-R3 24 O14798
TNFRSF5 CD40 23 P25942, изотип 2
TNFRSF18 GITR, AITR 23 Q9Y5U5, изотип 3
TNFRSF18 GITR, AITR 23 Q9Y5U5
TNFRSF9 CD137, 4-1BB 22 Q07011
TNFRSF5 CD40 21 P25942
TNFRSF14 TR2, HVEM-A 21 Q92956
TNFRSF16 Рецептор NGF 21 P08138
TNFRSF3 LTßR, TNFRIII 20 P36941
TNFRSF6 Fas 20 P25445, изотип 6, Tmdcl (A)
TNFRSF6 Fas 20 P25445
TNFRSF3 LTßR, TNFRIII 19 P36941, изотип 2
TNFRSF6 Fas 19 P25445, изотип 7, FasExo8Del
TNFRSF11B Остеопротегерин 18 O0030
TNFRSF1B TNFR1b, TNFR2, CD120b 18 P20333
TNFRSF11A RANK, CD265 16 Q9Y6Q6

CCDS=консенсусная кодирующая последовательность; ID=идентификатор; NA=не применимо; TNFRSF=суперсемейство рецепторов фактора некроза опухоли; UniProt - Universal Protein Resource (база данных последовательностей белков).

[0280] Связывание OX40mAb24 с транзиентно трансфицированными клетками HEK293, которые экспрессировали NGFR, LTßR, TNFR2, GITR, CD137 или HVEM человека, оценивали с помощью проточной цитометрии, как описано в разделе 3.1.3 выше. Экспрессию NGFR, LTßR, TNFR2, GITR, CD137 и HVEM человека на клеточной поверхности подтверждали с помощью коммерчески доступных антител, специфических в отношении каждого белка TNFRSF человека; кратное повышение MFI в сравнении с антителами изотипического контроля для каждого белка TNFRSF показано в таблице 3-3. Связывание OX40mAb24 с клетками HEK293, которые экспрессировали NGFR, LTßR, TNFR2, GITR, CD137 или HVEM человека, несущественно превышало наблюдаемое в случае связывания только вторичного антитела с теми же клетками (таблица 3-3, фигура 4A). В отличие от этого, связывание OX40mAb24 с линий клеток Jurkat, которые конститутивно сверхэкспрессировали OX40, в 48 раз, исходя из средней MFI, превышало связывание только меченного флуорохромом вторичного антитела (таблица 3-3 и фигура 4B).

Таблица 3-3. Кратное превышение связывания меченных флуорохромом TNFRSF-специфических моноклональных антител и OX40mAb24 со сверхэкспрессирующими TNFRSF клетками HEK293 или OX40mAb24 со сверхэкспрессирующими OX40 клетками Jurkat

Экспрессируемый
представитель
TNFRSF
Линия клеток, перенесенная
с помощью представителя
TNFRSF
Связывание рецептор-специфического коммерческого
mAb (относительно MFI
антитела изотипического контроля)
Связывание OX40mAb24 (относительно
MFI вторичного антитела
отдельно)
OX40 Jurkat ND 48
TNFRSF16 (NGFR) HEK293 17 2,2
TNFRSF3 (LTßR) HEK293 146 1,0
TNFRSF1ß HEK293 5,0 1,0
TNFRSF18 (GITR) HEK293 37 1,1
TNFRSF9 (CD137) HEK293 24 1,2
TNFRSF14 (HVEM) HEK293 69 1,1

mAb=моноклональное антитело; MFI=средняя интенсивность флуоресценции; ND=не определено; TNFRSF=суперсемейство рецепторов фактора некроза опухоли.

[0281] В формате ELISA связывание антитела, содержащего Fab-область из OX40mAb24, но при этом Fc-домен IgG1, содержащий три аминокислотные модификации (mAb29), было специфическим в отношении OX40 (фигура 5A), что показывает отсутствие специфического связывания выше фонового уровня с рекомбинантным NGFR (TNFRSF16), LTßR (TNFRSF3), TNFR2 (TNFRSF1ß), GITR (TNFRSF18), CD137 (TNFRSF9), HVEM (TNFRSF14), DR6 (TNFRSF21), остеопротегерином (OPG; TNFRSF11B), RANK (TNFRSF11A), FAS (TNFRSF6) и CD40 (TNFRSF5) человека. 9B12, моноклональное антитело IgG1 мыши к OX40 человека, которое было "гуманизировано" с получением OX40mAb24, характеризовалось аналогичным отсутствием связывания с этими белками TNFRSF (фигура 5B).

3.4. Выводы

[0282] Связывание OX40mAb24 и 9B12 с OX40 человека является специфическим и не характеризуется перекрестной реакцией с близкородственными белками TNFRSF.

ПРИМЕР 4. Способность OX40mAb24 костимулировать первичные CD4+ T-клетки человека с помощью OX40 in vitro

[0283] В этом примере способность OX40mAb24 усиливать активацию T-клеток наряду с активацией с помощью комплекса CD3/T-клеточный рецептор (TCR) оценивали с применением анализа пролиферации CD4+ T-клеток человека и высвобождения цитокинов с применением планшета. Также исследовали активность растворимого OX40mAb24, а также активность растворимого и связанного на планшете OX40mAb24 в отсутствие передачи сигналов через CD3/TCR.

4.1. МАТЕРИАЛЫ

[0284] Материалы, применяемые в данном исследовании, перечислены в таблице 4-1.

Таблица 4-1. Материалы

Наименование Источник
Антитело козы к IgG человека (H+L), меченное AlexaFluor® 647 Life Technologies, Карлсбад, Калифорния
Антитело к CD4 человека, меченное EFluor450® eBioscience, Сан-Диего, Калифорния
Бычий сывороточный альбумин (BSA) Sigma, Сент-Луис, Миссури
Набор для мечения клеток с помощью CFSE Life Technologies, Карлсбад, Калифорния
Полная среда RPMI: RPMI-1640+10% FBS Материалы от Life Technologies, Карлсбад, Калифорния
Планшеты с глубокими лунками, полипропилен, 2 мл VWR, Раднор, Пенсильвания
Набор для обогащения CD4+ T-клеток EasySep Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада
Программное обеспечение FlowJo TreeStar, Ашланд, Орегон
Антитело козы к IgG человка, Fcγ-специфическое Jackson ImmunoResearch, Вест Грув, Пенсильвания
Антитело козы к IgG мыши, Fcγ-специфическое Jackson ImmunoResearch, Вест Грув, Пенсильвания
Термоинактивированная сыворотка новорожденных телят Life Technologies, Карлсбад, Калифорния
IL-2, рекомбинантный человеческий Preprotech, Роки-Хилл, Нью-Джерси
Лейкаферезная масса AllCells, Аламеда, Калифорния
LSM MP Biomedicals, Санта-Ана, Калифорния
Проточный цитометр LSR II BD Biosciences, Сан-Хосе, Калифорния
Антитело мыши к CD3 человека, клон OKT3 Biolegend, Сан-Диего, Калифорния
Сыворотка новорожденных телят, термоинактивированная (FBS) Life Technologies, Карлсбад, Калифорния
96-луночные планшеты с круглодонными лунками, не обработанных для культур тканей VWR, Раднор, Пенсильвания
PHA-L Roche Applied Science, Индианаполис, Индиана
Фосфатно-солевой буферный раствор (PBS), pH7,2, без кальция и магния Life Technologies, Карлсбад, Калифорния
Программное обеспечение Prism, версия 5.01 Graphpad Software, Сан-Диего, Калифорния
Пропидиум йодид (раствор 1 мг/мл) Sigma, Сент-Луис, Миссури
Набор для обогащения CD4+ T-клеток RosetteSep StemCell Technologies, Ванкувер, Британская Колумбия, Канада
RPMI-1640 Life Technologies, Карлсбад, Калифорния
Микрочип для мультиплексного выявления цитокинов Th1/Th2 Mesoscale Discovery (MSD), Роквилл, Мэриленд
Счетчик Vi-Cell Beckman Coulter, Индианаполис, Индиана
Цельная кровь, антикоагулированная гепарином натрия Программа донорства крови MedImmune, Гейтерсберг, Мэриленд

4.2. Анализы

4.2.1. Биоактивность OX40mAb24 при иммобилизации на планшете

[0285] Биоактивность OX40mAb24 определяли путем измерения пролиферации CD4+ T-клеток человека и выработки цитокинов в анализе захвата лекарственного средства с применением планшета (фигура 6).

[0286] Обогащенные CD4+ T-клетки человека выделяли из цельной крови здоровых доноров с применением набора для обогащения CD4+ T-клеток RosetteSep в соответствии с протоколом производителя. Анализы проводили с клетками, полученными от четырех независимых доноров.

[0287] CD4+ T-клетки суспендировали в полной среде для культивирования RPMI и концентрацию клеток доводили до 1,0×106 на мл. Для активации T-клеток и повышения экспрессии OX40 добавляли конечные концентрации 2 мкг/мл фитогемагглютинина-лейкоагглютинина (PHA-L) и 20 МЕ/мл рекомбинантного человеческого IL-2 и клетки культивировали при 37°C и 5% CO2 в увлажненном инкубаторе для культивирования тканей в течение 2 дней.

[0288] 96-луночные планшеты для анализа с круглодонными лунками, не обработанные для культур тканей, покрывали с помощью 100 мкл 2 мкг/мл антитела козы, специфического в отношении Fcγ IgG мыши, и 2 мкг/мл антитела козы, специфического в отношении Fcγ IgG человека, в PBS. Иммобилизованные антитела козы к IgG человека не добавляли в лунки, предназначенные для анализа активности растворимого OX40mAb24. Планшеты инкубировали в течение ночи при 4°C, промывали с помощью 200 мкл PBS и блокировали в течение 90 минут при 37°C с помощью 1% BSA в PBS (1% BSA/PBS). Планшеты промывали с помощью PBS, и антитело мыши к CD3 человека, клон OKT3, восстановленное в 1% BSA/PBS из расчета 2 нг/мл, добавляли в планшеты на 90 минут при 37°C. Планшеты промывали с помощью PBS для удаления несвязавшегося OKT3, каждое из OX40mAb24, контрольного mAb для IgG1 человека, R347, 9B12 и контрольного mAb для IgG1 мыши, клон MOPC-21, восстанавливали в 1% BSA/PBS, начиная с 0,918 мкг/мл (3,0 нМ) и серийно разбавляли в виде серии 3-кратных разбавлений, а затем вносили в планшеты для анализа и инкубировали в течение 90 минут при 37°C.

[0289] Активированные первичные CD4+ T-клетки человека собирали, промывали в полной среде RPMI и концентрацию доводили до 1,0×106 жизнеспособных клеток/мл. Клетки метили с помощью сукцинимидилового сложного эфира карбоксифлуоресцеина (CFSE) в соответствии с инструкциями производителя, за исключением использования 1,25 мкМ CFSE вместо рекомендованного 5 мкМ с инкубацией в течение 10 минут при 37°C. После мечения клетки суспендировали в полной среде RPMI и концентрацию доводили до 0,5×106 клеток на мл. Планшеты промывали с помощью PBS и в каждую лунку добавляли по 200 мкл CD4+ T-клеток (100000/лунка). В случае лунок, содержащих растворимое OX40mAb24, OX40mAb24 разводили в полной среде RPMI до наибольших конечных концентраций, применяемых для связанного на планшете OX40mAb24. Клетки в планшете осаждали центрифугированием при 380xg и инкубировали при 37°C в течение 3 дней. Спустя 72 часа периода инкубации 40 мкл супернатанта культуры клеток отбирали для измерения высвобождения цитокинов. CD4+ T-клетки осаждали и промывали один раз с помощью PBS, содержащего 2% FBS (буфер FACS). Клетки суспендировали в смеси для связывания, содержащей антитело к CD4 человека, меченное eFluor450®, для выявления CD4+ T-клеток и пропидиум йодид (PI) для различения живых/нежизнеспособных клеток, и инкубировали в течение 30 минут. После инкубации клетки промывали в буфере FACS, ресуспендировали в буфере FACS и анализировали посредством проточной цитометрии с применением проточного цитометра LSRII и программного обеспечения FlowJo для анализа данных, форматированных согласно стандарту проточной цитометрии (FCS).

[0290] Для анализа пролиферации T-клеток живые (PI-отрицательные) объекты гейтировали с применением программного обеспечения FlowJo, и процентную долю гейтированных по CD4 клеток, демонстрирующих разбавление CFSE, определяли в качестве меры процентной доли клеток, подвергающихся пролиферации.

[0291] Для анализа высвобождения цитокинов супернатанты культур клеток, полученные после 72 часов культивирования, измеряли на содержание цитокинов с применением набора для 10-плексного анализа цитокинов Th1/Th2 человека от MesoScale Discovery (Гейтерсберг, Мэриленд) в соответствии с протоколом производителя. В этом наборе предусмотрен метод электрохимической детекции для количественного измерения следующих цитокинов человека: IFNγ, IL-2, IL4, IL-5, IL-8, IL-10, IL-12 p70, IL-13 и IL-1ß.

[0292] GraphPad Prism, версия 5.01 для Windows, GraphPad Software, Сан-Диего, Калифорния, США, www.graphpad.com, применяли для построения графика концентрации mAb в логарифмической шкале в зависимости от значений пролиферации или высвобождения цитокинов. Значения эффективных концентраций, приводящих к 20%, 50% и 90% максимального эффекта (EC20, EC50 и EC90) для биоактивности OX40mAb24, рассчитывали на основании сигмоидальных кривых биоактивности "доза-ответ" с применением функции ECAnything.

4.3. РЕЗУЛЬТАТЫ

[0293] Данные по пролиферации для каждого из четырех доноров и данные по высвобождению цитокинов для одного донора представлены на фигурах 7A-C и фигурах 8A-E. Значения EC20, EC50 и EC90 активности для пролиферации первичных CD4+ T-клеток человека представлены в таблице 4-2; значения активности в анализах высвобождения цитокинов из первичных CD4+ T-клеток человека представлены c таблицы 4-3 по таблицу 4-7; средние значения пролиферации и высвобождения цитокинов для OX40mAb24 и 9B12 представлены в таблице 4-8 и таблице 4-9 соответственно.

[0294] OX40mAb24 костимулировало пролиферацию первичных CD4+ T-клеток человека (n=4) зависимым от концентрации образом, при этом значения EC20, EC50 и EC90 составляли 21, 28 и 72 пМ соответственно. 9B12 костимулировало пролиферацию CD4+ T-клеток при значениях EC20, EC50 и EC90, составляющих 106, 218 и 622 пМ. Таким образом, отношение концентраций 9B12 и OX40mAb24, необходимых для индукции 50% максимального пролиферативного ответа, составляло 8 к 1 (таблица 4-2).

[0295] OX40mAb24 и 9B12 костимулировали первичные CD4+ T-клетки человека с высвобождением цитокинов (n=4). Средние значения EC20, EC50 и EC90 характеризовались меньшей мощностью, чем значения пролиферации, и приведены в обобщенном виде в таблице 4-8 и таблице 4-9. Анализ нелинейной регрессии было невозможно провести по результатам анализов IL-2, IL-4, IL-8, IL-12 p70 и IL-1ß для обоих mAb вследствие недостаточно четких или не существующих сигмоидальных кривых "доза-ответ".

Таблица 4-2. Средние значения EC20, EC50 и EC90 для OX40mAb24 и 9B12 в анализе пролиферации первичных CD4+ T-клеток человека

Номер донора Моноклональное антитело EC20 (95% CI), пМ EC50 (95% CI), пМ EC90 (95% CI), пМ Активность растворимой формы Активность в отсутствие стимуляции TCR
367 OX40mAb24 32 (22, 46) 38 (20, 72) 71 (17, 29) Не исследовали Отсутствует
661 OX40mAb24 33 (28, 39) 51 (33, 77) 128 (96, 172) Не исследовали Отсутствует
645 OX40mAb24 7,5 (2,7, 21) 8,3 (2,8, 25) 35 (7,1, 173) Отсутствует Не исследовали
651 OX40mAb24 9,6 (6,3, 15) 16 (9,1, 26) 54 (30, 99) Отсутствует Не исследовали
Среднее (стандартная ошибка среднего), пМ OX40mAb24 21 (6,9) 28 (9,8) 72 (20)
367 9B12 99,8 (80,0, 125) 156 (90,2, 269) 337 (214, 530) Не исследовали Не исследовали
661 9B12 128 (113, 144) 237 (164, 342) 535 (464, 617) Не исследовали Не исследовали
645 9B12 77,5 (30,2, 199) 169 (67,0, 425) 686 (152, 3080) Не исследовали Не исследовали
651 9B12 118 (80,8, 173) 309 (201, 475) 929 (511, 1690) Не исследовали Не исследовали
Среднее (стандартная ошибка среднего), пМ 9B12 106 (11,1) 218 (35,2) 622 (125)

CI=доверительный интервал; EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; TCR=T-клеточный рецептор.

Таблица 4-3. Средние значения EC20, EC50 и EC90 для индукции IFNγ под действием OX40mAb24 и 9B12 в анализе биоактивности на первичных CD4+ T -клетках человека

Номер донора Моноклональное антитело EC20 (95% CI), пМ EC50 (95% CI), пМ EC90 (95% CI), пМ Активность растворимой формы Активность в отсутствие стимуляции TCR
367 OX40mAb24 38,6 (21,3, 70,0) 57,2 (31,2, 105) 106 (34,6, 328) Не исследовали Отсутствует
661 OX40mAb24 ND ND ND Не исследовали Отсутствует
645 OX40mAb24 32,1 (20,8, 49,7) 58,2 (42,0, 80,8) 150 (77,6, 289) Отсутствует Не исследовали
651 OX40mAb24 47,5 (24,5, 91,8) 77,4 (51,4, 116) 168 (86,7, 324) Отсутствует Не исследовали
Среднее (стандартная ошибка среднего), пМ OX40mAb24 39,4 (4,46) 64,3 (6,57) 141 (18,4)
367 9B12 ND ND ND Не исследовали Не исследовали
661 9B12 ND ND ND Не исследовали Не исследовали
645 9B12 706 (518, 963) 2380 (1420, 3970) 16300 (5480, 48300) Не исследовали Не исследовали
651 9B12 344 (274, 430) 758 (639, 900) 2660 (780, 3990) Не исследовали Не исследовали
Среднее (стандартная ошибка среднего), пМ 9B12 525 (148) 1570 (662) 9480 (5569)

CI=доверительный интервал; EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; TCR=T-клеточный рецептор.

Таблица 4-4. Средние значения EC20, EC50 и EC90 для индукции TNFα под действием OX40mAb24 и 9B12 в анализе биоактивности на первичных CD4+ T -клетках человека

Номер донора Моноклональное антитело EC20 (95% CI), пМ EC50 (95% CI), пМ EC90 (95% CI), пМ Активность растворимой формы Активность в отсутствие стимуляции TCR
367 OX40mAb24 ND ND ND Не исследовали Отсутствует
661 OX40mAb24 ND ND ND Не исследовали Отсутствует
645 OX40mAb24 37,6 (22,5, 62,7) 54,1 (29,1, 101) 96,2 (26,7, 347) Отсутствует Не исследовали
651 OX40mAb24 ND ND ND Отсутствует Не исследовали
Среднее (стандартная ошибка среднего), пМ OX40mAb24 ND ND ND
367 9B12 ND ND ND Не исследовали Не исследовали
661 9B12 ND ND ND Не исследовали Не исследовали
645 9B12 306 (258, 503) 670 (527, 853) 1800 (1100, 2920) Не исследовали Не исследовали
651 9B12 388 (300, 502) 764 (640, 919) 2260 (1500, 3410) Не исследовали Не исследовали
Среднее (стандартная ошибка среднего), пМ 9B12 347 (33,5) 717 (38,4) 2030 (188)

CI=доверительный интервал; EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; ND=не определяли вследствие недостаточного соответствия кривой (EC20, EC50, EC90) или отсутствия достаточного числа значений для определения среднего и стандартной ошибки среднего; TCR=T-клеточный рецептор.

Таблица 4-5. Средние значения EC20, EC50 и EC90 для индукции IL10 под действием OX40mAb24 и 9B12 в анализе биоактивности на первичных CD4+ T -клетках человека

Номер донора Моноклональное антитело EC20 (95% CI), пМ EC50 (95% CI), пМ EC90 (95% CI), пМ Активность растворимой формы Активность в отсутствие стимуляции TCR
367 OX40mAb24 41,6 (17,8, 97,0) 59,5 (25,4, 139) 105 (25,0, 440) Не исследовали Отсутствует
661 OX40mAb24 63,5 (29,6, 136) 89,5 (64,2, 125) 154 (93,3, 255) Не исследовали Отсутствует
645 OX40mAb24 ND ND ND Отсутствует Не исследовали
651 OX40mAb24 53,0 (31,0, 90,6) 86,4 (65,0, 115) 188 (110, 321) Отсутствует Не исследовали
Среднее (стандартная ошибка среднего), пМ OX40mAb24 52,7 (6,32) 78,5 (9,53) 149 (24,1)
367 9B12 130 (83,3, 204) 198 (139, 284) 385 (224, 662) Не исследовали Не исследовали
661 9B12 ND ND ND Не исследовали Не исследовали
645 9B12 528 (363, 767) 1220 (858, 1740) 4630 (2050, 10400) Не исследовали Не исследовали
651 9B12 405 (300, 547) 796 (649, 976) 2320 (1440, 3730) Не исследовали Не исследовали
Среднее (стандартная ошибка среднего), пМ 9B12 354 (118) 738 (296) 2445 (1227)

CI=доверительный интервал; EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; ND=не определяли вследствие недостаточного соответствия кривой (EC20, EC50, EC90) или отсутствия достаточного числа значений для определения среднего и стандартной ошибки среднего; TCR=T-клеточный рецептор.

Таблица 4-6. Средние значения EC20, EC50 и EC90 для индукии IL13 под действием OX40mAb24 и 9B12 в анализе биоактивности на первичных CD4+ T -клетках человека

Номер донора Моноклональное антитело EC20 (95% CI), пМ EC50 (95% CI), пМ EC90 (95% CI), пМ Активность растворимой формы Активность в отсутствие стимуляции TCR
367 OX40mAb24 ND ND ND Не исследовали Отсутствует
661 OX40mAb24 ND ND ND Не исследовали Отсутствует
645 OX40mAb24 44,7 (26,5, 75,5) 73,8 (52,2, 104) 163 (93,3, 286) Отсутствует Не исследовали
651 OX40mAb24 36,2 (24,9, 52,7) 65,0 (49,6, 85,3) 164 (99,2, 273) Отсутствует Не исследовали
Среднее (стандартная ошибка среднего), пМ OX40mAb24 40,5 (4,25) 69,4 (4,40) 164 (0,50
367 9B12 ND ND ND Не исследовали Не исследовали
661 9B12 154 (841, 283) 238 (166, 341) 472 (278, 800) Не исследовали Не исследовали
645 9B12 1100 (413, 2910) 5450 (1060, 2800) 6930 (4310, 1110000) Не исследовали Не исследовали
651 9B12 495 (324, 756) 1770 (896, 3510) 13400 (2980, 60400) Не исследовали Не исследовали
Среднее (стандартная ошибка среднего), пМ 9B12 583 (277) 2486 (1550) 6930 (3730)

CI=доверительный интервал; EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; ND=не определяли вследствие недостаточного соответствия кривой (EC20, EC50, EC90) или отсутствия достаточного числа значений для определения среднего и стандартной ошибки среднего; TCR=T-клеточный рецептор.

