Гибридный белок igf-1-long для лечения инсульта, нуклеиновая кислота, вектор, клетка, фармацевтическая композиция, способ лечения



Гибридный белок igf-1-long для лечения инсульта, нуклеиновая кислота, вектор, клетка, фармацевтическая композиция, способ лечения
Гибридный белок igf-1-long для лечения инсульта, нуклеиновая кислота, вектор, клетка, фармацевтическая композиция, способ лечения
Гибридный белок igf-1-long для лечения инсульта, нуклеиновая кислота, вектор, клетка, фармацевтическая композиция, способ лечения
C07K2319/30 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2711111:

Духовлинов Илья Владимирович (RU)

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению нейропротекторных белков, и может быть использовано в медицине для лечения инсульта. Конструируют гибридный белок, содержащий последовательность инсулиноподобного фактора роста 1 (IGF-1) или его изоформы, обладающей нейропротекторной активностью, к которой с С-конца присоединена, напрямую или посредством линкера, последовательность SEQ ID NO: 3. Кроме этого изобретение относится к нуклеиновой кислоте, вектору, клетке-хозяину, фармацевтической композиции, способу лечения инсульта и применению, основанные на использовании указанного белка. Изобретение позволяет получить нейропротекторный белок, названный авторами «IGF-1-long», характеризующийся более длительным терапевтическим эффектом по сравнению с IGF-1, не слитым с дополнительным доменом. 7 н. и 9 з.п. ф-лы, 3 табл., 3 пр.

 

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к области медицины, в частности к новому терапевтическому агенту для терапии последствий инсульта – рекомбинантному белку IGF-1-long.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Сосудистые заболевания головного мозга - это актуальная медицинская и социальная проблема. Основное место среди них занимают инсульты, причем ежегодно в мире это заболевание регистрируется у более чем 10 млн человек. Согласно данным ВОЗ, инсульты неизменно являются второй по количеству причиной летальных исходов, например в 2015 г. от инсультов в мире умерло 6,24 млн человек. Не менее острой является проблема инвалидизация выживших после инсульта, большая часть из которых теряет трудоспособность, и зачастую нуждаются в постоянном постороннем уходе. Возраст является одним из наиболее значительных факторов риска инсульта, и уже после 30 лет данный риск начинает непреклонно увеличиваться. Большая часть инсультов (95 %) происходит в возрасте 45 лет и выше. Учитывая процесс демографического старения, который в последнее время охватывает не только развитые, но и развивающиеся страны, очевидна необходимость сконцентрировать усилия в области здравоохранения на улучшение имеющихся и разработку новых профилактических и терапевтических подходов к борьбе с инсультом.

Инсульты в зависимости от их причин подразделяются на два вида: ишемический и геморрагический. Ишемический инсульт – наиболее часто встречающийся тип (70-75 % от всех случаев инсультов) – представляет собой нарушение мозгового кровообращения с повреждением ткани мозга и нарушением его функций вследствие снижения или прекращения мозгового кровотока, тромбоза или эмболии, связанных с заболеваниями сосудов, сердца или крови. Под геморрагическим инсультом понимают нетравматическое внутримозговое кровоизлияние; к этому же виду, как правило, относят также и субарахноидальное кровоизлияние.

Лечение инсульта включает комплекс мероприятий по неотложной помощи и последующей реабилитации. Неотложная помощь включает реанимационные мероприятия, в том числе поддержание адекватных показателей гемодинамики и оксигенации, а также устранение причин и/или последствий инсульта, например тромбэктомия. В целом, для наиболее эффективного восстановления функций мозга важна ранняя диагностика и быстрое начало лечения. Медикаментозное лечение инсульта как правило преобладает в схемах лечения, причем существует большое количество лекарственных средств, которые требуется тщательно подбирать лечащим врачом в зависимости от вида инсульта и других обстоятельств. Сложность подбора медикаментозного лечения обусловливает необходимость поиска новых улучшенных лекарственных средств, эффективных в лечении и профилактике инсульта. При этом очевидна потребность в более универсальных лекарственных средствах, эффективных как при ишемическом, так и геморрагическом инсульте. Кроме того, имеется потребность в лекарственных средствах, которые можно оперативно применить после приступа без помощи медицинского персонала, например путем интраназального введения.

Одним из перспективных лекарственных средств, обладающих нейропротективной активностью, которое может быть использовано для лечения инсульта, является инсулиноподобный фактор роста 1 (IGF-1 или ИФР-1, известен также как соматомедин С).

Из публикации Xin-Feng Liu et al. Intranasal administration of insulin-like growth factor-I bypasses the blood–brain barrier and protects against focal cerebral ischemic damage. J Neurol Sci. 2001 Jun 15;187(1-2):91-7, известно применение IGF-1 в модели ишемического инсульта, вызванного у крыс, путем интраназального введения 150 мкг IGF-1.

В публикации Lioutas V.A. et al. Intranasal Insulin and Insulin-Like Growth Factor 1 as Neuroprotectants in Acute Ischemic Stroke. Transl Stroke Res. 2015 Aug;6(4):264-75, описаны благоприятные эффекты интраназального введения инсулина и IGF-1 в животных моделях острого ишемического инсульта.

В WO 93/08828 раскрыто применение фармацевтических композиций, содержащих нейротрофические факторы, включающие IGF-1, для внутривенного введения субъекту, страдающему от повреждения нейронов в ЦНС.

В WO 90/14838 раскрыты различные подходы к модификации IGF-I и IGF-II для их применения в лечении заболеваний, связанных с повреждением нейронов, которые включают химическое изменение аминокислотных и карбоксильных групп IGF, замену, удаление или включение новых аминокислотных остатков, присоединение дополнительных химических групп и т. д. для повышения возможности прохождения через гематоэнцефалический барьер (ГЭБ).

Из публикации Dłużniewska J. et al. A strong neuroprotective effect of the autonomous C-terminal peptide of IGF-1 Ec (MGF) in brain ischemia. The FASEB Journal. 2005 Vol. 19, No. 13, pp. 1896-1898, известно о том, что С-конечный домен белка MGF, который представляет собой изоформу белка IGF-1, проявляет ярко выраженную нейропротективную активность в модели ишемического инсульта.

Известен синтетический белок IGF-1 LR3 (long arginine 3-IGF-1, компания Lifetech Labs, Гонконг), отличающийся от нативного зрелого IGF-1 тем, что он имеет замену E→R в положении 3 и 13 аминокислот (MFPAMPLLSLFVN) с N-конца, имея в длину 83 аминокислоты. Показано, что IGF-1 LR3 обладает усиленной активностью IGF-1 и улучшенной метаболической стабильностью; период его полужизни составляет около 20-30 ч по сравнению с 12-15 ч у нативного зрелого IGF-1. Белок IGF-1 LR3 можно рассматривать как ближайший аналог настоящего изобретения, которое отличается от IGF-1 LR3 тем, что имеет дополнительный домен, присоединяемый по C-концу IGF-1.

Несмотря на всю перспективность IGF-1 и его активных изоформ, существует проблема недостаточно длинного периода полужизни белка, что ограничивает эффективность терапии с использованием указанных белков. Кроме того, существует потребность в расширении ассортимента модифицированных белков, обладающих активностью IGF-1, которые бы имели повышенную метаболическую стабильность, но в то же время приемлемые терапевтические свойства, в частности для лечения инсульта. Настоящее изобретение направлено, в том числе, на решение данной задачи.

КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Автор настоящего изобретения неожиданно обнаружил, что период полужизни IGF-1 в организме субъекта, которому ввели указанный белок, может быть увеличен путем присоединения к указанному белку с С-конца домена, имеющего последовательность SEQ ID NO: 3. Таким образом, настоящее изобретение относится к гибридному белку, обладающему нейропротективной активностью, содержащему последовательность IGF-1, к которой с С-конца присоединена напрямую или посредством линкера последовательность SEQ ID NO: 2. В качестве IGF-1 могут быть использованы различные изоморфы, обладающие активностью, присущей IGF-1, в частности нейропротекторной активностью.

Кроме того, настоящее изобретение имеет следующие дополнительные воплощения:

- нуклеиновая кислота, кодирующая вышеуказанный гибридный белок;

- вектор, содержащий вышеуказанную нуклеиновую кислоту, который предпочтительно может представлять собой экспрессионный вектор, но не ограничиваясь этим;

- клетка-хозяин, которая содержит вышеуказанный вектор; клетка-хозяин предпочтительно является продуцентом гибридного белка по изобретению;

- фармацевтическая композиция для лечения инсульта, содержащая гибридный белок по п. 1 в терапевтически эффективном количестве и фармацевтически приемлемый носитель; предпочтительно композиция адаптирована для интраназального введения;

- способ лечения инсульта, включающий интраназальное введение пациенту гибридного белка по п. 1 в количестве 0,1-3 мг в каждый носовой проход;

- применение гибридного белка по п. 1 для получения лекарственного средства для лечения инсульта.

Инсульт включает как ишемический инсульт, так и геморрагический инсульт.

Введение гибридного белка по изобретению предпочтительно осуществляют как можно быстрее после начала приступа инсульта, предпочтительно первое введение белка должно быть осуществлено в течение 120 мин с указанного момента. Типичное окно для введения гибридного белка по изобретению составляет 10-120 мин.

Гибридный белок по изобретению предпочтительно вводят в виде курса, например ежедневно 1-3 раза в сутки на протяжении 7-30 суток.

Введение гибридного белка по изобретению может предпочтительно сопровождаться совместным введением аминокислоты, выбранной из аргинина, лизина, глютамина, или любой их смеси. Соответственно, фармацевтическая композиция по изобретению может содержать по меньшей мере одну из указанных аминокислот в дополнение к гибридному белку и носителю, например в количестве 0,1-50 мг (каждой аминокислоты) на мл композиции.

Настоящее изобретение не ограничивается применением гибридного белка в качестве лекарственного средства для лечения инсульта, но также и для лечения или профилактики иных заболеваний или состояний, для лечения которых необходима или благоприятна нейропротекторная активность или другая активность, присущая IGF-1. Более того, гибридный белок по изобретению может применяться в качестве средства для стимуляции роста мышц человека за счет анаболического эффекта, что полезно для спортсменов, в частности занимающихся бодибилдингом. Предложенный гибридный белок будет также полезен в педиатрии для лечения отставания в физическом развитии и потери веса.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Определения

Если не определено иное в данной заявке, научные и технические термины, используемые в связи с настоящим изобретением, имеют значения, которые обычно понятны специалистам в данной области. В общем, используемые номенклатура и методы клеточной и тканевой культуры, молекулярной биологии, иммунологии, микробиологии, генетики и химии белков и нуклеиновых кислот, гибридизации, аналитической химии, синтетической органической химии и медицинской и фармацевтической химии, описанные в данной заявке, представляют собой номенклатуру и методы, хорошо известные и обычно использующиеся в данной области.

Используемая здесь терминология предназначена для целей описания конкретных вариантов воплощения изобретения и не является ограничивающей. При использовании в настоящем описании и формуле изобретения формы единственного числа включают множественное число, если контекст явным образом не указывает на иное.

Способы и методы биоинженерии по настоящему изобретению обычно осуществляют в соответствии с традиционными способами, хорошо известными в данной области, и как описано в различных общих и более конкретных источниках, которые цитируются и обсуждаются в настоящем описании, если не указано иное. См., например, Sambrook J. & Russell D. Molecular Cloning: A Laboratory Manual, 3rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2000); Ausubel et al., Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Wiley, John & Sons, Inc. (2002); Harlow and Lane Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1998); и Coligan et al., Short Protocols in Protein Science, Wiley, John & Sons, Inc. (2003).

Способы введения мутации в аминокислотные последовательности белка хорошо известны специалистам в данной области (см., например, Ausubel (ed.), Current Protocols in Molecular Biology, John Wiley and Sons, Inc. (1994); T. Maniatis, E. F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor laboratory, Cold Spring Harbor, N. Y. (1989)).

Ссылки на аминокислотные остатки, использованные в настоящей заявке, обозначены общепринятым однобуквенным или трехбуквенным кодом (см., например, Lehninger, Biochemistry, 2nd edition, Worth Publishers, New York, 1975, p. 72).

Термин "пептид" или "полипептид" относится к полимеру из аминокислот независимо от длины полимера; таким образом, фрагменты белка, олигопептиды и белки включены в определение пептида или полипептида. Этот термин также охватывает постэкспрессионные модификации полипептидов, например, полипептидов, которые включают ковалентное присоединение гликозильных групп, ацетильных групп, фосфатных групп, липидных групп и тому подобного. В данное определение также включены полипептиды, которые содержат один или более аналогов аминокислоты (включая, например, не встречающиеся в природе аминокислоты, аминокислоты, которые встречаются в природе только вне неродственной биологической системы, модифицированные аминокислоты из систем млекопитающих и т. д.), полипептиды с замещенными связями, а также другие модификации, известные в данной области, как природные, так и не природные.

Термин "идентичная последовательность" совместно с указанием процента идентичности означает, что в последовательности, идентичной, например, на 80 % какой-либо другой последовательности, 80 % идентичных аминокислот или нуклеотидов присутствует в том же положении при выравнивании последовательностей, которое можно осуществить известными в данной области техники способами.

Идентичность аминокислотной или нуклеотидной последовательности может быть определена традиционно с использованием известных компьютерных программ, таких как Bestfit, FASTA или BLAST (см., например, Pearson, Methods Enzymol. 183:63-98 (1990); Pearson, Methods Mol. Biol. 132:185-219 (2000); Altschul et al., J. Mol. Biol. 215:403-410 (1990); Altschul et al., Nucelic Acids Res. 25:3389-3402 (1997)).

Термин "приблизительно" и аналогичные ему, такие как "около" и "примерно", при использовании здесь вместе с определенным значением, указывают на то, что это значение может изменяться в пределах типичной погрешности измерений. Например, использование здесь указанных терминов с определенным значением, указывает на это значение плюс/минус 10%.

Структура гибридного белка по изобретению

Настоящее изобретение основано на применении известной нейропротекторной активности инсулиноподобного фактора роста 1 в лечении и профилактике инсульта.

Ген igf1, кодирующий белок IGF-1, транслируется в белок-предшественник pre-pro-IGF-I, который включает сигнальный пептид, сайт отщепления сигнального пептида, белок IGF-I и E-пептид (С-конечный пептид). Во время трансляции при отщеплении сигнального пептида образуется Pro-IGF-I. Дальнейшее расщепление протеазой отделяет зрелый IGF-I от E-пептида.

Зрелый IGF-1 состоит из 70 аминокислотных остатков, образующих четыре домена (B-C-A-D), имеет молекулярную массу 7,6 кДа и поступает в кровь в основном из печени, а его секреция стимулируется соматотропином. Известно, что IGF-1 оказывает прямое регулирующее воздействие на гематопоэз, в особенности лимфопоэз и функционирование иммунной системы (Clark P., 1997), стимулирует дифференцировку и переход про-В- в пре-В-клетки (Landgreth K. et al, 1992) и в синергизме с ИЛ-7 активирует пролиферацию В-клеток (Gibson L.F. et al, 1993), функционирует в метаболизме олигодендроцитов и миелина in vivo (Komoly, S. et al. (1992) Proc. Natl. Acad. Sci. USA 89:1894-1898). На секрецию IGF-1 влияют такие вещества как глутамин, аргинин, лизин, ангиотензин-II, баклофен, грелин, тиреоидные гормоны, соматотропин, стерилглюкозиды (SG), такие как ацилированные стерил-β-глюкозиды (ASG) и другие.

В то время как зрелый IGF-1 производит обычно приписываемые ему эффекты в отношении самых разных клеток и тканей, другие изоформы IGF-1 также могут быть использованы в изобретении постольку, поскольку они содержат последовательность зрелого IGF-1 и/или производят указанные эффекты. Такие изоформы включают, например изоформу 1 (IGF-1B), обычно называемую "канонической", поскольку она представляет собой полноразмерный белок-предшественник pre-pro-IGF-I; изоформу 2 (IGF-1A) длиной 153 аминокислотных остатков, изоформу 3 длиной 137 аминокислотных остатков, экспрессирующуюся в печени, изоформу 4 длиной 158 аминокислотных остатков, изоформу IGF-1E, включая варианты, преимущественно экспрессируемые в мышцах (у человека - IGF-1Ec) и в печени (IGF-1Eа).

Под термином "изоформы IGF-1" также включены его функциональные фрагменты, для которых известно об их желаемой биологической активности, например нейропротективной активности. Сюда относятся, например des(1-3)IGF-1, представляющий собой укороченный вариант (67 аминокислот), в котором отсутствуют первые три аминокислоты GPE; а также, например, Е-пептид изоформы IGF-1Ec, и другие. Указанный термин охватывает также и мутантные формы IGF-1, имеющие замены аминокислот, например встречающиеся в природе варианты с заменами R→W в положении 98, A→T в положении 115, A→D в положении 187, и другие, в том числе не встречающиеся в природе варианты.

Для целей краткости под выражением "IGF-1" в данном документе означает любую из вышеуказанных форм, если специально не указано иное. При этом изобретение охватывает гибридный белок, в котором последовательность IGF-1 фланкирована с N- и/или С-конца дополнительными аминокислотными последовательностями, предпочтительно длиной от 1 до 50 аминокислот, в частности от 1, 2, 3, 4, 5, 10 и до 45, 40, 35, 30, 25, 20, 15 аминокислот, включая указанные значения. Такие фланкирующие последовательности не должны менять активность, присущую IGF-1.

При упоминании "IGF-1" предпочтительно подразумевается человеческий IGF-1, однако изобретение не ограничено этим, и специалист может использовать ортолог IGF-1 для осуществления изобретения, например, в ветеринарной практике.

В одном из предпочтительных, но не ограничивающих воплощений в качестве последовательности IGF-1 в составе гибридного белка по изобретению используют:

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGMVDECCFRSCDLRRLEMYCAPLKPAKSA (SEQ ID NO: 1) или

MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGMVDECCFRSCDLRRLEMYCAPLKPAKSA (SEQ ID NO: 2; Met-1-rhIGF-1; GenBank: CAA01954.1).