Таблица 4-7. Средние значения EC20, EC50 и EC90 для индукции IL5 под действием OX40mAb24 и 9B12 в анализе биоактивности на первичных CD4+ T -клетках человека

Номер донора Моноклональное антитело EC20 (95% CI), пМ EC50 (95% CI), пМ EC90 (95% CI), пМ Активность растворимой формы Активность в отсутствие стимуляции TCR
367 OX40mAb24 33,2 (21,2, 52,1) 46,7 (24,7, 88,0) 79,8 (12,3, 519) Не исследовали Отсутствует
661 OX40mAb24 43,4 (27,6, 68,4) 69,0 (49,7, 95,7) 144 (86,8, 238) Не исследовали Отсутствует
645 OX40mAb24 ND ND ND Отсутствует Не исследовали
651 OX40mAb24 56,2 (35,5, 88,9) 95,9 (76,1, 121) 224 (128, 391) Отсутствует Не исследовали
Среднее (стандартная ошибка среднего), пМ OX40mAb24 44,3 (6,65) 70,5 (14,2) 149 (41,7)
367 9B12 ND ND ND Не исследовали Не исследовали
661 9B12 ND ND ND Не исследовали Не исследовали
645 9B12 ND ND ND Не исследовали Не исследовали
651 9B12 423 (285, 627) 1090 (742, 1600) 4870 (1900, 12500) Не исследовали Не исследовали
Среднее (стандартная ошибка среднего), пМ 9B12 ND ND ND

CI=доверительный интервал; EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; ND=не определяли вследствие недостаточного соответствия кривой (EC20, EC50, EC90) или отсутствия достаточного числа значений для определения среднего и стандартной ошибки среднего; TCR=T-клеточный рецептор.

Таблица 4-8. Обобщенные средние значения EC20, EC50 и EC90 для пролиферации и высвобождения цитокинов под действием OX40mAb24

Показатель биоактивности EC20 (StdErr), пМ EC50 (StdErr), пМ EC90 (StdErr), пМ
Пролиферация CD4 T-клеток 21 (6,9) 28 (98) 72 (20)
Высвобождение IFNγ 39,4 (4,46) 64,3 (6,57) 141 (18,4)
Высвобождение TNFα ND ND ND
IL10 52,7 (6,32) 78,5 (9,53) 149 (24,1)
IL13 40,5 (4,25) 69,4 (4,40) 164 (0,50)
IL5 44,3 (6,65) 70,5 (14,2) 149 (41,7)

EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; ND=не определяли вследствие недостаточного числа значений для расчета среднего и стандартной ошибки среднего; StdErr=стандартная ошибка среднего.

Таблица 4-9. Обобщенные средние значения EC20, EC50 и EC90 для пролиферации и высвобождения цитокинов под действием 9B12

Показатель биоактивности EC20 (StdErr), пМ EC50 (StdErr), пМ EC90 (StdErr), пМ
Пролиферация CD4 T-клеток 106 (11,1) 218 (35,2) 622 (125)
Высвобождение IFNγ 525 (148) 1570 (662) 9480 (5569)
Высвобождение TNFα 347 (33,5) 717 (38,4) 2030 (188)
IL10 354 (118) 738 (296) 2445 (1227)
IL13 583 (277) 2486 (1547) 6934 (3732)
IL5 ND ND ND

EC20=эффективная концентрация, приводящая к 20% максимального эффекта; EC50=полумаксимальная эффективная концентрация; EC90=эффективная концентрация, приводящая к 90% максимального эффекта; ND=не определяли вследствие недостаточного числа значений для расчета среднего и стандартной ошибки среднего; StdErr=стандартная ошибка среднего.

[0296] Определяли активность не связанного на планшете растворимого OX40mAb24. Растворимое OX40mAb24 не индуцировало ни пролиферацию первичных CD4+ T-клеток человека (фигуры 7A-C), ни высвобождение цитокинов (фигуры 8A-E) свыше уровней, наблюдаемых либо для антитела к CD3 отдельно, либо в присутствии контрольного mAb для IgG1 человека, R347. Связанное на планшете антитело к CD3 само по себе приводило к уровню пролиферации и высвобождению цитокинов от минимального до умеренного. Показанное в данном документе отсутствие активности у растворимого OX40mAb24 согласуется с отсутствием активности, наблюдаемой у растворимого OX40mAb24 без перекрестного сшивания клетками в анализе биоактивности с 2 типами клеток, в котором измеряли опосредованную OX40 передачу сигнала NFκB (см. пример 5 ниже).

[0297] Аналогично, OX40mAb24, либо иммобилизованное на поверхности планшета, либо добавленное в виде растворимого несвязанного белка, в отсутствие субмитогенного сигнала антитела к CD3 индуцировало пролиферацию CD4+ T-клеток (фигуры 7A-C) или высвобождение цитокинов (фигуры 8A-E) на низком уровне или не оказывало эффекта. Эти результаты показали, что в данном исследовании OX40mAb24 не обладает активностью в отношении первичных CD4+ T-клеток человека при отсутствии одновременного лигирования CD3/TCR.

4.4. Выводы

[0298] OX40mAb24 индуцировало пролиферацию первичных CD4+ T-клеток человека и высвобождение ими цитокинов зависимым от концентрации образом, что было аналогично антителу, на основании которого его гуманизировали, 9B12 (фигуры 8A-E и фигуры 9A-E). OX40mAb24 проявляло активность в качестве связанного на планшете, но не растворимого, белка. Кроме того, активность OX40mAb24 возникала одновременно с передачей сигнала через CD3/TCR.

ПРИМЕР 5. Определение in vitro активности OX40mAb24 в анализах биоактивности с 2 типами клеток, в которых применяются T-клетки Jurkat с NFκB-люциферазным репортером

[0299] В данном примере способность OX40mAb24 и 9B12 передавать сигнал с помощью OX40 человека оценивали с применением набора из анализов биоактивности на основе репортера с применением двух типов клеток. Измерение активации T-клеток с помощью костимуляции OX40 выполняли с применением сверхэкспрессирующих OX40 Т-клеток линии Jurkat с NFκB-люциферазным репортером, которая продуцирует люциферазу в ответ на стимуляцию сигнального пути NFκB (фигура 10). Сообщалось, что передача сигнала через NFκB происходит после вовлечения OX40, и ее можно связать с другими показателями активации T-клеток, такими как пролиферация и высвобождение цитокинов (Croft M, et al., Immunol Rev. 229:173-91 (2009)). Количество люциферазы и, таким образом, активацию T-клеток измеряли путем добавления субстрата люциферазы к клеточным лизатам и измерении света, испускаемого продуктом реакции, с применением люминометра. Измеряли биоактивность OX40mAb24, перекрестно сшитого при помощи клеток, сконструированных для экспрессии различных Fcγ рецепторных объектов, а также растворимого OX40mAb24, не подвергнутого перекрестному сшиванию с помощью FcγR.

5.1. Материалы

[0300] Материалы, применяемые в данном исследовании, перечислены в таблице 5-1.

Таблица 5-1. Материалы

Наименование Источник
Микрогранулы для CD45+ Miltenyi, Сан-Диего, Калифорния
Коллагеназа III Worthington Biochemical Corporation, Лейквуд, Нью-Джерси
ДНКаза I, из поджелудочной железы быка Sigma, Сент-Луис, Миссури
EDTA, 0,5 M, pH 8,0 Life Technologies, Карлсбад, Калифорния
Ридер люминесценции Envision Perkin Elmer, Уолтем, Массачусетс
Термоинактивированная сыворотка новорожденных телят (FBS) Life Technologies, Карлсбад, Калифорния
LS-колонка Miltenyi, Сан-Диего, Калифорния
Буфер MACS: PBS+0,5% BSA+2 мМ EDTA Материалы от Life Technologies, Карлсбад, Калифорния
96-луночные планшеты с круглодонными лунками, не обработанные для TC VWR, Раднор, Пенсильвания
Программное обеспечение Prism, версия 5.01 GraphPad, Сан-Диего, Калифорния
Раствор Steady-Glo для анализа люциферазы Promega, Мадисон, Висконсин
Счетчик ViCell Beckman Coulter, Индианаполис, Индиана

5.2. Анализ биоактивности с двумя типами клеток

5.2.1. Выделение первичных CD45+ клеток человека

[0301] Первичные CD45+ клетки человека выделяли из опухолей человека. Образцы опухолей извлекали из транспортной среды и помещали в стерильную чашку Петри. Добавляли забуференный солевой раствор Хенкса и иссекали видимую некротическую ткань или любую нормальную ткань из образца опухоли. Ткань разрезали на небольшие кусочки (~1 мм) и помещали в 50 мл коническую пробирку, и добавляли смесь ферментов на основе коллагеназы III (250 МЕ/мл коллагеназы III, 3 мМ CaCl2, 315 мкг/мл ДНКазы 1), смешивали и инкубировали. Подвергнутый действию ферментов образец фильтровали через 70-микронный фильтр и промывали буфером MACS. Диссоциировавшие клетки осаждали и число и жизнеспособность клеток определяли при помощи счетчика ViCell. Клетки суспендировали в буфере MACS с CD45-микрогранулами и инкубировали на льду. Клетки промывали и ресуспендировали в буфере MACS для позитивной селекции CD45+ клеток с применением LS-колонки. Связавшиеся с гранулами CD45+ клетки элюировали путем удаления колонки от магнита и добавления в колонку буфера MACS. Клетки осаждали и ресуспендировали в полной среде RPMI и применяли в анализах биоактивности, как описано выше.

5.2.2. Протокол анализа

[0302] OX40mAb24 и 9B12 исследовали в отношении биоактивности при помощи анализа биоактивности с 2 типами клеток. Для измерения агонизма OX40 (активность NFκB) применяли сверхэкспрессирующие OX40 человека клетки Jurkat с NFκB-люциферазным репортером, клон 64 (OX40-Jurkat с репортером). Вторую линию экспрессирующих FcγR клеток применяли, чтобы опосредовать перекрестное сшивание OX40mAb24, которое приводит к кластеризации и активации OX40 на клетках OX40-Jurkat с репортером (фигура 10). Линии экспрессирующих FcγR клеток, которые применяли для перекрестного сшивания, включали линию В-клеточной лимфомы человека Raji, экспрессирующие CD32A клетки HEK293, экспрессирующие CD32B клетки HEK293 или CD45+ иммунные клетки, выделенные из первичных опухолей человека.

[0303] Для определения активности растворимой формы OX40mAb24 также выполняли анализы биоактивности либо с применением исходных клеток HEK293, которые являются FcγR-нулевыми и, таким образом, не способны к перекрестному сшиванию OX40mAb24, либо при отсутствии клеток, опосредующих перекрестное сшивание, вообще.

[0304] Перед применением клетки OX40-Jurkat с репортером культивировали в полной среде RPMI в инкубаторе для культивирования тканей при плотности 0,5-1,5×106 на мл. Клетки пассировали за день перед проведением биоанализа при конечной плотности 106 клеток на мл.

[0305] Клетки ОX40-Jurkat с репортером, линии экспрессирующих FcγR клеток или исходные клетки HEK собирали и осаждали. Чтобы выделить CD45+ клетки из первичных опухолей человека и нормальных прилегающих тканей, ткани диссоциировали, и CD45+ клетки выделяли и ресуспендировали в полной среде RPMI для применения в анализах биоактивности, как описано ниже.

[0306] Для OX40mAb24, 9B12 и различных контрольных антител готовили серийные 3-кратные разбавления в полной среде RPMI.

[0307] Клетки OX40-Jurkat с репортером совместно с экспрессирующими FcγR клетками или исходными клетками HEK вносили в 96-луночный планшет из расчета 100000 клеток на лунку. OX40mAb24, 9B12 или контрольные антитела добавляли к клеткам в виде серии разбавлений при начальной концентрации 10 мкг/мл и инкубировали при 37°C в инкубаторе для культивирования тканей.

[0308] По истечении 16-24 часов времени инкубации 100 мкл восстановленного раствора Steady-Glo для анализа люциферазы (Promega, Мадисон, Висконсин) добавляли в каждую лунку и смешивали, чтобы лизировать клетки, а затем инкубировали, чтобы сбалансировать люциферазный сигнал. Steady-Glo/лизат образца (150 мкл) переносили из каждой лунки в 96-луночный аналитический планшет с белыми стенками для детекции и считывания люминесценции с применением ридера люминесценции Envision от Perkin Elmer.

[0309] GraphPad Prism, версия 5.01 для Windows (GraphPad Software, Сан-Диего, Калифорния) применяли для нанесения на график концентрации OX40mAb24, 9B12, IgG1 человека, R347, IgG1 мыши, клон MOPC-21 (ось x представляет собой log 10 концентрации белка), в зависимости от люминесценции в RLU (ось y). Значения биоактивности EC20, EC50 и EC90 определяли с применением функции ECAnything (ECf) для f=20, f=50 и f=90, исходя из сигмоидальных кривых биоактивности "доза-ответ" (изменяемый наклон)).

5.3 Результаты анализов биоактивности с 2 типами клеток

[0310] Результаты в отношении биоактивности OX40mAb24 и контрольных антител представлены на фигурах 11A-D, фигурах 12A-D и в таблице 5-2.

[0311] В присутствии линии экспрессирующих FcγR клеток (например, экспрессирующих CD32A клеток HEK293, экспрессирующих CD32B клеток HEK293, В-клеток Raji или CD45+ клеток, выделенных из первичных опухолей человека), OX40mAb24 проявляло эффективную стимуляцию сверхэкспрессирующих OX40 клеток Jurkat с NFκB репортером, как определяли по активации пути NFκB. В отсутствие второго типа клеток или в присутствии клеток HEK293, в которых не происходит эндогенная экспрессия FcγR, OX40mAb24 обеспечивало минимальную активность репортера (фигуры 11A-D).

[0312] Значения активности (EC20, EC50 и EC90), полученные в биоанализах с двумя типами клеток, обобщены в таблице 5-2. Средние значения EC20, EC50 и EC90 во всех анализах составляли 228, 751 и 5630 пМ соответственно.

[0313] Результаты в отношении биоактивности 9B12 и контрольных антител представлены на фигурах 12A-D, а значения активности обобщены в таблице 5-3. Средние значения EC20, EC50 и EC90 для всех анализов составляли 519, 2530 и 41100 пМ соответственно. Следовательно, отношение биоактивности (EC50) 9B12 в сравнении с биоактивностью OX40mAb24 составило 3,4 к 1 согласно анализу с 2 типами клеток.

Таблица 5-2. Биоактивность OX40mAb24 согласно анализу с двумя типами клеток

Номер эксперимента Экспрессирующая FcγR клетка* EC20 (95% CI), пМ EC50 (95% CI), пМ EC90 (95% CI), пМ
1 Raji 298 (236, 378) 1140 (982, 1340) 9850 (6500, 14300)
2 Экспрессирующие CD32A клетки HEK 104 (78,8, 138) 437 (370, 517) 4250 (2900, 6240)
3 Экспрессирующие CD32A клетки HEK 100 (79,5, 126) 322 (281, 370) 2060 (1530, 2780)
4 Raji 350 (259, 467) 1040 (855, 1270) 5930 (3740, 9400)
5 Экспрессирующие CD32B клетки HEK 90,6 (75,4, 109) 270 (242, 301) 1520 (1200, 1920)
6 Raji 180 (109, 296) 796 (577, 1100) 8410 (3820, 18500)
7 Экспрессирующие CD32B клетки HEK 280 (198, 394) 899 (710, 1140) 5730 (3290, 9970)
8 Экспрессирующие CD32B клетки HEK 237 (196, 286) 671 (592, 762) 3510 (2630, 4670)
9 Raji 676 (443, 1030) 1320 (970, 1800) 3820 (2000, 7320)
10 Raji 297 (127, 694) 1260 (666, 2390) 12500 (2570, 60500)
11 Экспрессирующие CD32B клетки HEK 144 (113, 184) 700 (598, 818) 8540 (5770, 12600)
12 CD45+ клетки, NSCLC 33,6 (24,7, 45,8) 81,6 (68,5, 97,3) 334 (236, 471)
13 CD45+ клетки, RCC 92,2 (75,4, 113) 337 (296, 383) 2630 (1940, 3550)
14 CD45+ клетки, NSCLC 247 (207, 295) 772 (688, 867) 4700 (3600, 6140)
15 CD45+ клетки, RCC 351 (155, 798) 1410 (782, 2530) 12700 (2960, 54500)
16 Экспрессирующие CD32A клетки HEK 166 (145, 191) 553 (507, 603) 3720 (3060, 4530)
Среднее (стандартная ошибка среднего) 228 (38,9) 751 (101) 5630 (937)

NSCLC=немелкоклеточный рак легкого; RCC=почечно-клеточная карцинома.

* Как указано, в анализах применяли клетки Raji, экспрессирующие CD32A клетки HEK293, экспрессирующие CD32B клетки HEK293 или CD45+ клетки, выделенные из образцов первичных опухолей человека, вместе с экспрессирующими OX40 клетками Jurkat с NFκB-люциферазным репортером, клон 64.

Таблица 5-3. Биоактивность 9B12 согласно анализу с двумя типами клеток

Номер эксперимента Экспрессирующая FcγR клетка* EC20, пМ EC50, пМ EC90, пМ
1 Raji 1110 (791, 1570) 9280 (4460, 19300) 267000 (57900, 1230000)
2 Экспрессирующие CD32A клетки HEK 74,1 (53,0, 104) 338 (279, 410) 3760 (2440, 5790)
3 Экспрессирующие CD32A клетки HEK 66,7 (43,3, 103) 225 (175, 289) 1550 (914, 2630)
4 Raji 1040 (834, 1300) 5040 (3880, 6550) 61200 (32200, 116000)
5 Экспрессирующие CD32B клетки HEK 249 (206, 303) 726 (641, 823) 3950 (2980, 5240)
6 Raji 548 (408, 736) 2700 (2070, 3620) 33700 (17000, 66700)
7 Экспрессирующие CD32B клетки HEK 585 (520, 658) 1770 (1620, 1930) 10200 (8280, 12500)
8 Экспрессирующие CD32B клетки HEK 518 (449, 598) 1340 (1210, 1480) 6050 (4800, 7630)
9 Raji 872 (504, 1510) 3070 (1910, 4950) 22600 (7000, 73100)
10 Raji 571 (212, 1540) 3330 (1080, 10200) 54400 (3400, 872000)
11 Экспрессирующие CD32B клетки HEK 650 (458, 923) 2360 (1790, 3100) 18200 (9200, 36000)
12 CD45+ клетки, NSCLC 104 (76,3, 143) 223 (185, 269) 741 (501, 1100)
13 CD45+ клетки, RCC ND ND ND
14 CD45+ клетки, NSCLC ND ND ND
15 CD45+ клетки, RCC 356 (132, 964) 2420 (938, 6250) 50500 (4140, 616000)
Среднее (стандартная ошибка среднего) 519 (96,2) 2530 (687) 41100 (19700)

ND=не определяли; NSCLC=немелкоклеточный рак легкого; RCC=почечно-клеточная карцинома.

* Как указано, в анализах применяли клетки Raji, экспрессирующие CD32A клетки HEK293, экспрессирующие CD32B клетки HEK293 или CD45+ клетки, выделенные из образцов первичных опухолей человека, вместе с экспрессирующими OX40 клетками Jurkat с NFκB-люциферазным репортером, клон 64.

5-4. Выводы

[0314] OX40mAb24 и 9B12 опосредовали активацию T-клеток человека, как определено по стимуляции пути NFκB в линии сверхэкспрессирующих OX40 клеток Jurkat с NFκB-люциферазным репортером. В отсутствие клеток, которые экспрессируют FcγR, способные к перекрестному сшиванию с помощью Fc-доменов OX40mAb24, определяли минимальную активность линии клеток с репортером. Однако в системе с 2 типами клеток, содержащей клетки, которые экспрессируют FcγR, которые способны к перекрестному сшиванию mAb, и линию сверхэкспрессирующих клеток Jurkat с NFκB-люциферазным репортером, для определения активации T-клеток, OX40mAb24 и 9B12 опосредовали эффективную активацию OX40, при этом средние значения EC50 составляли 751 пМ и 2530 пМ соответственно. Следовательно, биоактивность OX40mAb24 в системе для анализа с 2 типами клеток была аналогична активности 9B12.

ПРИМЕР 6. Способность OX40mAb24 вызывать эффекторную функцию

[0315] В этом примере OX40mAb24 оценивали в отношении его способности вызывать Fc-эффекторную функцию, а именно, способность OX40mAb24 вызывать опосредованную клетками-естественными киллерами (NK) человека антителозависимую клеточную цитотоксичность (ADCC) в отношении первичным CD4+ T-клеток человека, экспрессирующим высокие уровни OX40, или связываться с C1q, что является необходимым условием для комплементзависимой цитотоксичности (CDC) при классическом пути активации комплемента. Для оценки вклада Fc-домена IgG1 из OX40mAb24 в опосредование ADCC-активности использовали варианты OX40mAb24, содержащие либо Fc-домен IgG4P человека (mAb28), либо Fc-домене IgG1 с тройной мутацией, которая снижает связывание Fcγ RIIIa (mAb29). Также эффекторные функции OX40mAb24 сравнивали с таковыми 9B12, моноклонального антитела IgG1 мыши к OX40 человека, которое гуманизировали с получением OX40mAb24. Ритуксимаб, антитело к CD20, связывается с B-клетками, экспрессирующими CD20, и его применяли в качестве положительного контроля для экспериментов по ADCC. Поскольку первичные активированные CD4+ T-клетки человека не экспрессируют CD20, для подтверждения активности NK-клеток в системе ADCC-анализа проводили отдельный анализ с применением линии В-клеток Toledo, которая экспрессирует CD20.

6.1. МАТЕРИАЛЫ

[0316] Материалы, применяемые в данном исследовании, перечислены в таблице 7-1.