Вторым важным элементом изобретения является дополнительный домен, разработанный автором изобретения, который обеспечивает неожиданные преимущества гибридного белка по изобретению. Указанный дополнительный домен размером 3 кДа имеет последовательность SEQ ID NO: 3 и присоединен к белку IGF-1 с С-конца. Не ограничиваясь конкретной теорией, автор полагает, что поскольку структура этого дополнительного домена включает определенные повторы гидрофобных аминокислот, они обеспечивают молекуле высокую термодинамическую стабильность, что приводит к большей стабильности белка в крови и других жидкостях организма, и, следовательно, пролонгирует эффект, оказываемый IGF-1. Дополнительный домен не влияет на взаимодействие IGF-1 со специфическим рецептором.

В качестве альтернативы SEQ ID NO: 3 могут быть использованы последовательности, имеющие по меньшей мере 80 % идентичность с последовательностью SEQ ID NO: 3, в частности может быть использована последовательность, идентичная последовательности SEQ ID NO: 3 по меньшей мере на 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 или 99 %.

Указанный дополнительный домен присоединен к С-концу IGF-1 либо непосредственно (например, SEQ ID NO: 4 или 5), либо через линкер (спейсер), обычно используемый для создания гибридных белков (см., например, Chen X. et al. Fusion protein linkers: Property, design and functionality. Advanced Drug Delivery Reviews Volume 65, Issue 10, 15 October 2013, PP. 1357-1369). Типично, линкер составляет от 3 до 35, например 3-16, аминокислотных остатков в длину, может быть синтетического происхождения или представлять собой фрагменты встречающихся в природе белков. Для целей изобретения целесообразно не использовать линкеры, которые предназначены для отщепления связываемых доменов. Предпочтительно использовать линкер, приемлемый с фармакологической точки зрения. Примеры линкеров включают (GGGS)n, (GGGGS)n, GSAGSAAGSGEF, но не ограничиваясь этим.

Предпочтительно, указанный дополнительный домен присоединяется к С-концевой аминокислоте домена D IGF-1 или соответствующей аминокислоте последовательности, включающей последовательность IGF-1, напрямую или посредством линкера.

Настоящее изобретение также охватывает варианты белка с последовательностями, обладающими эквивалентными химическими функциями и свойствами, которые получены любым известным в данной области техники способом, например, путем сайт-направленного мутагенеза или путем химического синтеза. Подобные варианты являются результатом консервативных аминокислотных замен, вставок и/или делеций в последовательности IGF-1 и/или дополнительного домена (SEQ ID NO: 3).

Итак, гибридный белок по изобретению, включающий вышеописанный дополнительный домен и также обозначаемый в данном документе как "IGF-1-long", обладает повышенным периодом полужизни по сравнению с тем же самым белком, не слитым с указанным дополнительным доменом. Дополнительно к этому автором обнаружено, что указанный домен не оказывает влияния на эффективность связывания белка и соответствующего рецептора, т. е. сохраняет активность IGF-1, а также обеспечивает снижение возможной токсичности гибридного белка и повышение переносимости пациентом терапии таким белком. Так же как и неудлиненный вариант, белок IGF-1-long оказывает благоприятное воздействие, в частности протективное, на нейроны головного мозга, предотвращая их повреждение и/или гибель, и/или снижая уровень повреждений в результате перенесенного инсульта.

Получение гибридного белка по изобретению

Гибридный белок по изобретению, а также его части могут быть получены с помощью различных экспрессионных систем и с использованием рекомбинантных нуклеиновокислотных молекул. Подходящие системы экспрессии включают прокариоты и эукариоты, например дрожжи, такие как S. cerevisiae, бактерии, такие как E. coli, систему на основе бакуловируса (с использованием клеток насекомых), животные клетки, например клетки млекопитающего, в частности человека.

В одном из воплощений изобретения гибридный белок может быть конъюгирован с другой молекулой, например, для увеличения его времени полужизни, растворимости или биодоступности. Молекулы, которые могут быть конъюгированы с гибридным белком по изобретению, включают без ограничений, биотин, полиэтиленгликоль, нуклеиновые кислоты, полисахариды и белки других организмов. Конъюгация может быть прямой или опосредованной (например, через линкер).

В некоторых воплощениях гибридный белок может быть соединен с меткой, сигналом секреции или другой сигнальной последовательностью. Примеры подобных меток и последовательностей описаны в WO 2013078299.

Нуклеиновая кислота

В изобретении также предложена молекула нуклеиновой кислоты, кодирующая гибридный белок по изобретению. Эти молекулы могут быть встроены в вектор экспрессии для клонирования последовательности и/или экспрессии белка в подходящей экспрессионной системе. Нуклеиновая кислота может представлять собой ДНК или РНК, предпочтительно ДНК. Нуклеиновая кислота может быть изолированной, либо являться сегментом более длинной последовательности.

Изобретение охватывает и любые очевидные для специалиста модификации нуклеиновокислотной последовательности по изобретению, т. е. такие, при которых данная нуклеотидная последовательность сохраняет свои биологические свойства, т. е. способна экспрессировать белок, обладающий предусмотренными в данном изобретении свойствами, обеспечивая адекватную транскрипцию и трансляцию. Для специалиста в области генетической инженерии, знакомого с понятиями консервативных замен и вырожденности генетического кода, не составит труда подобрать модификации последовательности по изобретению, удовлетворяющие указанным выше критериям.

Нуклеиновая кислота, кодирующая гибридный белок по настоящему изобретению, способна экспрессироваться в клетке-хозяине. Нуклеотидная последовательность, кодирующая гибридный белок по изобретению может быть оптимизирована для обеспечения стабильного и высокого уровня экспрессии указанного гибридного белка.

Под молекулой нуклеиновой кислоты в настоящем изобретении также понимается гибридный ген, содержащий в функциональном сцеплении друг с другом по меньшей мере один промотор, который является функциональным в организме-хозяине, последовательность, кодирующую гибридный белок в соответствии с изобретением, и терминаторный элемент, который является функциональным в том же организме-хозяине. Различные элементы, которые могут содержать гибридный ген, представляют собой, во-первых, элементы, регулирующие транскрипцию, трансляцию и созревание белков, такие как промотор, последовательность, кодирующую сигнальный пептид или транзитный пептид, или терминаторный элемент, составляющий сигнал полиаденилирования, и, во-вторых, полинуклеотид, кодирующий белок. Выбор регуляторных элементов зависит от клетки-хозяина, в котором они должны функционировать, и специалисты в данной области техники способны без дополнительного экспериментирования выбрать необходимые регуляторные элементы.

Выражение "в функциональном сцеплении друг с другом" означает, что указанные элементы гибридного гена сцеплены друг с другом таким образом, что на функцию одного из этих элементов влияет функция другого. Например, промотор функционально сцеплен с кодирующей последовательностью, когда он способен влиять на экспрессию указанной кодирующей последовательности. Конструирование гибридного гена в соответствии с изобретением и сборку различных его элементов можно осуществить, используя методики, хорошо известные специалистам в данной области техники, в частности, описанные в Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Nolan C. ed., New York: Cold Spring Harbor Laboratory Press). Выбор регуляторных элементов, составляющих гибридный ген, существенно зависит от организма-хозяина, в котором они должны функционировать, и специалисты в данной области техники способны выбрать регуляторные элементы, которые являются функциональными в организме-хозяине, представляющем собой объект интереса. Термин "функциональный" указывает на способность функционировать в данном организме-хозяине.

Промоторы, которые могут содержать гибридный ген в соответствии с изобретением, являются либо конститутивными, либо индуцибельными. Например, универсально эффективным промотором, используемым для экспрессии в клетках млекопитающих, является pCMV (промотор цитомегаловируса).

В соответствии с изобретением гибридный ген может также содержать другие регуляторные последовательности, которые локализованы между промотором и кодирующей последовательностью, такие как транскрипционные активаторы (энхансеры).

Вектор

Настоящее изобретение также относится к вектору, содержащему нуклеиновую кислоту по изобретению. Вектор может быть кольцевым или линейным, одноцепочечным или двуцепочечным.

В одном из воплощений настоящего изобретения предложен вектор для экспрессии гибридного гена в клетке-хозяине. Вектор по изобретению способен к экспрессии указанного гибридного гена в клетке организма млекопитающего, в частности, в клетке человека. В одном из предпочтительных воплощений указанный вектор представляет собой нуклеиново-кислотную структуру, способную к репликации в бактериальной клетке-хозяине.

Подходящие векторы известны специалисту в данной области и включают, например, плазмиды, космиды, искусственные хромосомы (например, бактериальные или дрожжевые), бактериофаги, вирусные векторы (например, ретровирусы, лентивирусы, аденовирусы, адено-ассоциированные вирусы), в частности бакуловирусные векторы. Предпочтительно, вектор в соответствии с изобретением представляет собой плазмиду. Как правило, основными качествами этого вектора должна быть способность к поддержанию самого себя и самостоятельной репликации в клетках организма-хозяина, в частности, за счет присутствия точки начала репликации, и к экспрессии в них лиганда.

В целях стабильной трансформации организма-хозяина вектор может также интегрироваться в геном. Выбор подходящего вектора, а также методики вставки гена в вектор известны специалисту в данной области и описаны, например, в Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Nolan C. ed., New York: Cold Spring Harbor Laboratory Press) и Маниатис и др. (1984. Молекулярное клонирование).

В одном из предпочтительных воплощений вектор может быть выбран из pcDNA3 и pcDNA3.1 (Invitrogen), которые содержат цитомегаловирусный промотор и сигнал полиаденилирования гена гормона роста быка. В другом предпочтительном воплощении вектор может быть выбран из pVAX (Invitrogen), pCI, VR1012 DNA (Vical Inc.), pJW4303, pVAC1-mcs, pVAC2-mcs (InvivoGen). В еще одном предпочтительном воплощении вектор может представлять собой вирусный вектор, например, на основе аденовирусов (например, AD5), ортопоксвирусов, альфавирусов или любого другого подходящего для целей изобретения вектора, который коммерчески доступен и/или известен специалисту в данной области техники.

Регуляторные элементы, необходимые для экспрессии, описаны выше в отношении нуклеиновой кислоты по изобретению, и их выбор лежит в пределах компетенции специалиста.

Инициирующий кодон может быть расположен выше кодирующей последовательности антигена. Стоп-кодон может быть расположен ниже кодирующей последовательности антигена. Инициирующий и стоп-кодоны могут располагаться в одной рамке считывания с кодирующей последовательностью антигена.

Примерами сигналов полиаденилирования, пригодных в рамках настоящего изобретения, в частности для получения генетической вакцины для человека, являются без ограничений сигналы полиаденилирования SV40 и LTR (длинные концевые повторы).

Промотор может являться промотором вируса обезьян 40 (SV40), промотором вируса опухоли молочной железы мыши (MMTV), промотором цитомегаловируса (CMV), промотором вируса Эпштейна-Барра (EBV). Промотор также может являться промотором гена человека, например, гена актина человека, гена миозина человека, гена гемоглобина человека. Промотор также может являться тканеспецифичным промотором, например, промотором, специфичным для мышцы и кожи, природным или синтетическим. В частности, для экспрессии в гепатоцитах подходит промотор гена десмина, для экспрессии в кератиноцитах – промотор гена гидроксилазы витамина D3. Примеры таких промоторов описаны в US20040175727.

Вектор может включать гены для маркеров трансформации, указывающие на трансформацию бактериальной клетки вектором. Маркером трансформации может быть селективный маркерный ген, используемый для отличия и отбора клеток, являющихся эффективно трансформированными, то есть теми, в которых присутствует вектор, от клеток без вектора. Такие маркеры хорошо известны специалистам в данной области техники. Общепринято используемые селективные маркеры включают гены, которые придают устойчивость к специфичным антибиотикам, таким как ампициллин, неомицин и др. Некоторые векторы могут также включать маркерные гены, которые только указывают, какие клетки были трансформированы вектором. Такими генами могут быть гены, кодирующие пигменты или ферменты, регулирующие образование пигментов в трансформированных клетках. Подобные селективные маркерные гены, в частности, описаны в WO 91/02071, WO 95/06128, WO 96/38567 и WO 97/04103. Индикаторный маркерный ген может представлять собой последовательность гена lacZ, кодирующего фермент β-галактозидазу. Другие используемые маркеры трансформации включают, например, гены люциферазы и GFP.

Предпочтительным вектором по изобретению является плазмида. Предпочтительной плазмидой является плазмида, сконструированная для обеспечения экспрессии трансгенных генетических последовательностей. Большое число векторов известно и охарактеризовано (например, база http://genome-www.stanford.edu/vectordb/vector_pages/plasmid_pages/Plasmid.html). Примеры плазмид, которые позволяют относительно легко вводить экспрессионные кассеты, хорошо известны в данной области техники и доступны коммерческим путем (WO1990002189, US 20140065699, US 2001/0016351).

В одном из воплощений настоящего изобретения вектор может быть пригоден для трансфекции клеток нуклеиновой кислотой, кодирующей гибридный белок по изобретению, причем трансформированную клетку-хозяина культивируют и поддерживают в условиях, в которых происходит экспрессия указанного гибридного белка. Способы трансформации для введения векторов в различные клетки и организмы хорошо известны. Например, векторную конструкцию можно вводить методом химически компетентных клеток (хлорид кальция/тепловой шок), электропорации, посредством плазмидной конъюгации, бомбардировки частицами, с использованием генного пистолета, липосомных носителей и т. д.

Клетка

В изобретении также предложена клетка-хозяин, содержащая молекулу нуклеиновой кислоты или вектор по изобретению и предпочтительно предназначенная для получения копий нуклеиновой кислоты или вектора или продуцирования гибридного белка по изобретению. Может быть использована любая клетка, обычно используемая в комбинации с экспрессирующимися векторами, описанными выше. Клетка для продуцирования гибридного белка по изобретению может представлять собой эукариотическую или прокариотическую клетку, как описано выше. Примеры эукариотической клетки включают клетки животного или растения, например клетки дрожжей, CHO (клетки яичника китайского хомячка), Vero. Прокариотическая клетка может представлять собой, например, клетку E. coli и ее штаммы BL21 (DE3), BLR(DE3), origami 2(DE3), Bacillus или другие грамположительные бактерии, такие как Lactococcus lactis. Предпочтительные клеточные системы экспрессии включают E. coli, такие как E. coli DH10B.

Фармацевтическая композиция и способы лечения

Термин "лечение" применительно к человеку, животному или иному субъекту относится к терапевтическому лечению, профилактическим или превентивным мерам для исследовательских и диагностических применений. Термин "лечение" относится к обращению, облегчению, ингибированию прогрессирования или предупреждению расстройства или состояния, по отношению к которому употребляется данный термин, или одного или более симптомов такого расстройства или состояния. Термин охватывает полный спектр методов лечения для конкретного состояния, от которого страдает субъект, например, введение активного вещества или композиции, содержащей его, с целью облегчения или ослабления симптомов или осложнений; замедления прогрессирования состояния, частичного купирования клинических проявлений заболевания или нарушения; излечения или устранения состояния, заболевания или нарушения и/или предотвращения или снижения риска развития состояния, заболевания или нарушения. При этом термины "предотвращение" или "профилактика" означают систему мер и уход за пациентом с целью препятствования развитию состояния, заболевания или нарушения и подразумевают введение активных соединений для предотвращения или снижения риска возникновения симптомов или осложнений.

Термин "введение" при применении к биологическим объектам, таким как животное, человек, подопытный субъект, клетка, ткань, орган или биологическая жидкость, относится к приведению в контакт экзогенного фармацевтического, терапевтического агента, диагностического агента или композиции с биологическим объектом, включающим животное, человека, субъекта, клетку, ткань, орган или биологическую жидкость. Термин "введение" может относиться, например, к терапевтическим, фармакокинетическим, диагностическим, исследовательским и экспериментальным способам. Обработка клеток включает в себя приведение в контакт реагента с клеткой, а также приведение в контакт реагента с текучей средой, где текучая среда находится в контакте с клеткой. Термин "введение" также означает методы обработки in vitro и ex vivo, например, клетки, реагентом, диагностическим средством, связывающим соединением или другой клеткой.

Термин "субъект" при использовании здесь относится к любому млекопитающему, включая грызунов, таких как мышь или крыса, морских свинок и приматов, таких как яванский макак (Масаса fascicularis), макак-резус (Масаса mulatta) или человек (Homo sapiens). Предпочтительно субъектом является примат, наиболее предпочтительно человек.

В настоящем документе термины "терапевтически эффективная доза", или "терапевтически эффективное количество", или "фармацевтически эффективная доза", или "фармацевтически эффективное количество" означает дозу, оказывающую эффекты, для которых ее вводят. Как правило, терапевтический агент вводят в количестве, эффективном для облегчения одного или более заболевания или состояния пациента или популяции, подлежащего (-ей) лечению, либо посредством индукции регрессий этих заболеваний или состояний, либо посредством ингибирования прогрессирования таких заболеваний или состояний в какой-либо клинически измеримой степени.

Термин "фармацевтическая композиция" относится к смеси, содержащей одно или более активных веществ в соответствии с настоящим изобретением вместе с другими компонентами, в частности физиологически/фармацевтически приемлемыми вспомогательными веществами (эксципиентами). Фармацевтическая композиция должна иметь состав, оптимизированный для желаемого пути введения активного ингредиента в организм и, в конечном итоге, проявления биологического действия.

"Фармацевтический" или "фармацевтически приемлемый" относится к химическим соединениям и композициям, которые не приводят к побочной, аллергической или другой нежелательной реакции при введении млекопитающему, в частности человеку, или такие реакции сведены к минимуму. Фармацевтически приемлемое вспомогательное вещество относится к нетоксичному твердому, мягкому или жидкому наполнителю, разбавителю, материалу капсулы или другому вспомогательному веществу любого типа.