Таблица 6-1. Материалы

Наименование Источник
Белок C1q системы комплемента Quidel, Сан-Диего, Калифорния
Полная среда RPMI: RPMI-1640+10% FBS Материалы от Life Technologies, Карлсбад, Калифорния
Среда DM-L Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада
Биосенсорный чип GLC Bio-Rad, Геркулес, Калифорния
Программное обеспечение FlowJo FlowJo, Ашланд, Орегон
IL-2, рекомбинантный человеческий Preprotech, Роки-Хилл, Нью-Джерси
Проточный цитометр LSR II BD Biosciences, Сан-Хосе, Калифорния
Программное обеспечение Prism, версия 5.01 Graphpad Software, Сан-Диего, Калифорния
Пропидиум йодид (раствор 1 мг/мл) Sigma, Сент-Луис, Миссури
Программное обеспечение ProteOn Manager 2.1 Bio-Rad, Геркулес, Калифорния
Устройство ProteOn XPR36 Bio-Rad, Геркулес, Калифорния
Набор для обогащения CD4 T-клеток RosetteSep Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада
Обогащение NK-клеток человека RosetteSep Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада
Счетчик ViCell Beckman Coulter, Индианаполис, Индиана
Раствор для мечения клеток Vybrant DiO Life Technologies, Карлсбад, Калифорния
Цельная кровь, антикоагулированная гепарином натрия Программа донорства крови MedImmune, MedImmune, Гейтерсберг, Мэриленд

6.2. Анализы

6.2.1 Антителозависимая клеточная цитотоксичность

[0317] ADCC-активность OX40mAb24 по сравнению с таковой у 9B12 и моноклональных антител, содержащих Fab-фрагменты OX40mAb24 либо с Fc-доменом IgG4P, либо с Fc-доменом IgG1 человека c тройной мутацией (TM), исследовали с применением обогащенных первичных NK-клеток человека в качестве эффекторов и экспрессирующих OX40 первичных CD4+ T-клеток человека, в качестве мишеней. В качестве положительного контроля активность каждого препарата NK-клеток исследовали при помощи направляемого ритуксимабом киллинга линии В-клеток Toledo.

[0318] Для выделения первичных CD4+ T-клеток человека антикоагулированную гепарином цельную кровь, полученную от здоровых доноров в рамках программы донорства крови MedImmune, обрабатывали в соответствии со следующим протоколом. Смесь антител из набора для выделения CD4 T-клеток RosetteSep от Stem Cell Technologies (1 мл, Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада) добавляли на 20 мл цельной крови, смешивали и инкубировали в течение 20 минут (мин.) при комнатной температуре (RT). Кровь разбавляли 1:1 стерильным буфером FACS при комнатной температуре (PBS, pH 7,2, плюс 2% термоинактивированной сыворотки новорожденных телят) и наслаивали поверх среды DM-L с последующим центрифугированием в течение 20 мин. После центрифугирования лейкоцитарную пленку, содержащую CD4+ T-клетки человека, извлекали и клетки промывали один раз буфером FACS при RT и один раз полной средой RPMI при RT. Клетки подсчитывали на счетчике ViCell для определения количества и жизнеспособности клеток, и CD4+ Т-клетки суспендировали в полной среде RPMI при концентрации 1,0×106 на мл.

[0319] Первичные CD4+ T-клетки человека (1,0×106 на мл в полной среде RPMI) культивировали в увлажненном инкубаторе для культивирования тканей при 37°C и 5% CO2 в течение 48 часов с 2 мкг/мл PHA-L и 20 МЕ/мл rhIL-2 для С активации T-клеток и повышения экспрессии OX40, а затем применяли в ADCC-анализах для OX40mAb24. Все доноры на фигурах, на которые ссылаются ниже, представляли собой уникальных индивидуумов; иными словами, CD4+ T-клетки не выделяли от одного и того же донора для повторных экспериментов по ADCC.

[0320] Для различения T-клеток-мишеней или культивируемых В-клеток Toledo от очищенных NK-клеток человека в анализах цитотоксичности флуоресцентный краситель, DiO, включали в клеточную мембрану клеток-мишеней с применением раствора для мечения клеток Vybrant DiO (в соответствии с протоколом производителя для мечения клеток в суспензии). После активации и мечения с помощью DiO первичных CD4+ T-клеток человека и В-клеток Toledo эффекторные NK-клетки выделяли из антикоагулированной гепарином натрия крови из программы донорства крови MedImmune с применением того же протокола, что приведен выше для CD4+ T-клеток человека, за исключением того, что вместо l мл смеси антител из набора для выделения CD4+ T-клеток RosetteSep применяли l мл смеси антител из набора для выделения NK-клеток RosetteSep. Выделенные первичные NK-клетки человека промывали дважды теплой полной средой RPMI (RPMI-1640 плюс 10% FBS), а затем суспендировали в полной среде RPMI при концентрации 2,67×106 на мл. Аналогично, активированные первичные CD4+ T-клетки человека также промывали дважды теплой полной средой RPMI и суспендировали при концентрации 2,67×105 на мл. Затем 75 мкл первичных NK-клеток человека (200000) и 75 мкл активированных первичных CD4+ T-клеток человека (20000) вносили в лунки стерильных 96-луночных планшетов с круглодонными лунками, не обработанных для культур тканей, чтобы получить соотношения эффектор-мишень 10:1. В некоторых экспериментах полную среду RPMI (50 мкл), содержащую OX40mAb24 или контрольное mAb, добавляли для получения конечной концентрации 10 мкг/мл. В других экспериментах полную среду RPMI (50 мкл), содержащую серию 3-кратных разбавлений OX40mAb24 или контрольных mAb, что приводило к конечной концентрации 67 нМ, или серию 27-кратных разбавлений 9B12 или IgG1 человека, R347, начиная с 67 нМ, добавляли к находящимся на планшетах клеткам. Ритуксимаб (10 мкг/мл, контрольное антитело) применяли в качестве положительного контроля в лунках, содержащих меченные DiO, экспрессирующие CD20 В-клетки Toledo, вместо экспрессирующих OX40 активированных первичных CD4+ T-клеток, поскольку активированные CD4+ T-клетки не экспрессируют CD20. Клетки для ADCC-анализа осторожно осаждали центрифугированием при RT и затем культивировали в течение 24 часов.

[0321] По окончанию периода инкубации клетки осаждали центрифугированием и затем суспендировали в буфере FACS, содержащем 10 мкг/мл пропидиума йодида (PT), для анализа методом проточной цитометрии на проточном цитометре BD LSRII. Нежизнеспособные (PT-положительные) клетки среди DiO-положительных CD4+ T-клеток-мишеней или В-клеток Toledo различали с применением программного обеспечения FlowJo после компенсации флуоресценции.

[0322] Графическое представление данных для ADCC-анализов NK-клеток, в том числе определение средних значений и стандартной ошибки среднего получали с применением GraphPad Prism, версия 5.01 для Windows.

6.2.2. Связывание OX40mAb24 с C1q

[0323] Устройство ProteOn XPR36 применяли для определения связывания OX40mAb24 или 9B12 с белком C1q системы комплемента человека, очищенным из объединенных сывороток крови человека с OX40mAb24 или 9B12, с помощью поверхностного плазмонного резонанса. Для иммобилизации OX40mAb24 или 9B12 на поверхности биосенсорного чипа GLC применяли стандартное сочетание с аминами. C1q человека суспендировали в PBS/0,005% Tween 20, pH 7,4, в пяти концентрациях в диапазоне от 26 нМ до 1,6 нМ. Образцы вводили при скорости 30 мкл/мин. в течение 200 секунд, а фаза диссоциации продолжалась в течение 600 секунд. Данные сенсограмм обрабатывали с помощью программного обеспечения ProteOn Manager 2.1 (Bio-Rad) с применением аппроксимации к модели 1:1.

6.3. Результаты

[0324] Способность OX40mAb24, 9B12 и вариантов OX40mAb24 на основе IgG4P человека (mAb28) и IgG1-TM (mAb29) опосредовать ADCC исследовали при уровнях насыщения (10 мкг/мл [67 нМ]) для связывания OX40 (см. пример 2) с применением как аллогенных, так и аутологичных смесей NK-клеток и экспрессирующих OX40 клеток-мишеней (фигура 13A и фигура 14A). OX40mAb24 проявляло измеримую ADCC-активность в отношении активированных CD4+ T-клеток человека. В отличие от этого, 9B12, mAb28 и mAb29 не проявляли ADCC-активность, превышающую таковую отрицательного контроля. Антитело положительного контроля к CD20 человека (ритуксимаб) проявляло ADCC-активность при применении тех же NK-клеток, что указывает на то, что данные NK-клетки были способны к проявлению выраженной ADCC-активности (фигура 13B и фигура 14B).

[0325] В экспериментах по определению зависимости "доза-ответ" для OX40mAb24 продемонстрирована зависимая от концентрации ADCC-активность в отношении активированных CD4+ T-клеток человека (фигуры 15A-D, фигуры 16A-D, фигуры 17A-B и таблица 6-2). В отличие от этого, 9B12 не проявляло какой-либо обнаруживаемой ADCC-активности. Кроме того, контрольное mAb для IgG1 человека, R347, не проявляло какой-либо обнаруживаемой ADCC-активности, что подтверждало то, что ADCC-активность, опосредуемая OX40mAb24, зависела от вовлечения OX40 на клетках-мишенях. Антитело положительного контроля к CD20 человека также приводило к ADCC в отношении линии экспрессирующей CD20 В-клеточной лимфомы (фигура 13B и фигура 14B); это подтверждает валидность анализа. В целом, результаты данных экспериментов подтвердили, что OX40mAb24 способно к ADCC в отношении клеток-мишеней, которые культивировали в условиях, которые, как было показано ранее, приводят к стимуляции экспрессии OX40 на клеточной поверхности.

Таблица 6-2. Обобщенные результаты по эффективности ADCC под действием NK-клеток, опосредуемой OX40mAb24

Номер эксперимента Номер донора EC20 (пМ) EC50 (пМ) EC90 (пМ)
3 363 134 2380 225000
3 504 309 1370 14600
4 464 37,0 3050 3330000
4 532 111 1310 66100
5 601 54,4 501 16900
5 602 61,4 527 16000
Среднее (стандартная ошибка среднего), пМ 118 (41,1) 1520 (415) 611000 (545000)

[0326] Потенциальную возможность OX40mAb24 связываться с компонентом C1q системы комплемента человека оценивали c помощью анализа поверхностного плазмонного резонанса. В этом анализе связывание с C1q применяли в качестве упрощенного показателя активности для анализа комплементзависимой цитотоксичности (Dall'Acqua et al., J. Immunol 177:1129-1138 (2006)). 9B12 применяли в качестве антитела отрицательного контроля. Для OX40mAb24 показана зависимая от концентрации способность связываться с очищенным белком C1q человека (фигура 18A). В отличие от этого, для 9B12 не показано какого-либо обнаруживаемого связывания с белком C1q (фигура 18B).

6.4. Выводы

[0327] OX40mAb24 связывалось с C1q и вызывало NK-опосредованную ADCC в отношении активированных CD4+ T-клеток.

ПРИМЕР 7. In vitro исследования сопоставимости с применением OX40mAb24 и T-клеток макака-крабоеда и макака-резуса

[0328] В данном примере способность OX40mAb24 усиливать активацию T-клеток определяли с помощью анализов биоактивности на основе репортера с применением двух типов клеток, в которых использовали линии Т-клеток Jurkat с NFκB-люциферазным репортером, экспрессирующих OX40 макака-крабоеда (cyno)/макака-резуса. Для опосредованного Fcγ-рецептором перекрестного сшивания лекарственного соединения применяли опосредование либо с помощью линии В-клеток макака-резуса, либо с помощью экспрессирующих Fcγ-рецептор макака-резуса клеток в образце цельной крови после лизиса эритроцитов. Активацию OX40 измеряли как повышенную активность люциферазы в ответ на стимуляцию сигнального пути NFκB после активации T-клеток человека. Передача сигнала с помощью NFκB является хорошо изученным нисходящим событием при передаче сигнала от OX40, и ее можно связать с другими показателями активации T-клеток, такими как пролиферация и высвобождение цитокинов (Croft M, et al., Immunol Rev. 229:173-91 (2009)). Кроме того, способность OX40mAb24 усиливать опосредованную T-клеточным рецептором активацию (костимуляцию) T-клеток макака-резуса исследовали с помощью анализа биоактивности с применением планшета, в котором оценивали пролиферацию CD4+ T-клеток. Для демонстрации специфического вовлечения OX40 использовали изотипический контроль (IgG1 NIP228).

[0329] Параллельно, измеряли биоактивность 9B12, моноклонального антитела мыши к OX40, от которого происходит OX40mAb24, чтобы обеспечить возможность сравнения активности OX40mAb24 и 9B12 в отношении OX40, принадлежащего отличному от человека примату.

7.1. МАТЕРИАЛЫ

[0330] Материалы, применяемые в данном исследовании, перечислены в таблице 7.1.

Таблица 7-1. Материалы

Наименование Источник
Хлорид аммония StemCell Technologies, Ванкувер, Британская Колумбия
Антитело к CD3 человека, клон SP34-2 BD Biosciences, Сан-Хосе, Калифорния
Антитело к CD4-V450 человека, клон L200 BD Biosciences, Сан-Хосе, Калифорния
Антитело к CD28 человека, клон CD28.2 BD Biosciences, Сан-Хосе, Калифорния
Набор для мечения клеток с помощью CFSE Life Technologies, Карлсбад, Калифорния
Конканавалин A Sigma, Сент-Луис, Миссури
Планшет-ридер для нескольких меток Envision Perkin Elmer, Уолтем, Массачусетс
Антитело козы к Fcγ человека Jackson Immunoresearch, Вест Грув, Пенсильвания
Антитело козы к Fcγ мыши Jackson Immunoresearch, Вест Грув, Пенсильвания
Термоинактивированная фетальная бычья сыворотка Life Technologies, Карлсбад, Калифорния
Интерлейкин-2, рекомбинантный человеческий Preprotech, Роки-Хилл, Нью-Джерси
Проточный цитометр LSR II BD Biosciences, Сан-Хосе, Калифорния
Среда для фракционирования лимфоцитов (LSM) MP Biomedicals, Санта-Ана, Калифорния
Буфер MACS Miltenyi, Сан-Диего, Калифорния
Набор для выделения CD4 T-клеток отличных от человека приматов Miltenyi, Сан-Диего, Калифорния
Пропидиум йодид (раствор 1 мг/мл) Sigma, Сент-Луис, Миссури
Цельная кровь макака-резуса (индийское происхождение), антикоагулированная гепарином натрия Worldwide Primates, Майами, Флорида
Среда RPMI-1640 Life Technologies, Карлсбад, Калифорния
Раствор SteadyGlo для анализа люциферазы Promega, Мадисон, Висконсин
Счетчик ViCell Beckman Coulter, Индианаполис, Индиана

7.2. Анализы

7.2.1. Анализы биоактивности с 2 типами клеток в отношении молекулы макака-крабоеда/макака-резуса

[0331] OX40mAb24 исследовали в отношении биоактивности с применением анализа на основе репортера с применением 2 типов клеток. Поскольку аминокислотная последовательность OX40 макака-крабоеда и макака-резуса идентична, для измерения показателя агонизма OX40 (активность NFκB) применяли линию экспрессирующих OX40 макака-крабоеда/макака-резуса клеток Jurkat с NFκB-люциферазным репортером (клон B2). Для опосредования перекрестного сшивания OX40mAb24 и, вследствие этого, кластеризации OX40 на клетках Jurkat с репортером, применяли либо линию экспрессирующих Fcγ-рецептор В-клеток макака-резуса, LCL8664, либо лейкоциты из цельной крови нормального макака-резуса, которые содержат экспрессирующие FcγR клетки. Фоновую биоактивность оценивали как без добавления OX40mAb24, так и в отсутствие экспрессирующих FcγR клеток. Для демонстрации роли вовлечения OX40 на клетках с репортером вместо OX40mAb24 применяли изотипический контроль.

[0332] Биоанализ OX40mAb24 с 2 типами клеток с применением LCL8664 выполняли согласно следующему протоколу.

[0333] За день до применения экспрессирующие OX40 макака-крабоеда/макака-резуса клетки Jurkat с NFκB-люциферазным репортером, клон B2, и LCL8664 культивировали в полной среде RPMI (RPMI с 10% фетальной бычьей сыворотки [FBS] и 1% раствора антибиотиков/противогрибковых средств) для достижения плотности клеток, составляющей примерно 5×106 клеток/мл и 4×105 клеток/мл соответственно. На следующий день клетки OX40-Jurkat с репортером и LCL8664 осаждали, суспендировали в полной среде и подсчитывали с применением счетчика ViCell, перед тем как довести концентрацию клеток у обеих линий клеток до 2,5×106 в полной среде.

[0334] Клетки клона B2 и LCL8664 вносили в 96-луночный планшет с круглодонными луноками, не обработанный для культур ткани, при концентрации каждого 100000 клеток на лунку. OX40mAb24 добавляли к клеткам в виде разбавления в полной среде RPMI до конечной концентрации, начиная с 30 мкг/мл и при разбавлении с 3-кратным шагом. Аналогично, IgG1 R347 (изотипический контроль) применяли в конечной концентрации 10 мкг/мл и разбавляли с 6-кратным шагом. 9B12 и MOPC-21 (изотипический контроль) разбавляли аналогичным образом. Планшеты переносили в инкубатор при 37°C с увлажненной атмосферой, содержащей 5% CO2.

[0335] По истечении 16 часов времени инкубации 100 мкл восстановленного раствора Steady-Glo для анализа люциферазы добавляли в каждую лунку и смешивали, чтобы лизировать клетки, а затем инкубировали, чтобы сбалансировать люциферазный сигнал. Steady-Glo/лизат образца (150 мкл) переносили из каждой лунки в 96-луночный аналитический планшет с белыми стенками для детекции и считывания люминесценции с применением ридера люминесценции Envision от Perkin Elmer.

[0336] Следующий протокол применяли для получения клеток макака-резуса после лизирования эритроцитов в антикоагулированной гепарином натрия цельной крови, полученной от здорового макака-резуса индийского происхождения.

[0337] Свежую цельную кровь (5 мл) вносили в 50 мл коническую пробирку и добавляли 45 мл раствора хлорида аммония. Смесь клеток инкубировали в течение 10 минут на льду, затем осаждали и промывали полной средой RPMI, после чего клетки были готовы к применению в анализе биоактивности с 2 типами клеток.

[0338] Анализ биоактивности с 2 типами клеток с применением клеток цельной крови макака-резуса после лизирования эритроцитов выполняли, как описано в отношении линии В-клеток макака-резуса, LCL8664, однако в качестве антитела отрицательного контроля применяли IgG1 NIP228 из расчета 10 мкг/мл.

7.2.2. Анализ пролиферации CD4 T-клеток макака-резуса

[0339] Биоактивность OX40mAb24 определяли в анализе пролиферации CD4+ T-клеток с применением активированных первичных CD4+ T-клеток макака-резуса и захваченного на планшете лекарственного соединения в соответствии со следующим протоколом. CD4+ T-клетки макака-резуса, выделенные из антикоагулированной гепарином натрия цельной крови, полученной от здоровых макаков-резусов (N=2) из World Wide Primates (Майами, Флорида), применяли в качестве источника клеток-респондеров.

[0340] Свежую гепаринизированную кровь макака-резуса разбавляли с помощью PBS при комнатной температуре (RT) в соотношении 1:1. Затем 20 мл разбавленной цельной крови наслаивали на 15 мл 95% среды для фракционирования лимфоцитов (LSM) в 50 мл конической центрифужной пробирке. Кровь центрифугировали при 400 x g в течение 30 минут при комнатной температуре без торможения. Мононуклеарные клетки периферической крови собирали на поверхности раздела, дважды промывали буфером MACS от Miltenyi и осаждали. Клеточный осадок обрабатывали при помощи буфера для лизиса эритроцитов в течение 5 минут, а затем действие буфера для лизиса прекращали путем добавления полной среды RPMI. Клетки промывали и суспендировали в буфере MACS и подсчитывали с помощью счетчика ViCell для определения числа и жизнеспособности клеток.

[0341] CD4+ T-клетки макака-резуса выделяли при помощи набора Miltenyi для отличных от человека приматов в соответствии с инструкциями производителя. Затем CD4+ T-клетки подсчитывали на счетчике ViCell, суспендировали из расчета 1×106 клеток/мл в полной среде RPMI с 51 мкг/мл конканавалина A и 1000 МЕ/мл IL-2 и культивировали при 37°C и 5% CO2 в увлажненном инкубаторе в течение 2 дней для активации T-клеток и индукции экспрессии OX40. 96-луночные планшеты для анализа с круглодонными лунками, не обработанные для культур тканей, покрывали с помощью 100 мкл 2 мкг/мл антитела козы, специфического в отношении Fcγ IgG мыши, и 2 мкг/мл антитела козы, специфического в отношении Fcγ IgG человека, в PBS. Иммобилизованные антитела козы к IgG человека не добавляли в лунки, предназначенные для анализа активности растворимого OX40mAb24. Планшеты инкубировали в течение ночи при 4°C, промывали с помощью 200 мкл PBS и блокировали в течение 90 минут при 37°C с помощью 1% BSA в PBS (1% BSA/PBS). Планшеты промывали с помощью PBS и 2 нг/мл антитела к CD3 (клон SP34-2), восстановленного в 1% BSA/PBS, добавляли в планшеты на 90 минут при 37°C. Планшеты промывали с помощью PBS для удаления несвязавшегося антитела, каждое из OX40mAb24, контрольного mAb для IgG1 человека, R347, 9B12 и контрольного mAb для IgG1 мыши (клон MOPC-21) восстанавливали в 1% BSA/PBS, начиная с 1,01 мкг/мл (6,67 нМ; эксперимент 1) или 1,5 мкг/мл (10,0 нМ; эксперимент 2), и путем серийных разбавлений готовили серию 3-кратных разбавлений и затем добавляли в планшеты для анализа и инкубировали в течение 90 минут при 37°C.

[0342] Активированные первичные CD4+ T-клетки макака-резуса собирали, промывали в полной среде RPMI и концентрацию доводили до 1,0×106 жизнеспособных клеток/мл. Клетки метили сукцинимидиловым сложным эфиром карбоксифлуоресцеина (CFSE) в соответствии с инструкциями производителя, за исключением применения CFSE при концентрации 1,25 мкМ вместо рекомендованной 5 мкМ, с инкубацией в течение 10 минут при 37°C. После мечения клетки суспендировали в полной среде RPMI и концентрацию доводили до 1,0×106 на мл. Планшеты промывали с помощью PBS и в каждую лунку добавляли по 200 мкл CD4+ T-клеток (200000/лунка). Затем планшет инкубировали при 37°C в течение 3 дней.

[0343] По истечении 72 часов времени инкубации CD4+ T-клетки осаждали и промывали один раз с помощью PBS, содержащего 2% FBS (буфер FACS). Клетки суспендировали в смеси для связывания, содержащей антитело к CD4, меченное V450®, для выявления CD4+ T-клеток и пропидиум йодид (PI) для различения живых/нежизнеспособных клеток, и инкубировали в течение 30 минут. После инкубации клетки промывали в буфере FACS, ресуспендировали в буфере FACS и анализировали посредством проточной цитометрии с применением проточного цитометра LSRII и программного обеспечения FlowJo для анализа данных, форматированных согласно стандарту проточной цитометрии (FCS).

[0344] Анализ повторяли в двух независимых экспериментах с применением первичных CD4+ T-клеток макака-резуса.