"Фармацевтически приемлемый носитель" означает один или более чем один совместимый твердый, полутвердый или жидкий наполнитель, которые подходят для введения субъекту и должны иметь достаточную чистоту и достаточно низкую токсичность. "Совместимость" в данном документе означает, что компоненты композиции можно смешивать с соединениями согласно изобретению или друг с другом, и они не будут значительно снижать эффективность соединений. Некоторые примеры фармацевтически приемлемых носителей включают целлюлозу и ее производные (такие как натрий-карбоксиметилцеллюлоза, натрий-этилцеллюлоза, ацетат целлюлозы и т. д.), желатин, тальк, твердые смазывающие вещества (такие как стеариновая кислота, стеарат магния), сульфат кальция, растительные масла (такие как соевое масло, кунжутное масло, арахисовое масло, оливковое масло и т.д.), полиолы (такие как пропиленгликоль, глицерин, маннит, сорбит и т.д.), эмульгаторы (такие как Tween®), увлажнитель (такой как додецилсульфат натрия), красители, корригенты, стабилизаторы, антиоксиданты, консерванты, воду (стерильную) и т. д.

Способы введения гибридного белка по изобретению

Введение гибридного белка или фармацевтической композиции по изобретению может быть выполнено различными путями, включая без ограничений пероральный, подкожный, внутривенный, парентеральный, интраназальный, интраортикальный, интраокулярный, ректальный, вагинальный, трансдермальный, интраперитонеальный, внутримышечный, внутрилегочный или интратекальный путь введения. Предпочтительно введение гибридного белка или фармацевтической композиции по изобретению осуществляют интраназально, при этом введение осуществляют в каждый носовой проход.

Композиция по изобретению может быть введена вместе с другими терапевтическими агентами, т. е. терапевтические агенты, описанные в данном документе, могут быть введены параллельно, одновременно или последовательно с другими фармакотерапевтическими агентами или на фоне иных терапевтических воздействий на организм, например радиационной терапии, физиотерапии, хирургического вмешательства и т. д. Подразумевается, что гибридный белок или фармацевтическая композиция по изобретению могут являться частью комплексного лечения инсульта, включающего другие рекомендованные для лечения инсульта лекарственные средства и/или иные терапевтические воздействия. Фармацевтическая композиция по изобретению может содержать в дополнение к гибридному белку по изобретению другие активные вещества, при условии, что они не приводят к нежелательному с фармацевтической и терапевтической точек зрения взаимодействию, например ингибированию друг друга. Принципы и практические подходы к созданию комбинированных лекарственных средств являются частью компетенции специалиста.

Любое из активных веществ, входящих в состав композиций по изобретению, можно вводить опосредованно путем введения экзогенной нуклеиновой кислоты, например ДНК или РНК, кодирующей соответствующее активное вещество, в результате чего осуществляется экспрессия введенной нуклеиновой кислоты. Например, в качестве дополнительного терапевтического агента может быть использован аргинин, лизин, или глютамин, или любая их смесь. Указанные агенты могут быть включены в ту же самую композицию, в которой находится гибридный белок по изобретению, либо находиться в отдельной фармацевтической композиции, которая составляет набор с указанной композицией, содержащей гибридный белок.

Фармацевтическим композициям по изобретению придают лекарственную форму, подходящую для желаемого пути введения.

Жидкие лекарственные формы могут, например, представлять собой раствор или суспензию одного или более настоящих соединений и необязательные фармацевтические адъюванты в носителе, таком как, например, вода, физиологический раствор, водный раствор декстрозы, глицерин, этанол и тому подобные. При необходимости фармацевтическая композиция для введения может также содержать другие нетоксичные вспомогательные вещества, такие как смачивающие или эмульгирующие средства, средства для забуферивания рН и т. п. Типичными примерами таких вспомогательных средств являются ацетат натрия, монолаурат сорбитана, триэтаноламин, олеат триэтаноламина и т. д. Практические способы приготовления таких лекарственных форм известны или будут очевидны для специалистов в данной области техники, например, см. Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, Pa., 16th Edition, 1980. В одном из вариантов осуществления для интраназального введения используют аэрозоли или спреи. В одном варианте осуществления для парентерального введения используют растворы гибридного белка по настоящему изобретению, в стерильном водном растворе, в водном пропиленгликоле или в кунжутном или арахисовом масле. Водные растворы должны быть соответствующим образом забуферены, когда это целесообразно, и жидкий разбавитель сделан изотоническим, например, с помощью соответствующего солевого раствора или глюкозы. Водные растворы особенно подходят для интраназального, внутривенного, внутримышечного, подкожного и внутрибрюшинного введения. Все используемые стерильные водные среды легко могут быть получены стандартными методами, известными специалистам в данной области.

Подходящие фармацевтические носители включают инертные твердые разбавители или наполнители, стерильные водные растворы и различные органические растворители. Примерами твердых носителей являются лактоза, магнезия, сахароза, циклодекстрин, тальк, желатин, агар, пектин, гуммиарабик, стеарат магния, стеариновая кислота и низшие алкильные эфиры целлюлозы. Примерами жидких носителей являются сироп, арахисовое масло, оливковое масло, фосфолипиды, жирные кислоты, амины жирных кислот, полиоксиэтилен и вода. Кроме того, носитель или разбавитель может включать любой материал замедленного высвобождения, известный в данной области, такой как глицерилмоностеарат или глицерилдистеарат, самостоятельно или в смеси с воском.

Фармацевтические композиции по изобретению могут иметь форму лиофилизата, подходящего для изготовления раствора путем добавления стерильной воды или другого подходящего растворителя непосредственно перед введением композиции.

Под фармацевтическими композициями в настоящем изобретении понимаются как фармацевтические субстанции, представляющие собой сырье для производства лекарственных препаратов, так и сами лекарственные препараты, имеющие определенную лекарственную форму, и, в целом, готовые фармацевтические продукты, например капли назальные или спрей назальный дозированный, в том числе упакованные в упаковку, включающую инструкцию по применению. Предпочтительно, чтобы композиция по изобретению была представлена в стандартной лекарственной форме.

Дозы и длительность лечения

При выборе дозы гибридного белка по изобретению специалист может ориентироваться на обычно применяемую дозу соответствующего IGF-1, не имеющего дополнительного домена по изобретению, которые известны из уровня техники. Количества вводимых активных веществ по изобретению определяют, как правило, исходя из массы тела субъекта.

Например, приблизительный диапазон разовой дозы IGF-1-long может составлять от 1 мкг/кг до 15 мг/кг массы тела субъекта, включая поддиапазоны от 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90 мкг/кг массы тела субъекта, от 0,1, 0,2, 0,3, 0,4, 0,5, 0,6, 0,7, 0,8, 0,9, 1, 1,1, 1,2, 1,3, 1,4, 1,5, 2, 2,5, 3, 3,5, 4, 4,5, 5, 5,5 или 6 мг/кг массы тела субъекта и до 15, 14, 13, 12, 11, 10, 9,5, 9, 8,5, 8, 7,5, 7, 6,5 мг/кг массы тела субъекта, включая, в частности, указанные граничные значения.

При расчете разовой дозы IGF-1-long для интраназального введения человеку специалист может ориентироваться на диапазон от 0,1 до 3 мг на один носовой ход или от 0,2 до 6 мг на оба носовых хода. Указанный диапазон включает поддиапазоны от 0,2, 0,3, 0,4, 0,5, 0,6, 0,7, 0,8, 0,9, 1, 1,1, 1,2, 1,3, 1,4, 1,5, 1,6, 1,7, 1,8, или 1,9 мг на один носовой ход и до 3,0, 2,9, 2,8, 2,7, 2,6, 2,5, 2,4, 2,3, 2,2, 2,1 или 2,0 мг на один носовой ход, включая, в частности, указанные граничные значения.

В одном из аспектов настоящего изобретения гибридный белок по изобретению вводят совместно с по меньшей мере одной из следующих аминокислот: аргинин, лизин или глютамин. Лекарственные средства, содержащие указанные аминокислоты, хорошо известны специалистам и представлены на рынке, и они могут применяться в готовом виде; альтернативно указанные аминокислоты могут быть включены в фармацевтическую композицию по изобретению в количествах, в которых эти аминокислоты обычно применяются, т. е. специалист может ориентироваться на известные дозировки и концентрации аминокислот. Примерные дозы аргинина, лизина и глютамина составляют от 1, 5, 10, 15, 20 или 25 мг/кг массы тела субъекта и до 50, 45, 40, 35 или 30 мг/кг массы тела субъекта, включая, в частности, указанные значения. Например, аминокислоты вводят в количестве от 0,1, 0,5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30 или 40 и до 50, 40, 30, 25, 20, 15, 10, 9, 8, 7 или 6 г/кг массы тела субъекта, включая, в частности, указанные граничные значения. Суточная доза указанных аминокислот при приеме человеком может, в частности, составлять от 0,15 г до 1,5 г каждой аминокислоты. При использовании аминокислот в фармацевтической композиции по изобретению, в частности в жидкой лекарственной форме, например спрее или каплях, концентрация каждой аминокислоты может составлять 0,1-50 мг/мл композиции. Этот диапазон включает поддиапазоны от 0,2, 0,3, 0,4, 0,5, 0,6, 0,7, 0,8, 0,9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30 мг/мл композиции и/или до 45, 40, 35, 30, 25, 20 мг/мл, включая, в частности, указанные граничные значения.

Все указанные дозы являются разовыми и их вводят предпочтительно 1, 2 или 3 раза в сутки. При этом, в случае интраназального введения указанные дозы вводят в каждый носовой проход. Однако в зависимости от необходимости, определяемой врачом, частота введения может быть как уменьшена, так и увеличена. Например, если используется лекарственная форма с длительным высвобождением, частота введения может быть уменьшена до 1 раза в 2 суток, 1 раза в 3 суток, 1 раза в 4 суток, 1 раза в 5 суток, 1 раза в 6 суток или 1 раза в неделю. С другой стороны, частота может быть увеличена до более двух раз в сутки, например 3, 4 или 5 раз в сутки.

Длительность введения активных веществ или композиций по изобретению составляет предпочтительно от 7 до 30 суток, например от 7, 8, 9, 10, 14, 21 суток и/или до 30, 28, 24, 23 суток. Безусловно, в зависимости от выраженности терапевтического эффекта и возможных побочных эффектов длительность лечения может быть как уменьшена, так и увеличена относительно указанных значений. Лечение может включать несколько курсов введения гибридного белка или композиции по изобретению или их по существу постоянный прием.

Субъекту вводят композицию по изобретению как можно быстрее после приступа инсульта, не позднее 120 мин. В данном контексте предпочтительно понимают первые признаки инсульта, которые можно определить с помощью теста FAST (Лицо-Рука-Речь) или УЗП. Как правило, терапевтическое окно составляет 5-120 мин после начала приступа инсульта. Предпочтительно субъекту вводят композицию по изобретению в течение 10-60 мин после инсульта. Наиболее предпочтительно композицию вводят в течение 10-15 мин после инсульта.

Точная дозировка будет зависеть от цели лечения и должна определяться лечащим врачом с помощью известных рекомендаций. Количество терапевтического агента, которое является эффективным для облегчения какого-либо конкретного заболевания или состояния (также обозначено термином "терапевтически эффективное количество") может изменяться в соответствии с несколькими факторами, такими как статус заболевания, возраст и масса тела пациента и другими. Дозировка может при необходимости быть скорректирована непосредственно в процессе лечения в зависимости от выраженности терапевтического эффекта и побочных эффектов.

Количество гибридного белка в композициях для применения согласно изобретению может варьировать в широких пределах в зависимости от желаемой лекарственной формы. В любом случае, содержание активных веществ в композициях по изобретению может быть подобрано исходя из примерных доз, указанных выше, таким образом, чтобы готовая лекарственная форма обеспечила наиболее легкое следование пациента предписанному ему режиму лечения.

Настоящее изобретение не ограничено объемом приведенных в качестве примера вариантов осуществления, которые предполагаются только в качестве иллюстраций или специфических аспектов настоящего изобретения. Различные модификации настоящего изобретения, дополнительные к раскрытым в данном документе, будут понятны специалистам с учетом имеющихся знаний в области техники. Предполагается, что все такие модификации охватываются прилагаемой формулой изобретения.

Экспериментальные модели

В связи с актуальностью данного заболевания важно адекватное тестирование лекарственных средств на этапе доклинических исследований. С этой точки зрения важен выбор подходящей модели заболевания на животных.

Для исследования нейропротекторного действия лекарственного средства наиболее часто используют такие модели как модель ишемического инсульта, вызванного перевязкой двух сонных артерий (глобальная церебральная ишемия), модель геморрагического инсульта, вызываемого краниотомией, модель глобальной церебральной ишемии, фокальной церебральной ишемии, вызванной внутрипросветной имплантацией филамента, модель субарахноидальной гематомы без краниотомии и другие.

В качестве биологических тест-систем могут выступать разные виды животных, но наиболее подходящими и часто используемыми являются крысы.

Исходя из практических и этических соображений, экспериментальное моделирование инсульта должно воспроизводиться при адекватной анестезии. В экспериментальной практике моделирования инсульта выбор анестезии является одной из важнейших составляющих, так как анестезия может влиять на основные показатели инсульта: выживаемость и площадь поражения головного мозга. Множество анестетиков имеют довольно высокий церебропротекторный потенциал и способны изменять адаптацию головного мозга к гипоксии, а следовательно и влиять на исход инсульта.

Модель глобальной церебральной ишемии путем окклюзии двух сосудов в совокупности с артериальной гипотензией (GBI)

GBI – острое нарушение мозгового кровообращения с повреждением ткани мозга, нарушением его функций вследствие затруднения или прекращения поступления крови к тому или иному отделу. По данным МКБ 10 данное состояние относится к ишемическим инсультам. Согласно статистическим данным ишемический инсульт является самым частым и распространенным цереброваскулярным заболеванием. Впервые GBI была описана в 1972 г Eklof и Siesjo. Данная модель характеризуется относительной простотой в исполнении и достаточно хорошей воспроизводимостью, вследствие чего, широко применяется в лабораторной практике для воспроизведения состояния глобальной ишемии головного мозга у крыс.

Для воспроизведения данной модели описано применение различных средств для наркоза. Например использование Zoletil 100 в сочетании с ксилазином в дозе 2,6 мг/кг внутривенно позволяет достигнуть глубокого, продолжительного наркоза и предотвратить влияние анестетика на развитие патологии.

После подготовки операционного поля выполняется срединный разрез шеи и послойное разобщение мышц и мягких тканей шеи тупым способом до выделения сосудисто-нервного пучка шеи слева и справа. В ходе выполнения данной манипуляции важно не повредить n. vagus. После выделения общей сонной артерии с обеих сторон выполняется их лигирование. Слева на общую сонную артерию накладывается одна лигатура. Справа сначала накладывается лигатура дистально, ближе к бифуркации общей сонной артерии, после чего под контролем артериального давления (АД) осуществляется кровопускание путем прокалывания общей сонной артерии катетером. Согласно рекомендациям необходимо понижать давление до 30 мм рт. ст. По окончании снижения АД методом кровопускания общая сонная артерия лигируется проксимальнее места вкола иглы катетера. Затем рана послойно ушивается и обрабатывается антисептиком.

При использовании данной модели можно учитывать и видовые различия животных. Так, например, у песчанки отсутствует Вилизиев круг, и ограничены анастомозы между передними артериями головного мозга. Такая анатомическая особенность позволяет индуцировать одностороннюю ишемию переднего мозга путем окклюзии одной сонной артерии, с уровнем успешности примерно 40%, двусторонней окклюзии общих сонных артерий – до 90%.

Для приближения метода к естественным условиям развития ишемического инсульта была разработана модифицированная модель.

У крысы рассекают мягкие ткани передней поверхности шеи срединным разрезом. Выделяют общие сонные и левую наружную сонную артерии. Под сосуды подводят лигатуры, при этом под левую общую сонную артерию две лигатуры (верхнюю и нижнюю). Перевязывают левую наружную сонную артерию, для предупреждения проведения окклюдера в этот сосуд и развития массивного кровотечения при введении окклюдера. Перевязывают левую общую сонную артерию нижней лигатурой для предупреждения массивной кровопотери при введении окклюдера. Непосредственно перед бифуркацией на левую общую сонную артерию накладывают зажим. Хирургической иглой с круглым сечением производят перфорацию стенки левой общей сонной артерии чуть выше места перевязки. Через вкол в артерии вводят окклюдер, после чего зажим снимают и окклюдер медленно, для предупреждения повреждения сосуда в месте бифуркации, проводят на глубину 17-20 мм по ходу общей и внутренней сонных артерий к средней мозговой до ощущения затруднения дальнейшего продвижения. Окклюдер фиксируют в сосуде путем перевязки общей сонной артерии верхней лигатурой выше места перфорации стенки сосуда. Затем перевязывают общую сонную артерию c противоположной стороны для снижения кровоснабжения мозга и ушивают рану.

В качестве окклюдера используют стерильную нить из хромированного кетгута 5.0. Нить нарезают на фрагменты по 30 мм и на последнем красящим веществом, например метиленовым синим, отмечают расстояние в 20 мм.

Одним из ранних критериев правильности выполненной методики является нарушение кровоснабжения глаза левой стороны, вследствие окклюзии a. ophthalmica. Через 48 ч наблюдается полное расплавление тканей глаза. Для проведения эксперимента берут крыс обоего пола весом 150-200 г. После моделирования ишемического инсульта по предлагаемому способу оценивают кровоснабжение тканей глаза левой стороны сразу после операции. Через 24, 48 и 72 ч оценивают неврологические изменения.

Способ позволяет приблизить модель к естественным условиям развития ишемического инсульта, обеспечить высокую воспроизводимость и снижение травматичности при проведении эксперимента.

Модель эндоваскулярной фокальной церебральной ишемии головного мозга путем внутрипросветной окклюзии средней церебральной артерии (FCI)

Еще одной моделью воспроизведения ишемического инсульта является модель эндоваскулярной фокальной церебральной ишемии головного мозга путем внутрипросветной окклюзии средней церебральной артерии, которая, в отличие от предыдущей модели, является моделью именно очагового ишемического инсульта, локализованного в заведомо предполагаемом месте повреждения – бассейне средней мозговой артерии.