[0345] Для оценки пролиферации клеток живые (отрицательные с точки зрения окрашивания пропидиум йодида) объекты гейтировали с применением программного обеспечения FlowJo и определяли процентную долю CD4+-гейтированных клеток, демонстрирующих разбавление CFSE. Специфическую активность OX40mAb24 рассчитывали путем вычитания процентной доли CD4+-гейтированных клеток, демонстрирующих разбавление CFSE, при ответе на антитело к CD3 отдельно, из процентной доли CD4+-гейтированных клеток, демонстрирующих разбавление CSFE, при ответе на антитело к CD3 вместе с OX40mAb24.

[0346] Концентрации OX40mAb24, которые обеспечивали полумаксимальные (EC50) ответы в анализе с применением клеток Jurkat с NFκB репортером и анализе с применением первичных CD4+ T-клеток макака-резуса, определяли с помощью нелинейного регрессионного анализа ("доза-ответ" в логарифмической шкале, 4 параметрическая аппроксимация кривой) в GraphPad Prism, версия 5.01 (Сан-Диего, Калифорния).

7.3. РЕЗУЛЬТАТЫ

7.3.1. Анализ биоактивности с 2 типами клеток в отношении молекулы макака-крабоеда/макака-резуса

[0347] Результаты анализов биоактивности с 2 типами клеток в отношении молекулы макака-крабоеда/макака-резуса представлены в таблице 7-2, на фигурах 19A-B, фигурах 20A-B и фигурах 21A-B. OX40mAb24 активировало сигнальный путь OX40, как оценивали по передаче сигнала NFκB, в экспрессирующих OX40 макака-крабоеда/макака-резуса Т-клетках Jurkat в присутствии линии В-клеток макака-резуса, LCL8664, при этом среднее значение EC50 составляло 1450 пМ (N=2 эксперимента). Как показано в таблице 7-2, значение EC50 активности OX40mAb24 в анализе с 2 типами клеток в отношении молекулы макака-крабоеда/макака-резуса было в 1,3 раза выше, чем в анализах с 2 типами клеток в отношении молекулы человека при применении линии В-клеток Raji, при этом 9B12 характеризовалось ограниченной активностью в анализах с 2 типами клеток в отношении молекулы макака-крабоеда/макака-резуса и значение EC50 было невозможно определить.

[0348] Кроме того, как показано в таблице 7-2, OX40mAb24 активировало сигнальный путь OX40 в Т-клетках Jurkat в присутствии цельной крови макака-резуса с лизированными эритроцитами, которая, как считали, содержала экспрессирующие Fcγ-рецептор клетки, при этом EC50 составляла 550 пМ (N=1 эксперимент). Как также видно из таблицы 7-2, значение EC50 у 9B12 в том же анализе составляло 6052 пМ, а в анализе с 2 типами клеток в отношении молекулы человека с применением линии В-клеток Raji составляло 4680 пМ.

Таблица 7-2. Средняя полумаксимальная эффективная концентрация OX40mAb24 и 9B12 в анализах биоактивности с 2 типами клеток

Исследуемый или контрольный препарат Формат анализа с 2 типами клеток
Анализ биоактивности с применением В-клеток макака-резуса LCL8664+экспрессирующих OX40 макака-крабоеда/макака-резуса клеток Jurkat с NFκB-люциферазным репортером, клон B2
[среднее значение EC50 (Std Err); n]
Анализ биоактивности с применением цельной крови макака-резуса с лизированными эритроцитами+экспрессирующих OX40 макака-крабоеда/макака-резуса клеток Jurkat с NFκB-люциферазой, клон B2
[среднее значение EC50 (Std Err); n]
Анализ биоактивности с применением В-клеток человека Raji+экспрессирующих OX40 человека клеток Jurkat с NFκB-люциферазным репортером, клон 64a
[среднее значение EC50 (Std Err); n]
OX40mAb24 1450 (204); n=2 550; n=1 1110 (92,5); n=5
IgG1 человека, R347 Активность отсутствует; n=2 NT Активность отсутствует
IgG1 человека, NIP228 NT Активность отсутствует; n=1 NT
9B12 ND 6052; n=1 4680 (1220); n=5

Std Err=стандартная ошибка среднего; n=число экспериментов. NT=не исследовали. ND=не определяли.

a Данные из примера 5.

7.3.2. Анализ пролиферации первичных С-клеток макака-резуса

[0349] Результаты анализа пролиферации первичных T-клеток макака-резуса представлены в таблице 7-3, таблице 7-4 и на фигурах 22A-D. OX40mAb24 индуцировало пролиферацию первичных CD4+ T-клеток макака-резуса, при этом среднее значение EC50 составляло 436 пМ (таблица 7-3; N=2 эксперимента). Как показано в таблице 7-5, значение EC50 для 9B12 составляло 110 пМ (таблица 7-4; N=2 эксперимента). OX40mAb24 индуцировало пролиферацию активированных первичных CD4+ T-клеток человека при подобном формате анализа, при этом среднее значение EC50 составляло 28 пМ (таблица 7-5; данные из примера 4).

Таблица 7-3. Средняя полумаксимальная эффективная концентрация OX40mAb24 в анализах пролиферации первичных CD4 T-клеток макака-резуса

Исследуемое или контрольное антитело Число экспериментов Среднее значение EC50 (Std Err)
OX40mAb24 2 436 (309)
NIP228 IgG1 2 Активность отсутствует

Std Err=стандартная ошибка среднего.

Таблица 7-4. Средняя полумаксимальная эффективная концентрация 9B12 в анализах пролиферации первичных CD4 T-клеток макака-резуса

Исследуемое или контрольное антитело Число экспериментов Среднее значение EC50 (Std Err)
9B12 2 110 (13)
IgG1 мыши, MOPC-21 2 Активность отсутствует

Std Err=стандартная ошибка среднего.

Таблица 7-5. Средняя полумаксимальная эффективная концентрация OX40mAb24 и 9B12 в анализах пролиферации CD4 T-клеток макака-резуса и человека

Исследуемое или контрольное антитело Клетки макака-резуса, среднее
(Std Err)
Клетки человека, среднее
(Std Err)
OX40mAb24 436 (309) 28 (98)
9B12 110 (13) 218 (35)

Std Err=стандартная ошибка среднего.

7.4. ВЫВОДЫ

[0350] OX40mAb24 активировало сигнальный путь OX40 в линии экспрессирующих OX40 макака-крабоеда/макака-резуса Т-клеток Jurkat с NFκB репортером в присутствии В-клеток макака-резуса или экспрессирующих Fcγ рецептор клеток, которые содержатся в цельной крови макака-резуса с лизированными эритроцитами. Кроме того, OX40mAb24 индуцировало пролиферацию первичных CD4+ T-клеток макака-резуса.

ПРИМЕР 8. Активность OX40mAb24 в мышиных моделях форм рака человека

[0351] Данный пример разрабатывали для определения того, является ли OX40mAb24 эффективным в качестве средства монотерапии при лечении форм злокачественных новообразований. Данное исследование проводили на ксенотрансплантатных моделях форм злокачественных новообразований человека совместно с аллореактивными T-клетками человека у мышей с инсулинозависимым диабетом/тяжелым комбинированным иммунодефицитом (NOD/SCID), характеризующихся ослабленным иммунитетом.

8.1. Материалы

[0352] Материалы, применяемые в данном исследовании, и их источник перечислены в таблице 8-1.

Таблица 8-1. Материалы

Наименование Источник
Среда DMEM Invitrogen, Карлсбад, Калифорния
FBS Invitrogen, Карлсбад, Калифорния
Среда для фракционирования лимфоцитов VWR, Вест Честер, Пенсильвания
PBS Invitrogen, Карлсбад, Калифорния
RPMI 1640 Invitrogen, Карлсбад, Калифорния
Набор для обогащения CD4+ T-клеток RosetteSep Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада
Набор для обогащения CD8+ T-клеток RosetteSep Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада
Среда DML RosetteSep Stem Cell Technologies, Ванкувер, Британская Колумбия, Канада
Митомицин C Sigma-Aldrich, Сент-Луис, Миссури

8.2. Протоколы экспериментов

8.2.1. Исследуемые животные

[0353] Самок мышей NOD/SCID возрастом 5-9 недель получали из Harlan Laboratories, Inc. С животными обращались гуманно и их содержали в соответствии с протоколами, одобренными Институциональным комитетом по уходу за животными и их использованию, в Центре для лабораторных животных при MedImmune, при этом Центр был лицензирован Ассоциацией по оценке и аккредитации условий содержания лабораторных животных и Министерством сельского хозяйства США. Животных содержали в стерильных микроизоляторных блоках, обеспеченных стерильной подстилкой и пищей и подкисленной питьевой водой в неограниченном количестве. Условия окружающей среды были стандартизированными (комнатная температура: 20°C +/- 1°C; относительная влажность: 50%+10%; 12-часовой цикл чередования света и темноты). Животных ежедневно контролировали в отношении неблагоприятных клинических признаков и еженедельно определяли массу тела.

8.2.2. Создание ксенотрансплантатов

[0354] Раковые клетки человека A375, происходящие из линии клеток меланомы человека, получали из ATCC. Клетки выращивали в среде DMEM с 10% FCS при 37°C в условиях 5% CO2 в увлажненном инкубаторе. Затем их собирали, промывали один раз с помощью PBS, после чего ресуспендировали в PBS.

[0355] Раковые клетки человека A375 собирали из культур клеток. Их ресуспендировали в PBS. Клетки A375 затем смешивали с линиями CD4+ и CD8+ T-клеток, аллореактивными по отношению к линиям опухолевых клеток A375, перед имплантацией животным.

[0356] Для получения линий CD4+ и CD8+ T-клеток мононуклеарные клетки из периферической крови (PBMC) человека от здоровых доноров обогащали CD4+ или CD8+ T-клетками путем добавления 1 мл продукта для обогащения Т-клеток RosetteSep на 20 мл цельной крови. После этого следовало 20-минутное инкубирование и последующее выделение с помощью центрифугирования в градиенте плотности с применением среды с градиентом плотности RosetteSep DM-L. После центрифугирования клетки 3 раза промывали PBS, дополненным 2% фетальной бычьей сыворотки (FBS), и ресуспендировали в среде RPMI1640, дополненной 10% FBS. Подвергнутые обогащению CD4+ и CD8+ T-клетки культивировали раздельно в течение 7-10 дней в среде, дополненной рекомбинантным интерлейкином 2 человека (rhIL-2), и в каждом случае объединяли с клетками A375, обработанными митомицитом С. T-клетки собирали и снова раздельно культивировали в течение 7-10 дней в среде, дополненной rhIL-2, и объединяли с клетками A375, обработанными митомицитом С. CD4+ и CD8+ Т-клетки собирали и объединяли в соотношении 2:1.

[0357] Непосредственно перед имплантацией клетки A375 и PMBC, обогащенные CD4+ и CD8+ T-клетками, смешивали в соотношении 6 клеток A375 к 1 T-клетке.

[0358] Ксенотрансплантанты создавали при помощи подкожной (SC) инъекции 3,5×106 клеток (Т-клетки человека, смешанные с клетками A375 в соотношении эффектор-мишень (E:T) 1:6 и суспендированные в 200 мкл PBS) в участок правого бока животных.

8.2.3. Рандомизация, обозначение групп и уровни доз

[0359] Перед проведением SC инъекции клеток в каждую экспериментальную группу случайным образом распределяли по шесть животных. Замен животных не производили. Обозначения групп и уровни доз для каждого эксперимента перечислены в таблице 8-2, таблице 8-3 и таблице 8-4. Исследуемые и контрольные антитела разбавляли в PBS до соответствующих концентраций и вводили внутрибрюшинно (IP) в общем объеме 200 мкл. Первую дозу исследуемых и контрольных антител вводили в день 3 или 4 после имплантации раковых/эффекторных T-клеток. Животные получали до 3 дополнительных доз исследуемых и контрольных антител, как указано на фигурах и описано в описании соответствующих фигур. Образование опухолей отслеживали у каждого животного 1 или 2 раза в неделю. Первичными конечными точками в данном исследовании служили либо объем опухоли 2000 мм3, либо макроскопический некроз опухоли.

8.2.4. Измерение опухолей

[0360] Опухоли измеряли штангенциркулем в моменты времени, указанные на фигурах и в таблицах для каждого эксперимента, а объемы опухолей (V) рассчитывали с применением следующей формулы:

V (мм3)=(длина [мм] x ширина [мм] x ширина [мм])/2.

Для каждой группы результаты приведены в виде среднего арифметического значения. Противоопухолевые эффекты выражали в виде процента подавления роста опухоли (% TGI), который рассчитывали следующим образом:

% TGI=(1 - [средний V опухоли в группе обработки] ÷ [средний V опухоли в контрольной группе]) × 100.

8.3. Статистические методы

[0361] Проводили сравнение животных, обработанных OX40mAb24 или обработанных 9B12, а также животных, обработанных изотипическим контролем, и межгрупповые различия анализировали в отношении статистической значимости при помощи критерия суммы рангов Манна-Уитни.

[0362] Значимые p-значения, полученные при помощи критерия суммы рангов Манна-Уитни, представлены в сводных таблицах и на фигурах рядом со средним арифметическим значением и стандартным отклонением среднего.

8.4. Результаты

[0363] В данном исследовании изучали активность OX40mAb24 в отношении роста опухолей в мышиных моделях рака человека. Самкам иммунодефицитных животных NOD/SCID имплантировали линии раковых клеток человека, смешанные с линиями аллореактивных CD4+ и CD8+ T-клеток человека. CD4+ и CD8+ T-клетки происходили из PBMC, выделенных от здоровых доноров-людей. Животные получали первую дозу исследуемых и контрольных антител через три или четыре дня после имплантации ксенотрансплантантов, а дополнительные дозы исследуемых и контрольных антител им вводили, как указано.

[0364] В трех отдельных экспериментах OX40mAb24 вместе с аллореактивными T-клетками человека приводило к значимому подавлению роста клеток A375, составлявшему до 85% в сравнении с группой изотипического контроля (таблица 8-2, таблица 8-3 и таблица 8-4; фигура 23A, фигура 24A и фигура 25). Контрольное 9B12 вместе с аллореактивными T-клетками человека также приводило к значимому подавлению роста клеток A375, составлявшему до 77% в сравнении с группой изотипического контроля (таблица 8-2 - таблица 8-4, фигура 23B и фигура 24B.

Таблица 8-2. Группы обработки и процент TGI в ксенотрансплантантной модели A375 в день 18 (эксперимент 2)

Группа a Исследуемое антитело Доза b (мг/кг) % TGI c
1 Отсутствует; без T-клеток NA NA
2 Отсутствует NA NA
3 Изотипический контроль 5 NA
4 OX40mAb24 5 79
5 OX40mAb24 2,5 75
6 OX40mAb24 1,0 85
7 9B12 5 53

IP=внутрибрюшинно; NA=не применимо; TGI=подавление роста опухоли; V=объем.

a Число животных в группе: 6.

b Все животные получали 200 мкл исследуемого антитела IP в дни 4, 7, 9 и 12.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний V опухоли в группе изотипического контроля)] × 100.

Таблица 8-3. Группы обработки и процент TGI в ксенотрансплантантной модели A375 в день 25 (эксперимент 1)

Группа a Исследуемое антитело Доза b (мг/кг) % TGI c
1 Отсутствует; без T-клеток NA NA
2 Отсутствует NA NA
3 Изотипический контроль 5 NA
4 OX40mAb24 5 68
5 OX40mAb24 2,5 83
6 OX40mAb24 1,0 84
7 9B12 5 80

IP=внутрибрюшинно; NA=не применимо; TGI=подавление роста опухоли; V=объем.

a Число животных в группе: 6.

b Все животные получали 200 мкл исследуемого антитела IP в дни 4, 7, 9 и 12.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний V опухоли в группе изотипического контроля)] × 100.

Таблица 8-4. Группы обработки и процент TGI в ксенотрансплантантной модели A375 в день 28 (эксперимент 3)

Группа a Исследуемое антитело Доза b (мг/кг) % TGI c
1 Отсутствует; без T-клеток NA NA
2 Отсутствует NA NA
3 Изотипический контроль 3,0 NA
4 OX40mAb24 3,0 75
5 OX40mAb24 1,0 73
6 OX40mAb24 0,3 68
7 OX40mAb24 0,1 84
8 OX40mAb24 0,03 73

IP=внутрибрюшинно; NA=не применимо; TGI=подавление роста опухоли; V=объем.

a n=6.

b Все животные получали 200 мкл исследуемого антитела IP в дни 3, 6, 8 и 10.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний V опухоли в группе изотипического контроля)] × 100.

8.5. Выводы

[0365] OX40mAb24 проявляло сильную противоопухолевую активность в мышиных моделях рака человека, в случае смешивания с аллореактивными T-клетками человека. Противоопухолевая активность OX40mAb24 была подобна противоопухолевой активности 9B12. Эти результаты предоставляют доказательство того, что OX40mAb24 может быть эффективным в качестве средства монотерапии при лечения пациентов с раком, характеризующимся инфильтратом T-клеток.

ПРИМЕР 9. Химерное IgG2a антитело крысы/мыши к OX40 мыши, клон OX86, подавляет рост линий раковых клеток мыши в сингенных моделях

[0366] OX40mAb24 не характеризуется перекрестной реакцией с (m)OX40 мыши (см. пример 2); следовательно, исследовать его активность в моделях на иммунокомпетентных мышах невозможно. OX86 представляет собой IgG1 антитело крысы к mOX40, которое специфически связывается с mOX40 и вызывает передачу сигнала с помощью него (al-Shamkhani et al., Eur. J. Immunol. 26:1695-1699 (1996)), а также характеризуется противоопухолевой активностью в моделях рака у иммунокомпетентных мышах (Weinberg AD, et al., J. Immunol. 164:2160-2169 (2000)). Для более полного изучения эффектов агонизма OX40 при применении суррогатного антитела мыши, функциональные свойства которого аналогичны OX40mAb24, из OX86 получали химерное IgG2a антитело крысы/мыши к mOX40 (OX86 mIgG2a; вариабельные области легкой и тяжелой цепи антитела крысы к OX40 с константными областями IgG2a мыши). В данном примере оценивается противоопухолевая активность OX86 mIgG2a в качестве монотерапевтического средства на трех мышиных моделях рака.

9.1. Материалы

[0367] Материалы, применяемые в данном исследовании, и их источник перечислены в таблице 9-1.

Таблица 9-1. Материалы

Наименование Источник
Фосфатно-солевой буферный раствор, pH 7,2 Life Technologies, Карлсбад, Калифорния
Фетальная бычья сыворотка, термоинактивированная Life Technologies, Карлсбад, Калифорния
Среда Мемориального института Розуэлла Парка 1640 Life Technologies, Карлсбад, Калифорния
0,25% трипсин-EDTA (1x) Life Technologies, Карлсбад, Калифорния

EDTA=этилендиаминтетрауксусная кислота.

9.2. Протоколы экспериментов

9.2.1. Исследуемые животные

[0368] Мыши BALB/c и C57BL/6 возрастом 6-8 недель поступали в MedImmune от Harlan Laboratories, Inc. (Индианаполис, Индиана), и им обеспечивали акклиматизацию в течение 3 дней перед началом исследования. Затем у мышей выбривали места имплантации опухоли и имплантировали микрочипы-транспондеры для маркировки.

[0369] Животных содержали в соответствии с протоколами, одобренными Институциональным комитетом по уходу за животными и их использованию, в Центре ресурсов лабораторных животных при MedImmune, при этом Центр был лицензирован Ассоциацией по оценке и аккредитации условий содержания лабораторных животных и Министерством сельского хозяйства США. Животных содержали в стерильных микроизоляторных блоках, обеспеченных стерильной подстилкой и пищей и подкисленной питьевой водой в неограниченном количестве. Условия окружающей среды были стандартизированными (комнатная температура: 20°C ± 1°C; относительная влажность: 50% ± 10%; 12-часовой цикл чередования света и темноты). Животных ежедневно контролировали в отношении неблагоприятных клинических признаков и раз в две недели определяли массу тела. Если отмечались паралич задних конечностей, респираторный дистресс, 20% потеря массы тела, или объем опухоли превышал 2000 мм3, животных незамедлительно гуманно умерщвляли путем удушения с помощью CO2.

9.2.2. Создание и имплантация сингенных опухолей

[0370] CT26 и 4T1 получали из ATCC, Манассас, Виргиния. Клетки MCA205 получали из Providence Cancer Center, Портленд, Орегон. Все клетки культивировали в среде для культивирования клеток RPMI 1640, дополненной 10% FBS, и выращивали при 37°C при 5% CO2 в увлаженной камере для культивирования тканей, затем собирали, промывали один раз с помощью FBS и в дальнейшем ресуспендировали в PBS.

[0371] Аллотрансплантанты создавали путем подкожной (SC) инъекции 5,0×105 клеток CT26 или 1,0×105 клеток 4T1, суспендированных в 0,1 мл PBS, в правый бок мышей линии BALB/c возрастом 7-9-недель, при этом 2,5×105 клеток MCA205, суспендированных в 0,1 мл фосфатно-солевого буферного раствора инъецировали в правый бок 7-9-неделных мышей линии C57BL/6.

9.2.3. Рандомизация, обозначение групп и уровни доз

[0372] В данном исследовании использовали самок мышей ВALB/c (всего 216) и C57BL/6 (всего 70). Мышей BALB/c, которым имплантировали опухолевые клетки CT26, распределяли случайным образом в когорты после того, как опухоли достигали среднего объема 120 мм3, через 9 дней после имплантации, или 200 мм3, через 13 дней после имплантации. Мышей BALB/c, которым имплантировали опухолевые клетки 4T1, распределяли случайным образом в когорты после того, как опухоли достигали среднего объема 120 мм3, через 13 дней после имплантации. Мышей C57BL/6 распределяли случайным образом в когорты после того, как опухоли достигали среднего объема 95 мм3, через 11 дней после имплантации. Обозначения групп, количество животных, уровни доз и режим дозирования представлены в таблице 9-2, таблице 9-3, таблице 9-4 и таблице 9-5. Все исследуемые антитела и контрольные антитела вводили путем внутрибрюшинной (IP) инъекции. Замен животных не производили.

[0373] Животных из каждой группы умерщвляли, когда объемы опухолей достигали примерно 2000 мм3 или когда опухоли становились изъязвленными или некротическими.

Таблица 9-2. План исследования: сингенная модель CT26

Группа Число животных (M/F) Обработка Режим дозирования (день исследования) Уровень дозы (мг/кг)a ROA
1 10 (F) Отсутствует NA NA IP
2 10 (F) Отрицательный контроль
(OX86 mIgG1 D265A)
9, 12 2,5 IP
3 10 (F) OX86 mIgG2a 9, 12 2,5 IP
4 10 (F) OX86 mIgG2a 9, 12 1,0 IP
5 10 (F) OX86 mIgG2a 9, 12 0,25 IP
6 10 (F) OX86 mIgG2a 9, 12 0,1 IP

F=самка; IgG1=иммуноглобулин G1; IP=внутрибрюшинно; mAb =моноклональное антитело; OX86 mIgG2a=вариабельные области легкой и тяжелой цепи антитела крысы к OX40, клон OX86, с константными областями IgG2a мыши; OX86 mIgG1 D265A=mIgG1 мыши к OX40 мыши с точковой мутацией в Fc-домене, которая снижает его способность связываться с Fcγ-рецепторами; NA=не применимо, поскольку животных не подвергали обработке; ROA=путь введения. a Объем дозы: 0,2 мл.

Таблица 9-3. План исследования: сингенная модель CT26

Группа Число животных (M/F) Обработка Режим дозирования (день исследования) Уровень дозы (мг/кг)a ROA
1 12 (F) Отсутствует NA NA IP
2 12 (F) OX86 mIgG2a 13, 16 10 IP
3 12 (F) OX86 mIgG2a 13, 16 3 IP
4 12 (F) OX86 mIgG2a 13, 16 1 IP
5 12 (F) OX86 mIgG2a 13, 16 0,3 IP
6 12 (F) OX86 mIgG2a 13, 16 0,1 IP

F=самка; IP=внутрибрюшинно; OX86 mIgG2a=вариабельные области легкой и тяжелой цепи антитела крысы к OX40, клон OX86, с константными областями IgG2a мыши; NA=не применимо, поскольку животных не подвергали обработке; ROA=путь введения. a Объем дозы: 0,2 мл.

Таблица 9-4. План исследования: сингенная модель MCA205

Группа Число животных (M/F) Обработка Режим дозирования (день исследования) Уровень дозы (мг/кг)a ROA
1 14 (F) Отсутствует NA NA IP
2 14 (F) Изотипический контроль
(смесь)b
11, 14 20 IP
3 14 (F) OX86 mIgG2a 11, 14 10 IP
4 14 (F) OX86 mIgG2a 11, 14 10 IP
5 14 (F) OX86 mIgG2a 11, 14 5 IP

F=самка; IP=внутрибрюшинно; OX86 mIgG2a=вариабельные области легкой и тяжелой цепи антитела крысы к OX40, клон OX86, с константными областями IgG2a мыши; NA=не применимо, поскольку животных не подвергали обработке; ROA=путь введения. a Объем дозы: 0,2 мл. b Смесь содержит антитела изотипического контроля с Fc-доменами из mIgG2a (10 мг/кг) и mIgG2b (10 мг/кг).

Таблица 9-5. План исследования: сингенная модель 4T1

Группа Число животных (M/F) Обработка Режим дозирования (день исследования) Уровень дозы (мг/кг)a ROA
1 12 (F) Отсутствует NA NA IP
2 12 (F) Изотипический контроль
(смесь)b
13, 16, 20, 23 70 IP
3 12 (F) OX86 mIgG2a 13, 16, 20, 23 10 IP
4 12 (F) OX86 mIgG2a 13, 16, 20, 23 5 IP
5 12 (F) OX86 mIgG2a 13, 16, 20, 23 2,5 IP
6 12 (F) OX86 mIgG2a 13, 16, 20, 23 1,0 IP
7 12 (F) OX86 mIgG2a 13, 16, 20, 23 0,25 IP

F=самка; IP=внутрибрюшинно; OX86 mIgG2a=вариабельные области легкой и тяжелой цепи антитела крысы к OX40, клон OX86, с константными областями IgG2a мыши; NA=не применимо, поскольку животных не подвергали обработке; ROA=путь введения. a Объем дозы: 0,2 мл. b Смесь содержит антитела изотипического контроля с Fc-доменами из mIgG2a (10 мг/кг), mIgG2b (20 мг/кг), IgG2a крысы (20 мг/кг) и IgG2b крысы (20 мг/кг).

9.2.4. Измерение опухолей

[0374] Опухоли измеряли штангенциркулем два раза в неделю и объемы опухолей рассчитывали с применением следующей формулы:

объем опухоли (V)=[длина (мм) x ширина (мм)2]/2,

где длину определяли как сторону большего размера, а ширину как сторону меньшего размера, перпендикулярную длине.

[0375] Противоопухолевые эффекты в каждой группе выражали в виде подавления роста опухоли (TGI), которое рассчитывали следующим образом:

% TGI=(1 - [средний V в группе обработки] ÷ [средний V в контрольной группе]) × 100.

Ответы, касающиеся роста опухоли, классифицировали как полный ответ (CR), если измеримая опухоль отсутствовала.

9.3. Статистические методы

[0376] Однофакторный ANOVA применяли для определения различий в средних объемах опухолей. В случае значимости F-критерия использовали критерий Данетта или Сидака для множественных сравнений (при необходимости). При необходимости применяли преобразование объемов опухолей с использованием десятичного логарифма, чтобы учесть гетероскедастичность. Значимым считали p-значение < 0,05.

9.4. Результаты

[0377] Обработка мышей с помощью OX86 mIgG2a приводила к значимому снижению роста опухолевых клеток CT26 и MCA205 по сравнению с контролем без обработки, или отрицательным контролем, или контрольными мышами, обработанными антителами изотипического контроля (таблица 9-6, таблица 9-7 и таблица 9-8; фигура 26A, фигура 27A и фигура 28A). Обработка мышей с помощью OX86 mIgG2a приводила к отсрочке и ослабленному росту опухолевых клеток 4T1 по сравнению с мышами без обработки или мышами, обработанными антителом изотипического контроля (таблица 9-9 и фигура 29A).

[0378] В сингенных моделях зачастую наблюдается смешанный ответ; в то же время, очень сильный ответ на обработку с помощью OX86 mIgG2a более явно выражен на графиках роста опухоли у отдельных животных (фигура 26B, фигура 27B, фигура 28B и фигура 29B). Эффект дозы не наблюдали у мышей, обработанных с помощью OX86 mIgG2a, по показателю TGI (таблица 9-6, таблица 9-7, таблица 9-8 и таблица 9-9; фигура 26A, фигура 27A, фигура 28A и фигура 29A) или применительно к увеличению числа животных, проявляющих полные ответы (таблица 9-6, таблица 9-7, таблица 9-8 и таблица 9-9).

Таблица 9-6. Группы обработки, процент подавления роста опухоли в день 22 и число полных респондеров в сингенной модели CT26

Группа a Исследуемое/контрольное антитело Доза b (мг/кг) % TGI c Число полных респондеров из 12 мышей d
1 Отсутствует NA NA 0
2 OX86 mIgG2a 10 67 8
3 OX86 mIgG2a 3 67 6
4 OX86 mIgG2a 10 75 8
5 OX86 mIgG2a 0,3 65 8
6 OX86 mIgG2a 0,1 70 8

IP=внутрибрюшинно; NA=не применимо; TGI=подавление роста опухоли; V=объем.

a n=12.

b Все животные получали 200 мкл исследуемого антитела IP в дни 13 и 16.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний V опухоли в контрольной группе)] × 100.

d Число животных в группе с показателем объема опухоли, зафиксированным как нулевой в конце исследования.

Таблица 9-7. Группы обработки, процент подавления роста опухоли в день 26 и число полных респондеров в сингенной модели CT26

Группа a Исследуемое/контрольное антитело Доза b (мг/кг) % TGI c Число полных респондеров из 10 мышей d
1 Отсутствует NA NA 1
2 Отрицательный контроль
(OX86 mIgG1 D265A)
2,5 NA 1
3 OX86 mIgG2a 2,5 94 7
4 OX86 mIgG2a 1,0 97 8
5 OX86 mIgG2a 0,25 95 6
6 OX86 mIgG2a 0,1 92 7

IP=внутрибрюшинно; NA=не применимо; TGI=подавление роста опухоли; V=объем.

a n=10.

b Все животные получали 200 мкл исследуемого антитела IP в дни 9 и 12.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний V опухоли в контрольной группе)] × 100.

d Число животных в группе с показателем объема опухоли, зафиксированным как нулевой в конце исследования.

Таблица 9-8. Группы обработки, процент подавления роста опухоли в день 22 и число полных респондеров в сингенной модели MCA205

Группа a Исследуемое/контрольное антитело Доза b (мг/кг) % TGI c Число полных респондеров из 14 мышей d
1 Отсутствует NA NA 0
2 Изотипический контроль
(смесь)
20 NA 0
3 OX86 mIgG2a 20 65 0
4 OX86 mIgG2a 10 76 4
5 OX86 mIgG2a 5 70 2

Таблица 9-9. Группы обработки, процент подавления роста опухоли в день 25 и число полных респондеров в сингенной модели 4T1

Группа a Исследуемое/контрольное антитело Доза b (мг/кг) % TGI c Число полных респондеров из 12 мышей d
1 Отсутствует NA NA 0
2 Изотипический контроль
(смесь)
70 NA 0
3 OX86 mIgG2a 10 5 0
4 OX86 mIgG2a 5 34 2
5 OX86 mIgG2a 2,5 37 0
6 OX86 mIgG2a 1,0 22 0
7 OX86 mIgG2a 0,25 ND 0

IP=внутрибрюшинно; NA=не применимо; TGI=подавление роста опухоли; V=объем; ND=не определяли.

a n=12.

b Все животные получали 200 мкл исследуемого антитела IP в дни 13, 16, 20 и 23.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний V опухоли в контрольной группе)] × 100.

d Число животных в группе с показателем объема опухоли, зафиксированным как нулевой в конце исследования.

9-5. Выводы

[0379] Обработка мышей, несущих опухоли, OX86 mIgG2a в качестве средства монотерапии приводила к противопухолевой активности, которая значимо снижала рост множества опухолей по сравнению с группами без обработки, отрицательным контролем, и/или группами, обработанными изотипическим контролем.

ПРИМЕР 10. Определение характеристик эпитопа для OX40mAb24

[0380] В данном примере исследуют эпитоп для OX40mAb24 c применением серии химерных вариантов OX40 человека/мыши.

10.1 Материалы, применяемые в данном исследовании, и их источник перечислены в таблице 10-1.

Таблица 10-1. Материалы

Наименование Источник
Антитело к IgG человека, меченное Alexa480 Invitrogen (Карлсбад, Калифорния)
Антитело к IgG овцы, меченное Alexa-480 Invitrogen (Карлсбад, Калифорния)
Антитело к IgG козы, меченное Alexa480 Invitrogen (Карлсбад, Калифорния)
Клетки FreeStyle 293F (клетки HEK293F) Invitrogen (Карлсбад, Калифорния)
Поликлональное антитело козы к OX40 мыши R&D Systems (Миннеаполис, Миннесота)
Проточный цитометр LSRII BD Biosciences (Сан-Хосе, Калифорния)
Фосфатно-солевой буферный раствор Invitrogen (Карлсбад, Калифорния)
Поликлональное антитело овцы к OX40 человека R&D Systems (Миннеаполис, Миннесота)
Реактив для трансфекции 293fectin Invitrogen (Карлсбад, Калифорния)

10.2. Получение химерных вариантов молекулы человека/мыши

[0381] OX40mAb24 специфически связывается с OX40 (SEQ ID NO: 91) и не распознает OX40 мыши (SEQ ID NO: 92), несмотря на 60% идентичность их аминокислотной (aa) последовательности (фигура 30). Химерные варианты OX40 человека/мыши конструировали путем обмена частей внеклеточного домена в OX40 человека и мыши. кДНК-конструкции OX40 человека и мыши применяли в качестве матриц в ПЦР с перекрывающимися праймерами, чтобы сконструировать химерные варианты с трансмембранным доменом для экспрессии рекомбинантных белков на клеточной поверхности. OX40 представляет собой белок массой примерно 45 кДа с тремя полными доменами с высоким содержанием цистеина (CRD) и одним усеченным доменом с высоким содержанием цистеина. Такая структура характерна для суперсемейства TNFR.

[0382] Тринадцать химерных нокаут-вариантов (KO/с потерей функции) конструировали путем замещения следующих остатков внеклеточного домена OX40 человека на соответствующие аминокислоты (aa) из OX40 мыши или аланин (фигура 31):

• • CRD1 (aa 29-65 из OX40 человека замещены на эквивалентные остатки из молекулы мыши);

• • CRD2 (aa 66-107 из OX40 человека замещены на эквивалентные остатки из молекулы мыши);

• • CRD3 (aa 108-146 из OX40 человека замещены на эквивалентные остатки из молекулы мыши);

• • CRD4+линкер (aa 147-214 из OX40 человека замещены на эквивалентные остатки из молекулы мыши);

• • CRD3+4 (aa 108-167 из OX40 человека замещены на эквивалентные им остатки из молекулы мыши);

• • A111 (aa аланин 111 из OX40 человека замещена на эквивалентный ему остаток из молекулы мыши, пролин);

• • L116 (aa лейцин 116 из OX40 человека замещена на эквивалентный ему остаток из молекулы мыши, глутамин);

• • P121 (aa пролин 121 из OX40 человека замещена на эквивалентный ему остаток из молекулы мыши, лейцин);

• • A126 (aa аланин 126 из OX40 человека замещена на эквивалентный ему остаток из молекулы мыши, валин);

• • D137 (aa аспарагиновая кислота 137 из OX40 человека замещена на эквивалентный ему остаток из молекулы мыши, аспарагин);

• • A111P121D137 (aa Ala111, Pro121 и Asp137 из OX40 человека замещены на эквивалентные остатки из молекулы мыши);

• • L116A126 (aa Leu116 и Ala126 из OX40 человека замещены на эквивалентные остатки из молекулы мыши) и

• • D117S118 (aa Asp117 и Ser118 из OX40 человека замещены на мутации в Ala).

[0383] Кроме того, пять нокин-вариантов (KI/с приобретением функции) конструировали путем привития следующих остатков из OX40 человека в OX40 мыши с применением того же способа, описываемого выше для KO-конструкций (фигура 31):

• • CRD3 (aa 108-146 из OX40 человека привиты в соответствующие области молекулы мыши);

• • A111 (aa аланин 111 из OX40 человека привита в соответствующее положение молекулы мыши);

• • L116 (aa лейцин 116 из OX40 человека привита в соответствующее положение молекулы мыши);

• • A126 (aa аланин 126 из OX40 человека привита в соответствующее положение молекулы мыши);

• • L116A126 (aa лейцин 116 и аланин 126 из OX40 человека привиты в соответствующие положения молекулы мыши).

[0384] Полученные химерные ДНК вводили в вектор экспрессии в клетках млекопитающих pEBNA для транзиентной экспрессии в клетках млекопитающих. Клетки 293F высевали при плотности 0,7×106 клеток/мл за день перед проведением трансфекции. Три с половиной микрограмма каждого вектора экспрессии трансфицировали в 5 мл клеток HEK293F с применением 5 мкл реактива для трансфекции 293fectin в соответствии с инструкциями производителя.

10.3. Определение характеристик связывания OX40mAb24 с химерными вариантами OX40

[0385] Через сорок восемь часов после трасфекции клетки HEK293F инкубировали с 1 мкг/мл OX40mAb24 в течение 1 часа на льду в PBS. Для обнаружения связанного OX40mAb24 с помощью проточной цитометрии клетки промывали 3 раза холодным PBS, инкубировали с 1 мкг/мл антитела к IgG человека, конъюгированного Alexa480, в течение 1 часа на льду и затем анализировали с применением проточного цитометра LSRII.

[0386] С помощью проточной цитометрии также контролировали уровни экспрессии всех химерных вариантов OX40; клетки инкубировали со смесью поликлональных антител овцы к OX40 человека и поликлональных антител козы к OX40 мыши из расчета 1 мкг/мл в PBS в течение 1 часа на льду. Клетки промывали 3 раза холодным PBS и затем инкубировали со смесью поликлональных антител к IgG, козы и овцы, конъюгированных с Alexa480. После 3-кратного промывания холодным PBS клетки анализировали с помощью проточного цитометра LSRII.

10.4. Результаты

[0387] Эпитоп для OX40mAb24 характеризовали с применением химерных вариантов человека/мыши. Аминокислотные последовательности OX40 человека и OX40 мыши характеризуются 60% идентичностью (фигура 30); но все же OX40mAb24 специфически связывается с OX40 человека и не распознает OX40 мыши. Эту специфичность использовали, чтобы идентифицировать эпитоп для OX40mAb24. Восемнадцать химерных вариантов были разработаны путем перестановки различных доменов из внеклеточного домена OX40 мыши в OX40 человека (KO/варианты с потерей функции) или OX40 человека в OX40 мыши (KI/варианты c приобретением функции) (фигура 31). Все варианты кодировали трансмембранный домен для экспрессии химерного белка на клеточной поверхности. Характеристики связывания OX40mAb24 с этими вариантами анализировали с помощью проточной цитометрии.

[0388] Эпитоп для OX40mAb24 был картирован в CRD3-домене OX40 человека, как определено после обмена отдельных доменов OX40 человека на домены из молекулы мыши. Связывание OX40mAb24 с OX40 человека не происходило при замещении CRD3-домена из молекулы человека на эквивалентные остатки из молекулы мыши (KO_CRD3 и KO_CRD3-4) (фигура 32A-C). Замена других CRD-доменов из молекулы человека на области из молекулы мыши не влияла на связывание OX40mAb24 (KO_CRD1, KO_CRD2 и KO_CRD4+линкер). Кроме того, привитие CRD3-домена из молекулы человека в OX40 мыши приводило к связыванию OX40mAb24 (KI_CRD3). Все варианты экспрессировались, на что указывает контроль с помощью поликлональных антител к OX40 человека и мыши (фигуры 32A-C). В этом исследования связывания также определяли характеристики mAb 9B12, исходного для OX40mAb24. 9B12 демонстрировало такие же профили связывания с данными вариантами, что и OX40mAb24, что позволяет предположить, что оба IgG распознавали один и тот же эпитоп в CRD3-домене.

[0389] Кроме того, с помощью мутирования аминокислот, которые различаются в OX40 человека и мыши в CRD3-домене идентифицировали критические остатки эпитопа, Leu116 и Ala126. Пять аминокислот, в том числе Ala111, Leu116, Pro121, Ala126 и Asp137 (фигура 30) в CRD3-домене из моекулы человека мутировали в соответствующие остатки из молекулы мыши или Ala в качестве отдельных аминокислот или различных комбинаций (фигура 31). Связывание OX40mAb24 не происходило при замещении остатков Leu116 и Ala126 из молекулы человека на эквивалентные остатки из молекулы мыши (KO_L116+A126). Кроме того, с помощью KI-вариантов/вариантов с приобретением функции подтвердили важность этих двух критических остатков. Привитие Leu116, Ala126 или их комбинации в OX40 мыши приводило к связыванию OX40mAb24.

10.5. Выводы

[0390] Эпитоп для OX40mAb24 был картирован в CRD3-домене OX40 человека, как определено с помощью химерных вариантов человека/мыши, с критическими остатками Leu116 и Ala126. Профили связывания OX40mAb24 и исходного 9B12 со всеми вариантами идентичны, что указывает на то, что они распознают один и тот же эпитоп на OX40 человека.

ПРИМЕР 11. Фармакодинамическая активность химерного IgG2a антитела крысы/мыши к OX40 мыши, клон OX86, у мышей, не подвергавшихся воздействию, и у мышей, несущих сингенные опухоли

[0391] OX86 представляет собой IgG1 антитело крысы к mOX40, которое специфически связывается с mOX40 и вызывает передачу сигнала с помощью него (al-Shamkhani et al, 1996), а также характеризуется противоопухолевой активностью в моделях рака у иммунокомпетентных мышей (Weinberg et al, 2000). Для более полного изучения эффектов агонизма OX40 с применением суррогатного антитела мыши, функциональные свойства которого подобны OX40mAb24, в данном примере использовали химерное IgG2a антитело крысы/мыши к mOX40, OX86, описанное в примере 9. В то же время, можно провести несколько параллелей между видами, например, mIgG2a и IgG1 человека зачастую считаются функционально эквивалентными, поскольку оба изотипа способны связываться с несколькими типами Fcγ-рецепторов, характеризуются к высокой аффинностью связывания с Fcγ-рецепторами и способны вызывать ADCC и связываться с C1q человека, что является необходимым условием для комплементзависимой цитотоксичности (CDC) при классическом пути активации комплемента (Stewart et al. 2014; Dall'Acqua et al, 2006). OX86 mIGg2a связывалось с OX40 мыши (см. пример 9) и его применяли в качестве антитела-агониста к OX40 мыши, суррогатного для OX40mAb24.

[0392] В данном примере изучали способность OX86 mIgG2a индуцировать T-клетки у мышей, не подвергавшихся воздействию, и у мышей, несущих опухоли, а также стимулировать их вхождение в клеточный цикл и пролиферацию. Кроме того, K167 и ICOS оценивали в качестве потенциального биомаркера агонистической активности OX40. Пролиферацию T-клеток и противоопухолевую активность определяли в двух сингенных мышиных моделях рака. Кроме того, в конечном итоге, определяли роль, которую играют активирующие (Fcγ-рецепторы I, III и IV) и/или ингибиторные (Cfγ-рецептор IIb) Fcγ-рецепторы в in vivo активности OX86 mIgG2a.

11.1. Материалы и методы

11.1.1. Получение и маркирование животных

[0393] Мыши дикого типа, BALB/c Fcgr2b-/- или Fcer1g-/-, а также C57BL/6 Fcgr2b-/- или Fcer1g-/- возрастом 6-8 недель поступали в MedImmune из Harlan Laboratories, Inc. (Индианаполис, Индиана) или из Charles River Laboratories (Великобритания), и им обеспечивали акклиматизацию в течение < 15 дней перед началом исследования. После этого мышам имплантировали микрочипы-транспондеры для маркировки индивидуальных мышей.

11.1.2. Содержание

[0394] С животными обращались гуманно и их содержали в соответствии с протоколами, одобренными Институциональным комитетом по уходу за животными и их использованию (США) и Министерства внутренних дел (Великобритания), Центре ресурсов лабораторных животных (США) и в Отделе биологических наук (Великобритания) при MedImmune, при этом Центр был лицензирован Ассоциацией по оценке и аккредитации условий содержания лабораторных животных и Министерством сельского хозяйства США. Животных содержали в стерильных микроизоляторных блоках, обеспеченных стерильной подстилкой и пищей и подкисленной питьевой водой (США) или водопроводной водой (Великобритания) в неограниченном количестве. Условия окружающей среды были стандартизированными (комнатная температура: 20°C ± 1°C (США) или 21°C ± 1°C (Великобритания); относительная влажность: 50% ± 10% (США) или 55 ± 10% (Великобритания); 12-часовой цикл чередования света и темноты). Животных ежедневно контролировали в отношении неблагоприятных клинических признаков и раз в две недели определяли массу тела. Если отмечались паралич задних конечностей, респираторный дистресс, 20% потеря веса тела, или объем опухоли превышал 2000 мм3, то животных незамедлительно гуманно умерщвляли посредством смещения шейных позвонков или путем удушения с помощью CO2.

11.1.3. Создание сингенных опухолей

[0395] Линию клеток CT26 (карцинома толстой кишки мыши) получали из ATCC, Манассас, Виргиния, а линию клеток MCA 205 (химически индуцированная саркома мягких тканей мыши) получали из Providence Cancer Center, Портленд, Орегон. Обе линии клеток поддерживали в среде RPMI 1640 +10% FBS при 37°C, 5% CO2.