Впервые данная модель была описана в 1986 г J. Koizumi и Y. Yoshida и в дальнейшем модифицирована и воспроизведена Zea Longa E.L. в 1989 г. Впоследствии модель была адаптирована и к мышам. Суть модели заключается в формировании ишемии мозга в бассейне средней мозговой артерии (СМА) монофиламентом эндоваскулярным способом.

Для воспроизведения патологии животное вводят в наркоз. Выделяют общую сонную артерию и ее ветви. Временно лигируют общую сонную артерию. Через наружную сонную артерию проводят монофиламент во внутреннюю сонную артерию приблизительно на расстояние 20-25 мм от бифуркации общей сонной артерии. Немаловажным фактором является обработка монофиламента силиконовым гелем для предотвращения перфорации сосудов головного мозга. После проведения монофиламента фиксируют его лигатурой на наружной сонной артерии, восстанавливают кровоток снятием лигатуры с общей СА и послойно ушивают рану.

Преимущества данной модели заключаются в том, что формирование патологии подразумевает под собой инфаркт головного мозга четкой локализации и не требует трепанации черепа.

Помимо непосредственно внутрипросветной окклюзии средней церебральной артерии существует модификация модели с использованием реперфузии. В этом случае внутрипросветная окклюзия средней мозговой артерии является временной, после чего кровоток восстанавливается за счет снятия лигатуры с общей сонной артерии. Наружная сонная артерия, через просвет которой вводился филамент, предварительно перевязывается. Время до реперфузии устанавливается исполнителями в соответствии с техническим оснащением лаборатории, а также для получения данных фокальной ишемии головного мозга при различных промежутках времени ишемии.

Данная модель, применяемая в экспериментальной практике, имеет важнейшее значение для разработки методов лечения ишемических инсультов и с лихвой компенсирует дороговизну, длительное время обучения и техническую сложность воспроизведения модели.

Модель субарахноидального кровоизлияния (SAH) внутрипросветной перфорацией сосудов головного мозга

Субарахноидальное кровоизлияние – кровоизлияние в субарахноидальное пространство (полость между паутинной и мягкой мозговыми оболочками). Согласно МКБ 10 данное состояние относится к геморрагическим инсультам.

Основной причиной SAH является разрыв артериальной аневризмы как правило, среднемозговой артерии. Именно это состояние и воспроизводит модель SAH внутрипросветной перфорацией сосудов головного мозга.

Данная модель впервые была описана в 1995 г. J. B. Bederson. Фактически она является модификацией фокальной церебральной ишемии по методу Zea-Longa. Индукция патологии осуществляется аналогично FCI, за исключением того, что нить продевается на расстояние 27-30 мм от бифуркации общей сонной артерии. Тем самым достигается перфорация среднецеребральной артерии. После чего филамент удаляют. Накладывают лигатуру на наружную сонную артерию. Восстанавливают кровообращение в общей сонной артерии, после чего операционную рану послойно ушивают.

Модель характеризуется высокой смертностью, которая составляет 40-60 % в первые три дня после моделирования. У выживших животных зачастую наблюдается помутнение роговицы – как результат окклюзии ветви среднецеребральной артерии – зрительной артерии.

Важно отметить, что модель характеризуется четкой локализацией поражения, что обеспечивает ее высокую повторяемость.

Отработка выполнения операционных вмешательств с целью моделирования заболеваний является важнейшим условием успешного выполнения фармакологического эксперимента. На отработку различных моделей инсульта обычно требуется около 144 лаборанто/дней. Такая подготовка к проведению собственно эксперимента позволяет значительно снизить смертность, подобрать информативные показатели оценки патологии, рассчитать время необходимое на проведение исследования. Особое внимание при моделировании инсультов следует уделить методам и средствам для наркоза.

Адекватное моделирование патологии позволит с высокой долей вероятности объективно оценить эффективность новых лекарственных препаратов для лечения инсультов на этапе доклинических исследований.

ПРИМЕРЫ

Пример 1. Получение IGF-1-long

Синтез гена и методы генетической инженерии

Синтез гена, кодирующего IGF-1-long человека, проводили методом удлинения частично перекрывающихся олигонуклеотидов, полученных с помощью автоматизированного химического синтеза. Реакции рестрикции и лигирования, селекцию трансформантов, выращивание бактериальных клеток, выделение и электрофорез плазмидных ДНК проводили с использованием стандартных методов генетической инженерии. Синтезированный ген был вставлен в вектор рЕТ28а(+) (Novagen, США) по сайтам NdeI и XhoI, полученной плазмидой рЕТ28-IGF-1 трансформировали клетки E. coli. Для первичного отбора трансформантов, проверки правильности синтеза и стыковки, а также для последующего длительного хранения плазмиды использовали клетки E. coli DH10 B [F- mcrA ∆(mrr-hsdRMS-mcrBC) φ80lacZ∆M15 ∆lacX74 recA1 endA1 araD139 ∆(ara-leu)7697 galU galK λ- rpsL nupG / pMON14272 / pMON7124] (Thermo Fisher Scientific, США). Для наработки рекомбинантного белка плазмидой рЕТ28-IGF-1 трансформировали клетки E. coli BL21 Star (DE3) (Invitrogen, USA), F- ompT hsdSB (rB-, mB-) gal dcm rne131 (DE3). Трансформацию клеток осуществляли методом электропорации с помощью генератора импульсов Gene Pulser Xcell™ Electroporation Systems (Bio-Rad, США) по инструкции производителя.

Культивирование клеток и анализ содержания рекомбинантного IGF-1-long

Культивирование клеток штамма-продуцента производили двумя способами - с использованием изопропил-β-D-тиогалактопиранозид (ИПТГ, IPTG) и лактозы в качестве индукторов синтеза целевого белка.

В первом варианте культуру клеток E. coli BL21 (pET28-IGF-1) выращивали в термостатированной качалке в 1 л среды LB, содержавшей 100 мкг/мл канамицина, при температуре +37 °С и скорости вращения 250 об/мин. После достижения культурой оптической плотности А600 0,6 оптических единиц добавляли индуктор – ИПТГ – до конечной концентрации 1 мМ и продолжали культивирование в течение 5 ч.

Для индукции лактозой по Studier отдельную колонию клеток штамма-продуцента инокулировали в 1 л среды PYP с 0,2 % лактозы и 100 мкг/мл канамицина и выращивали при +16 °С в течение ночи. Образцы культуры объемом 1 мл центрифугировали при 4000 g в течение 10 мин, после чего клеточные осадки лизировали добавлением пятикратного лизирующего раствора (10 % SDS, 10 мМ дитиотреитол, 30 % глицерин, 0,2 М трис-НСl, рН 6,8 и 0,05 % бромфенолового синего) и кипятили 10 мин. Электрофорез по методу Леммли проводили в 12,5 % ПААГ в денатурирующих редуцирующих условиях, с последующей окраской Кумасси G-250 и денситометрированием гелей. В качестве отрицательного контроля использовали культуру клеток штамма-продуцента без индукции синтеза белка IGF-1.

Выделение и очистка рекомбинантного IGF-1-long

Клетки Е. coli BL21 (pET28-IGF-1), выращенные в условиях индукции синтеза белка лактозой, осаждали центрифугированием при 10000 g, ресуспендировали в физиологическом растворе (1×PBS) в соотношении 5 мл 1×PBS / г влажной биомассы, после чего их разрушали с помощью генератора ультразвуковых волн (Heidolph Sonik 100, Германия) и центрифугировали при 10000 g в течение 12 мин при +4 °С. Полученный осадок ресуспендировали в исходном объеме промывочного раствора, содержащего 2 М мочевину, 20 mM Tris-HCl, рН 7,6, инкубировали в течение 30 минут при комнатной температуре, а затем центрифугировали 10000 g в течение 12 мин при температуре 4 °С. Супернатант удаляли, осадок отмытых телец включения растворяли в солюбилизирующем растворе (8 М мочевина, 20 мМ Tris-HCl, рН 8,0).

Рефолдинг проводили разбавлением солюбилизированного белка в 8 раз раствором 20 мМ Tris-HCl, рН 8,0; 0,01 % Tween 20, после чего фильтровали через фильтр с размером пор 0,2 мкм. Полученный раствор наносили на металлохелатную колонку объемом 5 мл (His-Trap Chelating, GE Healthcare, США), уравновешенную стартовым буфером (20 мМ Tris, рН 8,0; 0,01 % Tween 20). Использовали хроматограф Discovery 100 (Bio-Rad, США). После промывки колонки 10 объемами стартового буфера элюцию сорбированного белка проводили градиентом имидазола (0 мМ - 200 мМ) в стартовом буфере. Фракции, содержащие целевой белок, объединяли, подводили рН раствора белка до значения 8,8 добавлением 10 мМ NaOH и повторно фильтровали через фильтр 0,2 мкм. Раствор белка наносили на колонку с SP Sepharose Fast Flow GE Healthcare, уравновешенную стартовым буфером-2 (20 мМ Tris-HCl, рН 8,8; 0,01 % Tween 20). После нанесения и промывки колонки стартовым буфером-2 элюцию белка проводили линейным градиентом NaCl. Фракции, содержавшие целевой белок, объединяли и диализовали против 1×PBS. Содержание в препаратах бактериального эндотоксина определяли LAL-тестом (GeneScript, США). Раствор белка хранили при температуре -20 °С с добавлением глицерина до 10 %.