[0396] Аллотрансплантанты создавали путем подкожной (SC) инъекции 5,0×105 клеток CT26, ресуспендированных в 0,1 мл PBS, в правый бок 7-9-недельных мышей дикого типа, BALB/c Fcgr2b-/- или Fcer1g-/-. Аллотрансплантанты также создавали путем SC инъекции 2,5×105 клеток MCA205, ресуспендированных в 0,1 мл PBS, в правый бок 7-9-недельных мышей дикого типа, C57BL/6 Fcgr2b-/- или Fcer1g-/-.

11.1.4. Рандомизация, обозначение групп и уровни доз

[0397] В данном исследовании применяли самок мышей дикого типа (n=70), BALB/c Fcgr2b-/- (n=36) или Fcer1g-/- (n=36), а также C57BL/6 Fcgr2b-/- (n=36) или Fcer1g-/- (n=36). Всех мышей случайным образом распределяли в группы обработки. Обозначения групп, количество животных, уровни доз и режим дозирования представлены в таблице 11-1, таблице 11-2 и таблице 11-3. Все исследуемые препараты и контрольные препараты вводили внутрибрюшинно (IP). Замен животных не производили.

[0398] Животных из каждой группы умерщвляли, когда объемы опухолей достигали примерно 2000 мм3 или когда опухоли становились изъязвленными или некротическими.

Таблица 11-1. Обозначение групп и уровни доз мышей Balb/c, не подвергавшихся воздействию

Группа Число животных (M/F) Обработка Режим дозирования (день исследования) Уровень дозы (мг/кг)a ROA
1, 9 7 (F), 7 (F) Солевой раствор 1 NA IP
3, 11 7 (F), 7 (F) Изотипический контроль
(NIP228 IgG2a)
1 20 IP
4, 12 7 (F) OX86 mIgG2a 1 20 IP
5, 13 7 (F), 7 (F) OX86 mIgG2a 1 2 IP
6, 14 7 (F), 7 (F) OX86 mIgG2a 1 0,2 IP

F=самка; M=самец; NA=не применимо; IP=внутрибрюшинно; ROA=путь введения; OX86 mIgG2a=моноклональное IgG2a антитело мыши к OX40 мыши, вариант OX86

a Объем дозы: 0,2 мл в случае солевого раствора или объема, который корректировали с учетом массы тела; 10 мл/кг для всех остальных групп.

Таблица 11-2. Обозначение групп и уровни доз в сингенной модели СТ26

Группа Число животных (M/F) Линия
мышей
Обработка Режим дозирования (день исследования) Уровень дозы (мг/кг)a ROA
1 8 (F) Balb/c
Fcgr2b-/-
Отсутствует NA NA IP
2 8 (F) Контроль
(OX86 mIgG1 D265A)
4, 7 2,5 IP
3 8 (F) OX86 mIgG2a 4, 7 2,5 IP
4 8 (F) Balb/c
Fcer1g-/-
Отсутствует NA NA IP
5 8 (F) Контроль
(OX86 mIgG1 D265A)
4, 7 2,5 IP
6 8 (F) OX86 mIgG2a 4, 7 2,5 IP

F=самка; M=самец; NA=не применимо, поскольку животных не подвергали обработке; IP=внтурибрюшинно; ROA=путь введения; OX86 mIgG2a=вариабельные области легкой и тяжелой цепи антитела крысы к OX40, клон OX86, с константными областями IgG2a мыши.

a Объем дозы: 0,2 мл.

Таблица 11-3. Обозначение групп и уровни доз в сингенной модели MCA205

Группа Число животных (M/F) Линия
мышей
Обработка Режим дозирования (день исследования) Уровень дозы (мг/кг)a ROA
1 8 (F) C57BL/6
Fcgr2b-/-
Отсутствует NA NA IP
2 8 (F) Контроль
(OX86 mIgG1 D265A)
4, 7 7,5 IP
3 8 (F) OX86 mIgG2a 4, 7 7,5 IP
4 8 (F) C57BL/6
Fcer1g-/-
Отсутствует NA NA IP
5 8 (F) Контроль
(OX86 mIgG1 D265A)
4, 7 7,5 IP
6 8 (F) OX86 mIgG2a 4, 7 7,5 IP

F=самка; M=самец; NA=не применимо, поскольку животных не подвергали обработке; IP=внтурибрюшинно; ROA=путь введения; OX86 mIgG2a=вариабельные области легкой и тяжелой цепи антитела крысы к OX40, клон OX86, с константными областями IgG2a мыши.

a Объем дозы: 0,2 мл.

11.1.5. Измерение опухолей

[0399] Опухоли измеряли штангенциркулем два раза в неделю и объемы опухолей рассчитывали с применением следующей формулы:

объем опухоли=[длина (мм) x ширина (мм)2]/2,

где длину определяли как сторону большего размера, а ширину как сторону меньшего размера, перпендикулярную длине.

[0400] Противоопухолевые эффекты в каждой группе выражали в виде подавления роста опухоли (TGI), которое рассчитывали следующим образом:

% TGI=(1 - [средний V опухоли в группе обработки] ÷ [средний V опухоли в контрольной группе]) × 100.

11.1.6. Сбор тканей и выделение отдельных клеток

11.1.6.1 Получение клеток крови мыши для анализа методом проточной цитометрии

[0401] Буфер для лизиса эритроцитов (RBCL) (2 мл) добавляли к крови (50 мкл) и инкубировали в течение 5 мин. Объемы крови, полученной путем прижизненных кровопусканий, варьировали от 20 мкл до 50 мкл. Объем крови при последнем кровопускании составлял 50 мкл. В каждый образец добавляли RPMI +10% фетальной бычьей сыворотки (FBS) (8 мл). Клетки в каждом образце осаждали (300 x g, 5 мин.), а затем ресуспендировали в 0,3 мл буфера для проточной цитометрии. Суспензии клеток (200 мкл) вносили в каждую лунку 96-луночного планшета с круглодонными лунками для окрашивания с помощью флуоресцентных антител. Объединенные групповые образцы применяли в качестве неокрашенного контроля, контроля окрашивания одним антителом, контроля изотипического окрашивания и контроля окрашивания антителами в режиме "флуоресценция минус одно" (FMO).

11.1.6.2 Выделение дренирующих лимфатических узлов и селезенок мышей и получение суспензий отдельных клеток для анализа методом проточной цитометрии

[0402] Селезенки помещали в 10 мл RPMI+1X раствор Pen/Strep и пропускали через 40 мкм фильтр для клеток. Образцы осаждали (300 x g, 5 мин.), а затем ресуспендировали в 1 мл буфера RBCL в течение 3 мин. К каждому образцу добавляли RPMI+10% FBS (9 мл). Суспензии клеток осаждали (300 x g, 5 мин.) и ресуспендировали в 1 мл буфера для проточной цитометрии. Суспензии клеток (100 мкл) вносили в каждую лунку 96-луночного планшета с круглодонными лунками для окрашивания с помощью флуоресцентных антител. Объединенные групповые образцы применяли в качестве неокрашенного контроля, контроля окрашивания одним антителом, контроля изотипического окрашивания и контроля окрашивания антителами в режиме FMO.

11.1.6.3 Получение суспензий отдельных клеток из опухоли мыши для анализа методом проточной цитометрии

[0403] Опухоли иссекали в асептических условиях из умерщвленных мышей, при этом стараясь избегать сбора соединительной ткани или кожи, и помещали в коллагеназу, разведенную сбалансированным солевым раствором Хенкса, в 6-луночные чашки. Для повышения эффективности процесса ферментативного расщепления каждую опухоль измельчали с помощью скальпеля или небольших острых ножниц на более мелкие кусочки. Измельченные фрагменты опухолей переносили в 15 мл конические пробирки и помещали на качающуюся платформу для инкубации при 37°C в течение 20-30 минут. Пять мл RPMI+10% FBS добавляли к каждому образцу, чтобы прекратить действие коллагеназы и поддержать жизнеспособность иммунных клеток. Образцы пропускали через 70 мкм фильтры и помещали в 50 мл конические пробирки. Из каждого образца отбирали аликвоту для подсчета. Остальную часть образца осаждали в центрифуге при 330 x g и ресуспендировали в буфере FACS (PBS +2% FBS) при концентрации 1×107 клеток на мл.

'

11.1.7. Анализ методом проточной цитометрии

11.1.7.1 Анализ тканей от мышей, не несущих опухоли

[0404] Суспензии отдельных клеток крови или клеток селезенки осаждали (300 x g, 5 мин.), ресуспендировали в 50 мкл раствора для блокирования Fc-области (1:50), разбавляли в буфере для проточной цитометрии eBiosciences и инкубировали в течение 10 мин. на льду. Пятьдесят микролитров флуоресцентно меченых антител (2X исходный раствор) добавляли к каждому образцу (конечный объем 100 мкл). Растворы для окрашивания одним антителом (внеклеточное мечение) добавляли из расчета 1 мкл на лунку и смеси клетки/антитела инкубировали в течение 30 мин. на льду. Клетки осаждали (300 x g, 5 мин.), промывали дважды (200 мкл буфера для проточной цитометрии на лунку, 300 x g, 5 мин.), ресуспендировали в 50 мкл буфера Fix/Penn (одна часть концентрата на три части разбавителя), а затем инкубировали в течение ночи при 4°C в темноте.

[0405] Обработанные клетки промывали дважды в 1X буфере для пермеабилизации (разбавленном в воде). Антитела для внутриклеточного мечения разбавляли в буфере для пермеабилизации (100 мкл на лунку) и добавляли к клеткам, которые затем инкубировали при комнатной температуре в темноте в течение 30 минут. Антитела для окрашивания одним маркером (внутриклеточное окрашивание) добавляли к клеткам из расчета 1 мкл на лунку в 100 мкл буфера для пермеабилизации и инкубировали в течение 30 мин. на льду в темноте. Клетки промывали один раз буфером для пермеабилизации и ресуспендировали в 3,7% растворе формальдегида (100 мкл) перед проведением анализа на проточном цитометре Canto II (BD Biosciences, Сан-Хосе, Калифорния).

11.1.7.2. Анализ тканей от мышей, несущих опухоли

11.1.7.2.1. Окрашивание клеточной поверхности

[0406] Каждый образец осажденных клеток ресуспендировали в буфере FACS. Смеси флуоресцентных антител в буфере FACS добавляли в соответствующие лунки и инкубировали в течение 20-30 минут при 4°C в темноте. Клетки промывали дважды буфером FACS, ресуспендировали в буфере FACS и анализировали на проточном цитометре LSRII (BD Biosciences, Сан-Хосе, Калифорния).

11.1.7.2.2. Внеклеточное окрашивание (фиксированные и пермеабилизированные клетки)

[0407] Каждый образец осажденных клеток ресуспендировали в 50 мкл разбавленного 1:500 флуоресцентного синего красителя для фиксации для различения живых/нежизнеспособных клеток и инкубировали в течение 15 минут при 4°C в темноте. Клетки промывали один раз буфером FACS, ресуспендировали в 30 мкл PBS+4% сыворотки крови нормальных мышей, содержащей раствора для блокирования Fc-области и инкубировали в течение 15 минут при комнатной температуре. Смеси флуоресцентных антител в буфере FACS добавляли в соответствующие лунки и инкубировали в течение 20-30 минут при 4°C в темноте. Клетки промывали дважды буфером FACS, ресуспендировали в 150 мкл свежеприготовленного рабочего раствора FoxP3 Fix/Penn и инкубировали при комнатной температуре в течение 30 минут в темноте. Клетки промывали дважды 1X буфером для пермеабилизации, ресуспендировали в 100 мкл 1X буфера для пермеабилизации, содержащего антитела для окрашивания внутриклеточных антигенов, и инкубировали при комнатной температуре в течение 30 минут в темноте. Клетки промывали один раз 1X буфером для пермеабилизации, ресуспендировали в буфере FACS и анализировали на проточном цитометре LSRII.

11.1.8. Статистические методы

[0408] Для определения различий в средних объемах опухолей и средней процентной доле клеток Ki67+ или ICOS+ применяли однофакторный ANOVA. В случае значимости F-критерия использовали критерий Данетта или Сидака для множественных сравнений (при необходимости). При необходимости применяли преобразование средних значений с использованием десятичного логарифма, чтобы учесть гетероскедастичность. Значимым считали p-значение < 0,05. GraphPad Prism 6.0 использовали для линейного регрессионного анализа, в результате которого получали линию наилучшего соответствия, которая наилучшим образом прогнозировала значение Y в зависимости от значения X, уровень статистической значимости линии и критерий согласия (r2) определенной линии наилучшего соответствия.

11.1.9. МАТЕРИАЛЫ

[0409] Материалы, применяемые в данном исследовании, и их источник перечислены в таблице 11-4 и таблице 11-5.

Таблица 11-4. Материалы

Наименование Источник
0,25% трипсин-EDTA (1X) Life Technologies, Карлсбад, Калифорния
10x буфер для пермеабилизации eBioscience, Великобритания
3,7% раствор формальдегида Sigma-Aldrich, Великобритания
40 и 70 мкм фильтры для клеток Corning Life Sciences, Тьюксбери, Массачусетс
Коллагеназа 3 типа Worthington Biochem Corp., Лейквуд, Нью-Джерси
Раствор для блокирования Fc-области eBioscience, Великобритания
Фетальная бычья сыворотка, термоинактивированная Life Technologies, Карлсбад, Калифорния
Концентрат для фиксации/пермеабилизации eBioscience, Великобритания
Разбавитель для фиксации/пермеабилизации eBioscience, Великобритания
Буфер для проточной цитометрии eBioscience, Великобритания
Набор FoxP3 Fix/Perm eBioscience, Великобритания
Забуференный солевой раствор Хэнкса Life Technologies, США
Термоинактивированная гамма-облученная FBS для нейтрализации буфера RBCL SASC Biosciences, Канзас, США
Проточные цитометры LSRII и Canto II BD Biosciences, Сан-Хосе, Калифорния
Сыворотка крови нормальных мышей Jackson Labs, Бар Харбор, Майами
Раствор Pen/Strep Life Technologies, Великобритания
Буфер для пермеабилизации eBiosciences, США
Фосфатно-солевой буферный раствор, pH 7,2 Life Technologies, Карлсбад, Калифорния
Буфер для лизиса эритроцитов Sigma, Великобритания
Среда Мемориального института Розуэлла Парка 1640 Life Technologies, Карлсбад, Калифорния

Таблица 11-5. Флуоресцентные антитела для исследований методом проточной цитометрии

Наименование Источник
IgG2a крысы к CD4, конъюгированное с APC eBiosciences, Великобритания
mIgG2a к MHC2, конъюгированное с FITC eBiosciences, США
IgG2a крысы к CD8, конъюгированное с APC-H7 BD Biosciences, Великобритания
IgG2a крысы к Ki67, конъюгированное с EFluor 480 eBioscience, Великобритания
Изотипический контроль для IgG2a крысы, конъюгированный с APC eBioscience, Великобритания
Изотипический контроль для IgGa крысы, конъюгированный с APC-H7 BD Biosciences, Великобритания
Изотипический контроль для IgG2a крысы, конъюгированный с eFluor eBioscience, Великобритания
Изотипический контроль для IgG2b крысы, конъюгированный с PE eBioscience, Великобритания
rlgG2a к Ki67, конъюгированное с PECy7 eBioscience, США
rlgG2a к CD4, конъюгированное с BV605 Biolegend, США
rlgG2a к CD8, конъюгированное с BV711 Biolegend, США
Fixable Blue Life Technologies, США
Изотипический контроль для rlgG2a, конъюгированный с PeCy7 Biolegend, США

11.2. РЕЗУЛЬТАТЫ

[0410] Обработка мышей, не подвергавшихся воздействию, путем внутрибрюшинного введения IgG2a мыши-антитела OX86 к OX40 (OX86 mIgG2a) приводила к значимому, дозозависимому и временному повышению процентной доли Ki67+ CD4+ и ICOS+CD4+ T-клеток в крови в течение некоторого времени в сравнении с мышами, обработанными контрольными препаратами (фигуры 33A и C). Самую большую процентную долю Ki67+ CD4+ и ICOS+CD4+ T-клеток обнаруживали в день 10. Значимое увеличение процентной доли Ki67+CD4+ и ICOS+CD4+ T-клеток обнаруживали в селезенках мышей в день 10 после введения OX86 mIgG2a в сравнении с мышами, обработанными контрольными препаратами (фигуры 33B и D). Статистически значимую и сильную корреляцию между процентной долей Ki67+CD4+ T-клеток и ICOS+CD4+ T-клеток в крови и селезенке выявляли в день 10 (фигуры 34A и 34B).

[0411] Обработка мышей, не подвергавшихся воздействию, OX86 mIgG2a также приводила к значимому временному повышению процентной доли Ki67+ CD8+ T-клеток в крови в течение некоторого времени в сравнении с мышами, обработанными контрольными препаратами (фигура 35A). Повышение процентной доли ICOS+CD8+ T-клеток в крови в течение некоторого времени (фигура 35C) и процентной доли Ki67+CD8+ T-клеток в селезенке в день 10 (фигура 35B) выявляли после обработки с помощью OX86 mIgG2a, однако они не были статистически значимыми в сравнении с обработкой контрольными препаратами. Обработка мышей, не подвергавшихся воздействию, OX86 mIgG2a действительно индуцировала значимое дозозависимое повышение процентной доли ICOS+CD8+ T-клеток в селезенке в день 10 в сравнении с мышами, обработанными контрольными препаратами (фигура 35D). Выявляли умеренные, но значимые корреляции между процентной долей Ki67+CD8+ T-клеток и ICOS+CD8+ T-клеток в крови и селезенке (фигуры 36A и 36B).

[0412] Обработка с помощью OX86 mIgG2a в качестве монотерапевтического средства мышей дикого типа, несущих опухоли, приводила к противоопухолевой активности, которая снижала рост двух гистологически различных опухолей в сравнении с группами без обработки и группами, обработанными изотипическим контролем (см. пример 9). Обработка с помощью OX86 mIGg2a приводила к значимо сниженному росту опухолей MCA205 в день 20 (фигура 38A, таблица 11-7) в сравнении с обработкой контрольными препаратами у мышей линии C57BL/6, которые были получены с помощью генной инженерии, направленной на отсутствие экспрессии ингибиторного Fcγ-рецептора IIB (мыши Fcgr2b-/-). Идентичная обработка мышей с опухолями CT26 приводила к сниженному росту опухолей, который не достигал статистической значимости в день 18 (фигура 37A, таблица 11-6) в сравнении с обработкой контрольными препаратами у мышей линии Fcgr2b-/-BALB/c. Подавления роста не наблюдали, под действием какого-либо средства, у мышей Balb/c и C57BL/6, несущих опухоли, полученных с помощью генной инженерии, направленной на отсутствие экспрессии активирующих Fcγ-рецепторов (мыши Fcer1g-/-; фигура 37C; фигура 38C). В сингенных моделях зачастую наблюдается смешанный ответ. Однако противоопухолевый ответ после обработки с помощью OX86 mIgG2a в двух различных линиях мышей с нокаутом Fcγ-рецептора также можно было рассмотреть на графиках роста опухоли отдельных животных (фигуры 37B и D; фигуры 38B и D); обработка с помощью OX86 mIgG2a приводила к подавлению роста опухоли CT26 и MCA205 и в некоторых случаях индуцировала полные ответы у мышей Fcgr2b-/- (фигура 37B; фигура 38B).

Таблица 11-6. Группы обработки, процент TGI и число полных респондеров в сингенной мышиной модели CT26

Группа a Исследуемый/контрольный препарат Доза b (мг/кг) Линия мышей % TGI c Число полных респондеров из 8 мышей d
1 Отсутствует NA Balb/c Fcgr2b-/- NA 0
2 Изотипический контроль 2,5 мг/кг NA 0
3 OX86 mIgG2a 2,5 мг/кг 15 0
4 Отсутствует NA Balb/c Fcer1g-/- NA 0
5 Изотипический контроль 2,5 мг/кг NA 0
6 OX86 mIgG2a 2,5 мг/кг < 0 0

TGI=подавление роста опухоли; NA=не применимо; IP=внутрибрюшинно; V=объем.

a Число животных в группе: 8.

b Все животные получали 200 мкл исследуемого препарата IP в дни 4 и 7.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний объем V в контрольной группе)] × 100; рассчитано в день 18 для мышей Fcgr2b-/- и в 16 день для мышей Fcer1g-/-.

d Число животных в группе с показателем объема опухоли, зафиксированным как нулевой в конце исследования.

Таблица 11-7. Группы обработки, процент TGI в день 20 и число полных респондеров в сингенной мышиной модели MCA205

Группа a Исследуемый/контрольный препарат Доза b (мг/кг) Линия мышей % TGI c Число полных респондеров из 8 мышей d
1 Отсутствует NA C57BL/6 Fcgr2b-/- NA 0
2 Изотипический контроль 7,5 мг/кг NA 0
3 OX86 mIgG2a 7,5 мг/кг 95 8
4 Отсутствует NA C57BL/6 Fcer1g-/- NA 0
5 Изотипический контроль 7,5 мг/кг NA 0
6 OX86 mIgG2a 7,5 мг/кг 35 1

TGI=подавление роста опухоли; NA=не применимо; IP=внутрибрюшинно; V=объем.

a Число животных в группе: 8.

b Все животные получали 200 мкл исследуемого препарата IP в дни 4 и 7.

c % TGI=[1 - (средний V опухоли в группе обработки) ÷ (средний V опухоли в контрольной группе)] × 100

d Число животных в группе с показателем объема опухоли, зафиксированным как нулевой в конце исследования.

[0413] В параллельных исследованиях фармакодинамики обработка с помощью OX86 mIgG2a в сравнении с контрольными препаратами вызывала значимое повышение процентной доли Ki67+CD4+ T-клеток в селезенке (фигура 39A) и Ki67+CD8+ T-клеток в периферической крови и селезенке, но не в опухоли (фигура 40A) у мышей Balb/c Fcgr2b-/-, несущих опухоли CT26. Повышения Ki67+ CD4+ или CD8+ T-клеток в крови, селезенке или опухоли у мышей Balb/c Fcer1g-/-, несущих опухоли CT26, после обработки с помощью OX86 mIgG2a в сравнении с обработкой контрольными препаратами не выявляли (фигура 39B; фигура 40B).

[0414] Кроме того, в параллельных исследованиях обработка с помощью OX86 mIgG2a в сравнении с обработкой контрольными препаратами вызывала значимое повышение процентной доли Ki67+CD4+ T-клеток в дренирующем лимфатическом узле, селезенке и опухоли (фигура 41A) и Ki67+CD8+ T-клеток в дренирующем лимфатическом узле и селезенке (фигура 42A) у мышей C57BL/6 Fcgr2b-/-, несущих опухоли MCA205. Повышение процентной доли Ki67+CD8+ T-клеток в опухоли у мышей C57BL/6 Fcgr2b-/-, несущих опухоли MCA205, не было статистически значимым (фигура 42A). Обработка с помощью OX86 mIgG2a в сравнении с обработкой контрольными препаратами также индуцировала значимое повышение процентной доли Ki67+CD4+ T-клеток в дренирующем лимфатическом узле и селезенке мышей C57BL/6 Fcer1g-/-, несущих опухоли MCA205 (фигура 41B). Также наблюдали значимое повышение процентной доли Ki67+CD8+ T-клеток в селезенке этих мышей (фигура 42B). Значимого повышения процентной доли Ki67+CD4+ T-клеток в опухоли (фигура 42B) или Ki67+CD8+ T-клеток в дренирующем лимфатическом узле или опухоли у мышей C57BL/6 Fcgr2b-/-, несущих опухоли MCA205, не выявляли (фигура 42B).

11.3. ВЫВОДЫ

[0415] Однократная доза OX86 mIgG2a у мышей, не подвергавшихся воздействию, индуцировала временное повышение активации и пролиферации T-клеток, определяемых на основании повышенной экспрессии ICOS и Ki67 соответственно. Обнаружили значимую линейную корреляцию между процентной долей ICOS и Ki67 на CD4+ и CD8+ T-клетках. Противоопухолевая активность OX86 mIgG2a, определяемая по подавлению роста опухолей CT26 и MCA205, была зависима от экспрессии активирующих Fcγ-рецепторов I, III и IV, но не ингибиторного Fcγ-рецептора IIB. Повышение пролиферации T-клеток (Ki67) в периферической крови, дренирующем лимфатическом узле и/или селезенке наблюдали в параллельных фармакодинамических экспериментах у несущих опухоли мышей, в которых экспрессировались активирующие Fcγ-рецепторы; небольшую пролиферацию T-клеток наблюдали у мышей, в которых экспрессировался только ингибиторный Fcγ-рецептор. С учетом результатов фармакодинамических исследований, полученных на мышах, не подвергавшихся обработке, и без привязки к какой-либо конкретной теории, следует отметить, что потенциальным механизмом противоопухолевой активности OX86 mIgG2a является повышение пролиферации периферических и внутриопухолевых T-клеток (Ki67). Кроме того, in vivo противоопухолевая активность OX86 mIgG2a наблюдается при экспрессии активирующих Fcγ-рецепторов.

ПРИМЕР 12. Фармакодинамические изменения T-клеток в ответ на терапию OX40mAb24 у мышей, характеризующихся ослабленным иммунитетом, с приживленными гемопоэтическими стволовыми клетками человека

[0416] В данном примере изучали, может ли OX40mAb24 активировать CD4+ и CD8+ T-клетки памяти человека и вызывать их экспансию или снижать число Treg человека у мышей, характеризующихся ослабленным иммунитетом, с воспроизведенной иммунной системой человека. OX40mAb24 исследовали на in vivo мышиной модели с иммунной системой, воспроизведенной с помощью иммунных клеток человека, чтобы определить, оказывает ли данное лекарственное средство иммуномодулирующие эффекты на T-клетки человека.

12.1. МАТЕРИАЛЫ И МЕТОДЫ

12.1.1. Исследуемые животные

[0417] Мышей Nod.Cg-PrkdcscidIl2rgtm1Wy/SzJ (NSG) (n=14, возрастом 23-26 недель) получали из Jackson Laboratory. С животными обращались гуманно и содержали их в соответствии с протоколами, одобренными Институциональным комитетом по уходу за животными и их использованию, в Центре ресурсов лабораторных животных при MedImmune, при этом Центр был лицензирован Ассоциацией по оценке и аккредитации условий содержания лабораторных животных и Министерством сельского хозяйства США. Животных содержали в стерильных микроизоляторных блоках, обеспеченных стерильной подстилкой и пищей и подкисленной питьевой водой в неограниченном количестве. Условия окружающей среды были стандартизированными (комнатная температура: 20°C ± 1°C; относительная влажность: 50% ± 10%; 12-часовой цикл чередования света и темноты). Животных ежедневно контролировали в отношении неблагоприятных клинических признаков на протяжении всего хода исследования.

12.1.2. Фармакодинамика OX40mAb24 у мышей с приживленными HSC (гуманизированных)

12.1.2.1. Создание мышей с приживленными HSC человека

[0418] Мышей с приживленными CD34+ HSC человека приобретали в Jackson Laboratory. Мышей получали следующим образом: CD34+ клетки человека, объединенные от нескольких доноров пуповинной крови, выделяли и инъецировали внутривенно в хвостовую вену мышей Nod.Cg-Prkdcscid112rgtm1Wy/SzJ (NSG). Через 12 недель после приживления собирали образцы периферической крови мышей и их лизировали с помощью буфера для лизиса эритроцитов Pharm Lyse, а затем анализировали с помощью проточной цитометрии в отношении CD45-, CD19- и CD3-положительных клеток человека, чтобы определить показатель приживления иммунных клеток человека у мышей. Мышей с успешным приживлением при показателе 25% или более CD45+ иммунных клеток человека от всех жизнеспособных клеток крови затем отправляли в MedImmune.

12.1.2.2. Антигенная стимуляция и обработка с помощью OX40mAb24 мышей с приживленными HSC человека

[0419] Устойчивое приживление иммунных клеток человека у мышей NSG подтверждали с помощью проточной цитометрии через 22 недели после инъекции CD34 клеток человека, а через 23 недели мышей распределяли на 3 группы, которые оставляли без обработки или обрабатывали (таблица 12-1). Статистически значимые различия в средней процентной доле приживления CD45+ клеток человека между группами последующей обработки в момент 22 недели перед началом эксперимента отсутствовали. Группа 1 состояла из 4 мышей, и у них не проводили подкожную (SC) иммунизацию гемоцианином моллюска Megathura crenulata (KLH) или введение антитела. Группа 2 состояла из 5 мышей, и им вводили 300 мкг/50 мкл KLH и 50 мкл полного адъюванта Фрейнда (CFA) в два независимых участка при помощи SC инъекции. Эта группа мышей также получала 2 мг/кг антитела изотипического контроля для hIgG1, вводимого внутрибрюшинно (IP), через один день после иммунизации с помощью KLH. Группа 3 состояла из 5 мышей, и их SC иммунизировали с помощью KLH/CFA, как описано выше. Кроме того, на день позже мышам также вводили одну IP дозу 2 мг/кг OX40mAb24. В день SC иммунизации с помощью KLH/CFA, перед иммунизацией (до обработки) и спустя семь дней (после обработки) получали образцы цельной крови путем забора крови из ретроорбитального сплетения, и клетки подвергали иммунофенотипированию и подсчету с помощью проточной цитометрии.

Таблица 12-1. Экспериментальные группы, приживление CD45+ клеток человека и обработка

Группа Номер мыши Клетки CD45+ человека в виде
процентной доли от общего количества
жизнеспособных клеток человека вместе с
клетками CD45 мышиa
- 22 неделя после приживления
HSC
Обработкаb
- 23 неделя после приживления
HSC
1 1-1 4575 39,5 Отсутствует
1 1-2 4576 68,3 Отсутствует
1 1-3 4577 20,9 Отсутствует
1 1-4 4578 23,8 Отсутствует
2 2-1 4579 29,6 Иммунизация с помощью KLH +
huIgG1 NIP228
2 2-2 4580 21,7 Иммунизация с помощью KLH +
huIgG1 NIP228
2 2-3 4581 27,8 Иммунизация с помощью KLH +
huIgG1 NIP228
2 2-4 4582 50,3 Иммунизация с помощью KLH +
huIgG1 NIP228
2 2-5 4583 32,5 Иммунизация с помощью KLH +
huIgG1 NIP228
3 3-1 4584 15,4 Иммунизация с помощью KLH +
OX40mAb24
3 3-2 4585 44,3 Иммунизация с помощью KLH +
OX40mAb24
3 3-3 4586 20,3 Иммунизация с помощью KLH +
OX40mAb24
3 3-4 4587 16,3 Иммунизация с помощью KLH +
OX40mAb24
3 3-5 4588 25,6 Иммунизация с помощью KLH +
OX40mAb24

Hu=человек; KLH=гемоцианин моллюска Megathura crenulata; HSC=гемопоэтические стволовые клетки.

a CD45+ клетки человека определяли с помощью проточной цитометрии; b иммунизация с помощью KLH, гемоцианина моллюска Megathura crenulata, совместно с полным адъювантом Фрейнда.

12.1.2.3. Анализ иммунных клеток методом проточной цитометрии

[0420] Клетки подвергали иммунофенотипированию с помощью проточной цитометрии при применении протокола связывания антител с цельной кровью. Вкратце, постоянный объем антикоагулированной EDTA цельной крови вносили в лунки планшета с глубокими лунками и к клеткам добавляли мастер-микс для окрашивания T-клеток для связывания антигенов клеточной поверхности. После промывок в буфере FACS (PBS, pH 7,2, плюс 2% термоинактивированной сыворотки новорожденных телят) эритроциты (RBC) лизировали при помощи 1X буфера для лизиза RBC и клетки фиксировали и пермеабилизировали с применением набора для фиксации и пермеабилизации EBiosciences в соответствии с протоколом производителя. Затем клетки подвергали связыванию с mAb к FoxP3 и mAb к Ki67. Клетки промывали 1X буфером для фиксации и пермеабилизации, ресуспендировали в буфере FACS и объекты анализировали с применением проточного цитометра LSRII. Первичные данные стандартного формата проточной цитометрии (FCS) анализировали с применением программного обеспечения FlowJo и популяции клеток идентифицировали после различения живых/погибших клеток и удаления дублетов и клеточного дебрис. После гейтирования по популяциям CD4+ и CD8+ T-клеток T-клетки памяти определяли по профилю экспрессии CD45RA и CCR7, при этом наивные T-клетки определяли как CD45RA+/CCR7+, эффекторные T-клетки (Teff) как CD45RA+/CCR7-, эффекторные T-клетки памяти (Tem) как CD4SRA-/CCR7-, а центральные T-клетки памяти (Tcm) как CD45RA-/CCR7+. Treg определяли как CD4+/FoxP3+ клетки.

12.1.2.4. Статистические методы

[0421] Программное обеспечение GraphPad Prism для Windows (версия 6.03) применяли для графического представления и статистического анализа данных.

[0422] Для сравнения различий между средними значениями у экспериментальных групп применяли однофакторный ANOVA с апостериорным критерием Тьюки для множественных сравнений. В случае значимости F-критерия использовали критерий Сидака для множественных сравнений. Значимым считали p-значение меньше 0,05.

12.1.3. Материалы

[0423] Материалы, применяемые в данном исследовании, и их источник перечислены в таблице 12-2.

Таблица 12-2. Материалы

Наименование Источник
Конъюгированное с APC антитело к CCR7 человека, клон 150503 R&D Systems, Миннеаполис, Миннесота
Конъюгированное с APC антитело к CD14 человека, клон M5E2 Biolegend, Сан-Диего, Калифорния
Конъюгированное с PE антитело к CD16 человека, клон 1243 Biolegend, Сан-Диего, Калифорния
Конъюгированное с FITC антитело к CD25 человека, клон M-A251 Biolegend, Сан-Диего, Калифорния
Конъюгированное с FITC антитело к CD3 человека, клон UCHT1 Biolegend, Сан-Диего, Калифорния
Конъюгированное с BV605 антитело к CD4 человека, клон RPA-T4 Becton Dickinson, Сан-Хосе, Калифорния
Конъюгированное с FITC антитело к CD56 человека, клон HCD56 Biolegend, Сан-Диего, Калифорния
Конъюгированное с PE-CF594 антитело к CD8 человека, клон RPA-T8 Becton Dickinson, Сан-Хосе, Калифорния
Конъюгированное с APC антитело к CD19 человека, клон HIB19 Biolegend, Сан-Диего, Калифорния
Конъюгированное с PE-CF594 антитело к CD19 человека, клон HIB19 Becton Dickinson, Сан-Хосе, Калифорния
Конъюгированное с PE антитело к CD45 человека, клон HI30 Biolegend, Сан-Диего, Калифорния
Конъюгированное с PE антитело к CD45 человека, клон HI30 Biolegend, Сан-Диего, Калифорния
Конъюгированное с PE антитело к FoxP3 человека, клон PHC101 eBioscience, Сан-Диего, Калифорния
Конъюгированное с BV421 антитело к HLA-DR человека, клон 3G8 Biolegend, Сан-Диего, Калифорния
Конъюгированное с FITC антитело к Ki67 человека, клон B56 Becton Dickinson, Сан-Хосе, Калифорния
Конъюгированное с PE-Cy7 антитело к CD16/32 мыши Biolegend, Сан-Диего, Калифорния
Конъюгированное с PE-Cy7 антитело к CD45 мыши, клон 30F11 Biolegend, Сан-Диего, Калифорния
Полный адъювант Фрейнда (CFA) DifcoTM Becton Dickinson, Сан-Хосе, Калифорния
Набор для фиксации и пермеабилизации EBiosciences EBioscience, Сан-Диего, Калифорния
Программное обеспечение FlowJo FlowJo, Ашланд, Орегон
Концентрат и разбавитель для фиксации/пермеабилизации FoxP3/фактора транскрипции eBioscience, Сан-Диего, Калифорния
Программное обеспечение Graphpad Prism, версия 6.03 Graphpad Software, Сан-Диего, Калифорния
Термоинактивированная сыворотка новорожденных телят Life Technologies, Фредерик, Мэриленд
Гемоцианин моллюска Megathura crenulata Thermo Fisher Scientific, Уолтгем, Массачусетс
Синий фиксирующий краситель для различения живых/погибших клеток® Life Technologies, Фредерик, Мэриленд
Проточный цитометр LSR II BD Biosciences, Сан-Хосе, Калифорния
Изотипический контроль для IgG2a мыши, конъюгированный с APC eBioscience, Сан-Диего, Калифорния
Изотипический контроль для IgG2b мыши, конъюгированный с BV421 Biolegend, Сан-Диего, Калифорния
Изотипический контроль для IgG1 мыши, конъюгированный с FITC Biolegend, Сан-Диего, Калифорния
Фосфатно-солевой буферный раствор (PBS), pH 7,2 Life Technologies, Фредерик, Мэриленд
Изотипический контроль для IgG1 крысы, конъюгированный с PE-CF594 Becton Dickinson, Сан-Хосе, Калифорния
Изотипический контроль для IgG2a крысы, конъюгированный с PE eBioscience, Сан-Диего, Калифорния
Изотипический контроль для IgG2a крысы, конъюгированный с PE-Cy7 Biolegend, Сан-Диего, Калифорния

12.2. РЕЗУЛЬТАТЫ

[0424] OX40mAb24 или контрольное антитело huIgG1 вводили через один день после иммунизации с помощью KLH. Через шесть дней после введения OX40mAb24 наблюдали статистически значимое снижению процентной доли Treg в периферической крови в сравнении с группой, которой вводили антитело изотипического контроля huIgG1 (p=0,019, однофакторный ANOVA; фигуры 43A и 43B). Различия в процентных долях Treg между группами обработки перед иммунизацией и введением антитела не отсутствовали.

[0425] В дополнение к значимому снижению процентной доли Treg в периферической крови, происходило статистически значимое повышение соотношения CD4+ Tem:Treg после обработки OX40mAb24 в сравнении с обработкой изотипически сходным контролем huIgG1 (p=0,042), а также наблюдались тенденции значительных повышений соотношений суммарные CD4+:Treg (p=0,051), CD4+ Teff:Treg (p=0,10) и CD4+ Tem:Treg (p=0,069) (фигуры 44A-D). Аналогично, тенденцию в направлении значимости наблюдали для повышения соотношения CD8+ Teff:Treg (p=0,064) в периферической крови мышей, обработанных с помощью OX40mAb24, в сравнении с мышами, обработанными изотипическим контролем huIgG1 (фигуры 45A-B).

[0426] Экспрессия CD25 (рецептора IL-2) на T-клетках повышалась после их активации, и он считается маркером недавно активированных T-клеток. Повышение процентных долей CD25-положительных CD8+ T-клеток наблюдали для группы обработки OX40mAb24 в сравнении с группе обработки huIgG1 для суммарных CD8+ T-клеток (p=0,038), эффекторных CD8+ T-клеток (p=0,076) и для эффекторных CD8+ T-клеток памяти (p=0,040) (фигуры 46A-C). Следовательно, агонистическое действие OX40mAb24 на OX40 активировало CD8+ T-клетки в сравнении с контрольным антителом.

12.3. ВЫВОДЫ

[0427] У мышей с приживленными иммунными клетками человека обработка с помощью OX40mAb24 после иммунизации антигеном приводила к сниженному числу периферических Treg клеток в сравнении с мышами, получавшими контрольного антитело для IgG1 человека. В отличие от этого, отношение суммарных, эффекторных и CD4+ T-клеток памяти и эффекторных CD8+ T клеток к Treg клеткам также повышалось в периферической крови мышей, получавших OX40mAb24, в сравнении с получавшими контрольное антитело huIgG1. Наконец, процентная доля CD8+ T-клеток, экспрессирующих CD25 на клеточной поверхности, повышалась после обработки OX40mAb24, что свидетельствует об индукции под действием OX40 активации периферических CD8+ T-клеток.

ТАБЛИЦА ПОСЛЕДОВАТЕЛЬНОСТЕЙ

SEQ ID NO Описание Последовательность
1 9B12 VL DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSKLHSGVPSRFSGSGSRTDYSLTITDLDQEDIATYFCQQGSALPWTFGQGTKVEIK
2 LCDR1 RASQDISNYLN
3 LCDR2 YTSKLHS
4 LCDR3 QQGSALPWT
5 9B12 VH EVQLQESGPSLVKPSQTLSLTCSVTGDSFTSGYWNWIRKFPGNRLEYMGYISYNGITYHNPSLKSRISITRDTSKNHYYLQLNSVTTEDTATYFCARYRYDYDGGHAMDYWGQGTLVTVSS
6 HFW1 QVQLQESGPGLVKPSQTLSLTCAVYGGSFS
7 Вариант HFW1 QVQLQESGPGLVKPSQTLSLTCAVYGDSFS
8 HCDR1 SGYWN
9 HFW2-XXX WIRX39HPGKGLEX47X48G; где X39 представляет собой Q или K, X47 представляет собой W или Y, а X48 представляет собой I или M
10 Вариант HFW2 WIRQHPGKGLEWIG
11 Вариант HFW2 WIRKHPGKGLEYMG
12 Вариант HFW2 WIRKHPGKGLEWIG
13 Вариант HFW2 WIRKHPGKGLEYIG
14 HCDR2 YISYNGITYHNPSLKS
15 Вариант HCDR2 YISYNAITYHNPSLKS
16 Вариант HCDR2 YISYSGITYHNPSLKS
17 HFW3-XXX RITINX71DTSKNQX78SLQLNSVTPEDTAVYX91CAR; где X71 представляет собой P или R, X78 представляет собой F или Y, а X91 представляет собой Y или F
18 Вариант HFW3 RITINPDTSKNQFSLQLNSVTPEDTAVYYCAR
19 Вариант HFW3 RITINRDTSKNQYSLQLNSVTPEDTAVYFCAR
20 Вариант HFW3 RITINRDTSKNQFSLQLNSVTPEDTAVYYCAR
21 Вариант HFW3 RITINRDTSKNQFSLQLNSVTPEDTAVYFCAR
22 Вариант HFW3 RITINRDTSKNQYSLQLNSVTPEDTAVYYCAR
23 Вариант HFW3 RITINPDTSKNQYSLQLNSVTPEDTAVYFCAR
24 Вариант HFW3 RITINPDTSKNQYSLQLNSVTPEDTAVYYCAR
25 HCDR3 YRYDYDGGHAMDY
26 Вариант HCDR3 YKYDYDAGHAMDY
27 Вариант HCDR3 YKYDYDGGHAMDY
28 HFW4 WGQGTLVTVSS
29 OX40mAb VL DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSKLHSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGSALPWTFGQGTKVEIK
30 Легкая цепь OX40mAb DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSKLHSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGSALPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
31 ДНК легкой цепи OX40Mab GACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCAGCCAGGACATCAGCAACTACCTGAACTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACTACACCAGCAAGCTGCACAGCGGCGTGCCCAGCAGATTCAGCGGCAGCGGCTCCGGCACCGACTACACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCTCCGCCCTGCCCTGGACCTTTGGCCAGGGCACCAAGGTGGAAATCAAGCGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT
32 OX40mAb VL-hu2 DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAVKLLIYYTSKLHSGVPSRFSGSGSRTDYTLTISSLQPEDFATYYCQQGSALPWTFGQGTKVEIK
33 OX40mAb5 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRQHPGKGLEWIGYISYNGITYHNPSLKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
34 OX40mAb5 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGCAGCACCCCGGCAAGGGCCTGGAATGGATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCCCGACACCAGCAAGAACCAGTTCTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
35 OX40mAb8 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEWIGYISYNGITYHNPSLKSRITINRDTSKNQFSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
36 OX40mAb8VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATGGATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTTCTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
37 OX40mAb13 VH QVQLQESGPGLVKPSQTLSLTCAVYGDSFSSGYWNWIRKHPGKGLEYMGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYFCARYRYDYDGGHAMDYWGQGTLVTVSS
38 OX40mAb13 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGACAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATGGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTTCTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
39 OX40mAb14 VH QVQLQESGPGLVKPSQTLSLTCAVYGDSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYFCARYRYDYDGGHAMDYWGQGTLVTVSS
40 OX40mAb14 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGACAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTTCTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
41 OX40mAb15 VH QVQLQESGPGLVKPSQTLSLTCAVYGDSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQFSLQLNSVTPEDTAVYFCARYRYDYDGGHAMDYWGQGTLVTVSS
42 OX40mAb15 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGACAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTTCTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTTCTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
43 OX40mAb16 VH QVQLQESGPGLVKPSQTLSLTCAVYGDSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
44 OX40mAb16 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGACAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
45 OX40mAb17 VH QVQLQESGPGLVKPSQTLSLTCAVYGDSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQFSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
46 OX40mAb VH17 ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGACAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTTCTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
47 OX40mAb18 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINPDTSKNQYSLQLNSVTPEDTAVYFCARYRYDYDGGHAMDYWGQGTLVTVSS
48 OX40mAb18 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCCCGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTTCTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
49 OX40mAb19 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYFCARYRYDYDGGHAMDYWGQGTLVTVSS
50 OX40mAb19 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTTCTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
51 OX40mAb20 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
52 OX40mAb20 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
53 OX40mAb21 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINPDTSKNQYSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
54 OX40mAb21 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCCCGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
55 OX40mAb22 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNAITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDAGHAMDYWGQGTLVTVSS
56 OX40mAb22 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGCCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGCCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
57 OX40mAb23 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNAITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
58 OX40mAb23 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGCCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
59 OX40mAb24 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSS
60 OX40mAb24 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
61 OX40mAb25 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYSGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYRYDYDGGHAMDYWGQGTLVTVSS
62 OX40mAb25 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAGCGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
63 OX40mAb25a VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYSGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSS
64 OX40mAb25a VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAGCGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
65 OX40mAb26 VH EVQLQESGPSLVKPSQTLSLTCSVTGDSFTSGYWNWIRKFPGNRLEYMGYISYNAITYHNPSLKSRISITRDTSKNHYYLQLNSVTTEDTATYFCARYRYDYDGGHAMDYWGQGTLVTVSS
66 OX40mAb26 VH ДНК GAGGTGCAGCTGCAGGAAAGCGGCCCCAGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGCAGCGTGACCGGCGACAGCTTCACCAGCGGCTACTGGAACTGGATCCGGAAGTTCCCCGGCAACCGGCTCGAGTACATGGGCTACATCAGCTACAACGCCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCAGCATCACCCGGGACACCAGCAAGAACCACTACTACCTGCAGCTGAACAGCGTGACCACCGAGGACACCGCCACCTACTTTTGCGCCCGGTACAGATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
67 OX40mAb27 VH QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNAITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSS
68 OX40mA27 VH ДНК CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGCCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
69 CH-цепь IgG1 человека ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
70 ДНК CH-цепи IgG1 человека GCgTCgACCAAGGGCCCATCcGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCcTGGAACTCAGGCGCtCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTcTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCttaagCCTGTCTCCGGGTAAA
71 Тяжелая цепь OX40mAb24 QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
72 ДНК тяжелой цепи OX40mAb24 CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCgTCgACCAAGGGCCCATCcGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCcTGGAACTCAGGCGCtCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTcTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCttaagCCTGTCTCCGGGTAAA
73 Тяжелая цепь OX40mAb28 QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
74 ДНК тяжелой цепи OX40mAb28 CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCGTCGACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCTTGCAGCAGAAGCACCAGCGAGAGCACAGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACAGCGGCGCTCTGACCAGCGGCGTGCATACCTTCCCCGCCGTGCTCCAGAGCAGCGGACTGTACTCCCTGAGCAGCGTGGTGACCGTGCCTTCCAGCAGCCTGGGCACCAAGACCTACACCTGCAACGTGGACCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTGGAGAGCAAGTACGGCCCTCCCTGCCCCCCTTGCCCTGCCCCCGAGTTCCTGGGCGGACCTAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAGGACCCCGAGGTCCAGTTTAATTGGTACGTGGACGGCGTGGAAGTGCATAACGCCAAGACCAAGCCCAGAGAGGAGCAGTTCAACAGCACCTACAGAGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAATACAAGTGCAAGGTCTCCAACAAGGGCCTGCCTAGCAGCATCGAGAAGACCATCAGCAAGGCCAAGGGCCAGCCACGGGAGCCCCAGGTCTACACCCTGCCACCTAGCCAAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCTGGTGAAAGGCTTCTATCCCAGCGATATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACTCCAGACTGACCGTGGACAAGTCCAGATGGCAGGAGGGCAACGTCTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGAGCCTGAGCCTGGGCAAG
75 Тяжелая цепь OX40mAb29 QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
76 ДНК тяжелой цепи OX40mAb29 CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCGTCGACCAAGGGCCCATCCGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCcTGGAACTCAGGCGCtCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATgcCCacCGTGCCCAGCACCTGAATTCGAGGGGGGAcCGTCAGTCTTCCTCTTCCCCCCAAAACCCaaGgACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTcTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA
77 Тяжелая цепь OX40mAb31 QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNAITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
78 ДНК тяжелой цепи OX40mAb31 CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGCCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCGTCGACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCTTGCAGCAGAAGCACCAGCGAGAGCACAGCCGCCCTGGGCTGCCTGGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACAGCGGCGCTCTGACCAGCGGCGTGCATACCTTCCCCGCCGTGCTCCAGAGCAGCGGACTGTACTCCCTGAGCAGCGTGGTGACCGTGCCTTCCAGCAGCCTGGGCACCAAGACCTACACCTGCAACGTGGACCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTGGAGAGCAAGTACGGCCCTCCCTGCCCCCCTTGCCCTGCCCCCGAGTTCCTGGGCGGACCTAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGCAGAACCCCCGAGGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAGGACCCCGAGGTCCAGTTTAATTGGTACGTGGACGGCGTGGAAGTGCATAACGCCAAGACCAAGCCCAGAGAGGAGCAGTTCAACAGCACCTACAGAGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAATACAAGTGCAAGGTCTCCAACAAGGGCCTGCCTAGCAGCATCGAGAAGACCATCAGCAAGGCCAAGGGCCAGCCACGGGAGCCCCAGGTCTACACCCTGCCACCTAGCCAAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCTGGTGAAAGGCTTCTATCCCAGCGATATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACTCCAGACTGACCGTGGACAAGTCCAGATGGCAGGAGGGCAACGTCTTCAGCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGAGCCTGAGCCTGGGCAAG
79 Тяжелая цепь OX40mAb32 QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNAITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
80 ДНК тяжелой цепи OX40mAb32 CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGCCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCGTCGACCAAGGGCCCATCCGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCcTGGAACTCAGGCGCtCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATgcCCacCGTGCCCAGCACCTGAATTCGAGGGGGGAcCGTCAGTCTTCCTCTTCCCCCCAAAACCCaaGgACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTcTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA
81 Тяжелая цепь OX40mAb37 QVQLQESGPGLVKPSQTLSLTCAVYGGSFSSGYWNWIRKHPGKGLEYIGYISYNGITYHNPSLKSRITINRDTSKNQYSLQLNSVTPEDTAVYYCARYKYDYDGGHAMDYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
82 ДНК тяжелой цепи OX40mAb37 CAGGTGCAGCTGCAGGAAAGCGGCCCTGGCCTGGTCAAGCCCAGCCAGACCCTGAGCCTGACCTGTGCCGTGTACGGCGGCAGCTTCAGCAGCGGCTACTGGAACTGGATCCGGAAGCACCCCGGCAAGGGCCTGGAATACATCGGCTACATCAGCTACAACGGCATCACCTACCACAACCCCAGCCTGAAGTCCCGGATCACCATCAACCGGGACACCAGCAAGAACCAGTACTCCCTGCAGCTGAACAGCGTGACCCCCGAGGACACCGCCGTGTACTACTGCGCCCGGTACAAATACGACTACGACGGCGGCCACGCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCGaaGACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGCGGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTGACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCCGGCCAGCAGCACCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCTTGCATATGTACcGTCCCAGAAGTATCATCTGTCTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTCACCATTACTCTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCCGAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACAGCTCAGACGCAACCCCGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAGGACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAACAGTGCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCAAAGGCAGACCGAAGGCTCCACAGGTGTAtACCATTCCACCTCCCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTCTCCTGGTAAA
83 Легкая цепь OX40mAb37 DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYYTSKLHSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGSALPWTFGQGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
84 ДНК легкой цепи OX40mAb37 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCAGCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCAGCCAGGACATCAGCAACTACCTGAACTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGCTGCTGATCTACTACACCAGCAAGCTGCACAGCGGCGTGCCCAGCAGATTCAGCGGCAGCGGCTCCGGCACCGACTACACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCTCCGCCCTGCCCTGGACCTTTGGCCAGGGCACCAAGGTGGAAATCAAGCGGGCTGATGCGGCGCCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGT
85 VH OX86 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTGYNLHWVRQPPGKGLEWMGRMRYDGDTYYNSVLKSRLSISRDTSKNQVFLKMNSLQTDDTAIYYCTRDGRGDSFDYWGQGVMVTVSS
86 Тяжелая цепь OX86 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTGYNLHWVRQPPGKGLEWMGRMRYDGDTYYNSVLKSRLSISRDTSKNQVFLKMNSLQTDDTAIYYCTRDGRGDSFDYWGQGVMVTVSSASTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
87 ДНК тяжелой цепи OX86 CAGGTGCAGCTGAAGGAGTCAGGACCTGGTCTGGTGCAGCCCTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGGTTCTCACTAACCGGTTACAATTTACACTGGGTTCGCCAGCCTCCAGGAAAGGGTCTGGAGTGGATGGGAAGAATGAGGTATGATGGAGACACATATTATAATTCAGTTCTCAAATCCCGACTGAGCATCAGCAGGGACACCTCCAAGAACCAAGTTTTCTTGAAAATGAACAGTCTGCAAACGGATGACACAGCCATTTACTATTGTACCAGAGACGGGCGTGGTGACTCCTTTGATTACTGGGGCCAAGGAGTCATGGTCACAGTCTCCTCCGCGTCGACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGCGGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTGACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCCGGCCAGCAGCACCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCTTGCATATGTACCGTCCCAGAAGTATCATCTGTCTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTCACCATTACTCTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCCGAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACAGCTCAGACGCAACCCCGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAGGACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAACAGTGCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCAAAGGCAGACCGAAGGCTCCACAGGTGTATACCATTCCACCTCCCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTCTCCTGGTAAA
88 VL OX86 DIVMTQGALPNPVPSGESASITCRSSQSLVYKDGQTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYPFTFGSGTKLEIK
89 Легкая цепь OX86 DIVMTQGALPNPVPSGESASITCRSSQSLVYKDGQTYLNWFLQRPGQSPQLLTYWMSTRASGVSDRFSGSGSGTYFTLKISRVRAEDAGVYYCQQVREYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
90 ДНК легкой цепи OX86 GATATTGTGATGACCCAGGGTGCACTCCCCAATCCTGTCCCTTCTGGAGAGTCAGCTTCCATCACCTGCAGGTCTAGTCAGAGTCTGGTATACAAAGACGGCCAGACATACTTGAATTGGTTTCTGCAGAGGCCAGGACAGTCTCCTCAGCTTCTGACCTATTGGATGTCTACCCGTGCATCAGGAGTCTCAGACAGGTTCAGTGGCAGTGGGTCAGGAACATATTTCACACTGAAAATCAGTAGAGTGAGGGCTGAGGATGCGGGTGTGTATTACTGTCAGCAAGTTCGAGAGTATCCTTTCACTTTCGGCTCAGGGACGAAGTTGGAAATAAAACGGGCTGATGCGGCGCCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGT
91 OX40 человека MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
92 OX40 мыши MYVWVQQPTALLLLGLTLGVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAWRLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI

1. Выделенное антитело или его антигенсвязывающий фрагмент, которое может специфически связаться с ОХ40 человека, содержащее гуманизированную вариабельную область тяжелой цепи (VH) и гуманизированную вариабельную область легкой цепи (VL);

где VH содержит:

(а) CDR1, содержащую аминокислотную последовательность SEQ ID NO:8,

(b) CDR2, содержащую аминокислотную последовательность SEQ ID NO:14, и

(c) CDR3, содержащую аминокислотную последовательность SEQ ID NO:27,

и где VL содержит:

(d) CDR1, содержащую аминокислотную последовательность из остатков 24-34 SEQ ID NO:29,

(e) CDR2, содержащую аминокислотную последовательность из остатков 50-56 SEQ ID NO:29, и

(f) CDR3, содержащую аминокислотную последовательность из остатков 89-97 SEQ ID NO:29.

2. Антитело или его антигенсвязывающий фрагмент, которое может специфически связаться с ОХ40 человека, содержащее гуманизированную вариабельную область тяжелой цепи (VH) и гуманизированную вариабельную область легкой цепи (VL), где

VH содержит аминокислотную последовательность SEQ ID NO:59,

VL содержит аминокислотную последовательность SEQ ID NO:29.

3. Антитело или его антигенсвязывающий фрагмент по п.2, содержащее тяжелую цепь с аминокислотной последовательностью SEQ ID NO:71 и легкую область с аминокислотной последовательностью SEQ ID NO:30.

4. Антитело или его антигенсвязывающий фрагмент по п.1, где антигенсвязывающий фрагмент представляет собой фрагмент Fv, фрагмент Fab, фрагмент F(ab')2, фрагмент Fab, фрагмент dsFv, фрагмент scFv или его антигенсвязывающий фрагмент sc(Fv)2.

5. Композиция, вызывающая комплементзависимую или антителозависимую клеточную цитотоксичность в отношении экспрессирующих OX40 клеток, содержащая эффективное количество антитела или его антигенсвязывающего фрагментa по п.1 и носитель.

6. Полинуклеотид для экспрессии антитела или его антигенсвязывающего фрагмента, содержащий нуклеиновую кислоту, которая кодирует антитело или его антигенсвязывающий фрагмент по п.1.

7. Полинуклеотид по п.6, содержащий последовательность нуклеиновой кислоты SEQ ID NO:60, нуклеиновой кислоты SEQ ID NO:31, нуклеиновой кислоты SEQ ID NO:72 или их комбинацию.

8. Вектор экспрессии, содержащий полинуклеотид по п.6.

9. Клетка-хозяин для продукции антитела или его антигенсвязывающего фрагмента по п.1, содержащая полинуклеотид по п.6.

10. Способ получения антитела или его антигенсвязывающего фрагмента, включающий культивирование клетки-хозяина по п.9 в условиях, при которых экспрессируется антитело или его антигенсвязывающий фрагмент, кодируемые полинуклеотидом, и выделение антитела или его антигенсвязывающего фрагмента.

11. Клетка-хозяин для продукции антитела или его антигенсвязывающего фрагмента по п.1, содержащая вектор по п.8.

12. Способ лечения злокачественного новообразования у индивида, включающий введение индивидууму эффективного количества антитела или его антигенсвязывающего фрагмента, которое может специфически связаться с ОХ40 человека, содержащего гуманизированную вариабельную область тяжелой цепи (VH) и гуманизированную вариабельную область легкой цепи (VL);

где VH содержит:

(а) CDR1, содержащую аминокислотную последовательность SEQ ID NO:8,

(b) CDR2, содержащую аминокислотную последовательность SEQ ID NO:14, и

(c) CDR3, содержащую аминокислотную последовательность SEQ ID NO:27,

и где VL содержит:

(d) CDR1, содержащую аминокислотную последовательность из остатков 24-34 SEQ ID NO:29,

(e) CDR2, содержащую аминокислотную последовательность из остатков 50-56 SEQ ID NO:29, и

(f) CDR3, содержащую аминокислотную последовательность из остатков 89-97 SEQ ID NO:29.

13. Способ по п.12, в котором злокачественным новообразованием является солидная опухоль.

14. Способ по п.12, в котором введение антитела или его антигенсвязывающего фрагмента или композиции может ингибировать рост опухоли, способствовать уменьшению опухоли или вызывать и то и другое.

15. Способ по п.14, в котором ингибирование роста опухоли достигается в присутствии Т-клеток.

16. Способ по п.12, в котором антитело или антигенсвязывающий фрагмент, которое может специфически связаться с ОХ40 человека, содержит гуманизированную вариабельную область тяжелой цепи (VH) и гуманизированную вариабельную область легкой цепи (VL), где VH содержит аминокислотную последовательность SEQ ID NO:59 и VL содержит аминокислотную последовательность SEQ ID NO:29.

17. Способ по п.16, в котором антитело или его антигенсвязывающий фрагмент содержит тяжелую область с аминокислотной последовательностью SEQ ID NO:71 и легкую область с аминокислотной последовательностью SEQ ID NO:30.

18. Способ по п.12, в котором антигенсвязывающий фрагмент представляет собой фрагмент Fv, фрагмент Fab, фрагмент F(ab')2, фрагмент Fab, фрагмент dsFv, фрагмент scFv или его антигенсвязывающий фрагмент sc(Fv)2.

19. Способ лечения злокачественного новообразования у индивида, включающий введение индивиду эффективного количества композиции, содержащей антитело или его антигенсвязывающий фрагмент по п.1 и носитель.



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к молекуле рекомбинантной нуклеиновой кислоты для борьбы с вредителем, являющимся нематодой, а также к конструкту, вектору, клетке-хозяину, растению и семени, содержащим вышеуказанную молекулу.

Изобретение относится к области биохимии, в частности к молекуле рекомбинантной нуклеиновой кислоты для борьбы с вредителем, являющимся нематодой, а также к конструкту, вектору, клетке-хозяину, растению и семени, содержащим вышеуказанную молекулу.

Изобретение относится к области биотехнологии и молекулярной биологии. Предложена нуклеиновая кислота для получения белка гемагглютинина (НА) гриппа типа B в растении, содержащая регуляторную область, активную в растении, и энхансер экспрессии, активный в растении, причем регуляторная область и энхансер экспрессии функционально связаны с нуклеотидной последовательностью, кодирующей модифицированный гемагглютинин гриппа типа В (НА), причем в модифицированном НА между субъединицами НА1 и НА2 полностью удалена протеолитическая петля, при этом протеолитическая петля содержит одноосновный или многоосновный сайт расщепления, при этом нуклеиновая кислота не содержит длинную межгенную область вируса желтой карликовости бобов (BeYDV LIR) и короткую межгенную область BeYDV (BeYDV SIR), а также предложены способ получения модифицированного белка, клетка и растение, экспрессирующие модифицированный белок.

Изобретение относится к биотехнологии. Описаны способы для модулирования экспрессии целевой нуклеиновой кислоты в клетке, включающие применение множества ортогональных белков Cas9 для того, чтобы одновременно и независимо регулировать соответствующие гены или одновременно и независимо редактировать соответствующие гены.

Изобретение относится к области биохимии, в частности к генетически модифицированной клетке-хозяину млекопитающего, которая содержит первую нуклеиновую кислоту, кодирующую экзогенную фукозидазу, и вторую нуклеиновую кислоту, кодирующую эндогликозидазу, а также способ ее получения.

Изобретение относится к области биохимии, в частности к способу борьбы с заражением растения Leptinotarsa decemlineata, предусматривающему применение полинуклеотида, содержащего нуклеотидную последовательность, которая является комплементарной по меньшей мере 21 смежному нуклеотиду целевого гена Leptinotarsa decemlineata.

Изобретение относится к области биохимии, в частности к способу увеличения устойчивости растения к грибковой инфекции, вызываемой грибами семейства Sclerotiniaceae, включающему повышение в указанном растении экспрессии белка AtRLP30, а также к способу получения трансгенного растения с повышенной устойчивостью к грибковой инфекции, вызываемой грибами семейства Sclerotiniaceae, включающему трансформацию растения или растительной клетки с помощью нуклеотидной последовательности, кодирующей AtRLP30 или AtRLP30-подобный белок.

Изобретение относится к области биохимии, в частности к способу увеличения устойчивости растения к грибковой инфекции, вызываемой грибами семейства Sclerotiniaceae, включающему повышение в указанном растении экспрессии белка AtRLP30, а также к способу получения трансгенного растения с повышенной устойчивостью к грибковой инфекции, вызываемой грибами семейства Sclerotiniaceae, включающему трансформацию растения или растительной клетки с помощью нуклеотидной последовательности, кодирующей AtRLP30 или AtRLP30-подобный белок.

Изобретение относится к области биохимии, в частности к экспрессионной конструкции нуклеиновой кислоты, содержащей последовательность энхансера экспрессии, функционально связанную с представляющей интерес гетерологичной последовательностью, расположенной 3' к последовательности энхансера экспрессии, а также к растительной экспрессионной системе, содержащей вышеуказанную конструкцию.

Изобретение относится к области биохимии, в частности к экспрессионной конструкции нуклеиновой кислоты, содержащей последовательность энхансера экспрессии, функционально связанную с представляющей интерес гетерологичной последовательностью, расположенной 3' к последовательности энхансера экспрессии, а также к растительной экспрессионной системе, содержащей вышеуказанную конструкцию.

Изобретение относится к выделенному антителу или его антигенсвязывающему фрагменту, которое специфически связывается с Psl Pseudomonas, и фармацевтической композиции, содержащей указанное антитело.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая антитело или антигенсвязывающий фрагмент, специфически связывающееся с ИЛ-21, конъюгат для ингибирования функциональной активности ИЛ-21, содержащий вышеуказанное антитело, фармацевтическую композицию для лечения или профилактики аутоиммунного заболевания или расстройства или реакции «трансплантат против хозяина» (GVHD), ассоциированной с ИЛ-21, способ лечения или профилактики аутоиммунного заболевания или расстройства у субъекта, способ определения уровней экспрессии ИЛ-21 и способ лечения или профилактики реакции «трансплантат против хозяина», ассоциированной с ИЛ-21.

Изобретение относится к биохимии. Описано выделенное антитело или его антигенсвязывающий фрагмент для доставки цитотоксина, содержащие домен CH1 IgG, где домен CH1 IgG содержит остаток аспарагина в положении аминокислоты 114 в соответствии с нумерацией Kabat, где боковая цепь указанного остатка аспарагина связана с гликаном.

Настоящее изобретение относится к иммунологии. Предложен связывающий домен против EGFRvIII, содержащий его химерный антигенный рецептор, кодирующие нуклеиновые кислоты, вектор, клетка, а также применения указанных изобретений в производстве лекарственного средства, способы создания клетки и получения популяции клеток, способ обеспечения иммунитета, способ лечения.

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий фрагмент, которое специфически связывается с ErbB3, а также фармацевтическая композиция для профилактики или лечения заболевания, связанного с активацией или сверхэкспрессией белка ErbB3.

Настоящее изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.

Изобретение относится к области иммунологии. Предложены антитела к рецептору инсулиноподобного фактора роста 1 (IGF-1R) и их антигенсвязывающие фрагменты.

Настоящее изобретение относится к области иммунологии. Предложены химерные антигенные рецепторы (CAR), которые специфически связываются с ВСМА (антигеном созревания В-клеток).

Изобретение относится к биотехнологии. Описан связывающий элемент, обладающий специфичностью связывания к ФНО-альфа, включающий:(i) вариабельные последовательности CDR-H1, CDR-H2 и CDR-H3 тяжелой цепи, представленные в SEQ ID No: 6, 7 и 8; и (ii) вариабельные последовательности CDR-L1, CDR-L2 и CDR-L3 легкой цепи, представленные в SEQ ID No: 3, 4 и 5.

Изобретение относится к области иммунологии. Предложены варианты применения выделенного антитела или его антигенсвязывающего участка, специфичного к B7-H1, в лечении рака.

Изобретение относится к биохимии. Описано выделенное антитело или его антигенсвязывающий фрагмент для доставки цитотоксина, содержащие домен CH1 IgG, где домен CH1 IgG содержит остаток аспарагина в положении аминокислоты 114 в соответствии с нумерацией Kabat, где боковая цепь указанного остатка аспарагина связана с гликаном.

Изобретение относится к области биохимии, в частности к выделенному антителу или его антигенсвязывающему фрагменту, которое может специфически связаться с ОХ40 человека, а также к способу его получения и к композиции, его содержащей. Также раскрыт полинуклеотид для экспрессии вышеуказанного антитела или его антигенсвязывающего фрагмента, а также клетка, вектор, его содержащие. Изобретение также относится к способу лечения злокачественного новообразования у индивида, включающему введение индивидууму эффективного количества антитела или его антигенсвязывающего фрагмента, которое может специфически связаться с ОХ40 человека. Изобретение позволяет эффективно осуществлять лечение злокачественного новообразования. 10 н. и 9 з.п. ф-лы, 46 ил., 12 табл., 12 пр.

Наверх