Пример 2. Оценка морфологических изменений в тканях головного мозга

Для эксперимента использовали модель эндоваскулярной фокальной церебральной ишемии головного мозга путем внутрипросветной окклюзии средней церебральной артерии (FCI).

Затем после индукции инсульта крысам, разделенным на группы по 16 особей, интраназально ежедневно вводили препараты, содержащие соответствующие активные вещества. Опытным группам 2-4 вводили препарат IGF-1-long (SEQ ID NO: 5) в виде раствора, содержащего 0,9 % NaCl и 0,3 % реополиглюкина. В качестве отрицательного контроля использовали группу особей, которым не вводили никакие лекарственные препараты (группа 1), и в качестве положительного контроля использовали группу особей, которым вводили стандартный препарат от инсульта Пиритинол (группа 5).

Гистологический анализ проводили следующим образом.

Для световой микроскопии мозг крысы фиксируют в 96% этиловом спирте. Парафиновые срезы окрашивают метиленовым синим, гематоксилин-эозином и по методу Ниссля. Далее оценивают гистопатологические изменения по 6-балльной шкале (Clonidine Decreases Ptasma Catecholamines and Improves Outcome From Incomplete Ischemia in the Rat, William E. Hoffman, Ph D, Mary Ann Cheng, M D, Chinamma Thomas, M D, Verna L. Baughman, M D, and Ronald F. Albrecht, M D Departments of Anesthesiology and Pathology, Humana / Michael Reese Hospital, University of Illinois, Chicago, Chicago, Illinois. ANESTH ANALG 1991; 73; 460-4).

Таблица 1. Балльная оценка гистологических изменений мозга крысы

Баллы Гистологические изменения
0 Отсутствие погибших нейронов
1 Гибель единичных нейронов
2 Мелкоочаговые инфаркты
3 Крупноочаговые инфаркты
4 Инфаркты с поражением более 50% объема полушария
5 Тотальный инфаркт полушария

Таблица 2. Влияние вводимого препарата IGF-1-long на гистологические изменения в мозге подопытных крыс.

Группа
1 2 3 4 5
Время после индукции инсульта, день Контроль, без введения препаратов от инсульта Введение
180 мкг IGF-1-long на 20 грамм веса особи
Введение 18 мкг IGF-1-long на 20 грамм веса особи Введение
180 мкг IGF-1-long плюс 500 мкг аргинина на 20 грамм веса особи
Контроль, 5 мг на 20 грамм веса особи
1 3 3 3 3 3
2 3 3 3 3 3
3 3 3 3 2 4
4 4 2 3 2 4
5 4 2 3 2 3
6 5 2 2 2 3
7 5 2 2 2 3

Пример 3. Фармакокинетические свойства IGF-1-long

Время жизни гибридного белка по изобретению оценивали после введения крысам 100 мкг белка (IGF-1-long (SEQ ID NO: 5) и IGF-1 без домена long (SEQ ID NO: 2)) в виде тех же препаратов, что указаны в примере 2, и измерения уровня белка в сыворотке крови. Как показано в Таблице 3, по сравнению с немодифицированной доменом long формой обеспечивается существенное продление времени полужизни гибридного белка, что приводит в конечном счете к пролонгированному действию белка.

Таблица 3. Изменение концентрации IGF-1 и IGF-1-long

Время, сутки уровень IGF-1 в крови, нг/мл, при введении 100 мкг на животное уровень IGF-1-long в крови, нг/мл, при введении 100 мкг на животное
1 765 658
2 223 634
3 183 580
4 196 530
5 179 227
6 187 192

1. Гибридный белок, обладающий нейропротекторной активностью, содержащий последовательность инсулиноподобного фактора роста 1 (IGF-1) или его изоформы, обладающей нейропротекторной активностью, к которой с С-конца присоединена, напрямую или посредством линкера, последовательность SEQ ID NO: 3.

2. Гибридный белок по п. 1, где IGF-1 имеет последовательность SEQ ID NO: 1 или 2.

3. Нуклеиновая кислота, кодирующая гибридный белок по п. 1 или 2.

4. Экспрессионный вектор, содержащий нуклеиновую кислоту по п. 3.

5. Клетка-хозяин, являющаяся продуцентом гибридного белка по п. 1 или  2, содержащая вектор по п. 4.

6. Фармацевтическая композиция для лечения инсульта, содержащая гибридный белок по п. 1 или 2 в эффективном количестве и фармацевтически приемлемый носитель.

7. Фармацевтическая композиция по п. 6, дополнительно содержащая аминокислоту, выбранную из аргинина, лизина, глютамина, или любую их смесь.

8. Фармацевтическая композиция по п. 6 или 7, где количество каждой используемой аминокислоты составляет 0,1-50 мг/мл.

9. Фармацевтическая композиция по любому из пп. 6-8, где инсульт является ишемическим или геморрагическим инсультом.

10. Способ лечения инсульта, включающий интраназальное введение пациенту гибридного белка по п. 1 или 2 в количестве 0,1-3 мг в каждый носовой проход.

11. Способ по п. 10, где первое введение гибридного белка осуществляют в течение 120 минут с момента начала приступа.

12. Способ по п. 10 или 11, при котором указанный гибридный белок вводят ежедневно 1-3 раза в сутки в течение от 7 до 30 суток.

13. Способ по любому из пп. 10-12, при котором пациенту совместно с указанным гибридным белком дополнительно вводят аминокислоту, выбранную из аргинина, лизина, глютамина, или любую их смесь.

14. Способ по любому из пп. 10-13, где инсульт является ишемическим или геморрагическим инсультом.

15. Применение гибридного белка по п. 1 или 2 для получения лекарственного средства для лечения инсульта.

16. Применение по п. 15, где инсульт является ишемическим или геморрагическим инсультом.



 

Похожие патенты:

Изобретение относится к области биотехнологии. Предложен способ получения продукта, выбранного из биополимера, экспрессируемого клеткой, клетки и микроорганизма, в биореакторной системе с отъемно-доливной ферментацией.

Изобретение относится к области биотехнологии, конкретно к получению выделенной клетки млекопитающего, подходящей для рекомбинантной экспрессии интересующего полипептида, где клетку млекопитающего изменяют для ухудшения функции эндогенной протеазы матриптазы посредством нокаута, мутации, делеции или сайленсинга гена матриптазы.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению в клетках Escherichia coli гибридного белка, и может быть использовано для очистки биотехнологических субстанций от бактериальных липополисахаридов.

Изобретение относится к области биотехнологии, конкретно к способу получения препаратов рекомбинантной нуклеазы семейства Cas системы CRISPR/Cas в клетках штамма Escherichia coli Rosetta-gami B (DE3) и их дальнейшей очистке.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков и может быть использовано для получения активного фрагмента (1-34) эндогенного человеческого паратиреоидного гормона.

Настоящее изобретение относится к области биотехнологии, конкретно к получению противомикробных пептидов, и может быть использовано в медицине для антимикробной терапии.

Настоящее изобретение относится к области биотехнологии, конкретно к белкам-агонистам рецептора TRAIL, и может быть использовано в медицине для противоопухолевого лечения.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению терапевтических белков, и может быть использовано для получения рекомбинантного фолликулостимулирующего гормона человека (рчФСГ).

Настоящее изобретение относится к области биотехнологии, конкретно к получению противомикробных пептидов, и может быть использовано в медицине для лечения или предотвращения бактериальной и грибковой инфекции.

Изобретение относится к клеточным технологиям и может быть использовано для рекомбинантного получения фолликулостимулирующего гормона (ФСГ) человека. Клеточную линию huFSHKKc6 получают путем трансформации клеток huFSHIK экспрессионной плазмидой длиной 7719 п.о., состоящей из гена устойчивости PuroR с SV40 polyA, укороченного 3'LTR HIV-1, гена устойчивости AmpR, промотора AmpR, ориджина репликации SV40 и pBR322, промотора NP гена р53 человека, pgk - конститутивного промотора гена фосфоглицераткиназы, синтетической нуклеотидной последовательности, кодирующей полноразмерную альфа-субъединицу ФСГ человека, сигнала терминации трансляции, состоящего из 3 пар оснований и консенсусной сигнальной последовательности Козак.

Изобретение относится к области биотехнологии, конкретно к противораковым пептидным агентам на основе фрагмента эндостатина, и может быть использовано в медицине в терапии рака предстательной железы.

Изобретение относится к области биохимии, в частности к полинуклеотиду, кодирующему стабилизированную конструкцию мультиспецифичного антитела. Также раскрыты фармацевтическая композиция, содержащая указанное антитело, вектор экспрессии, содержащий указанный полинуклеотид, клетка-хозяин, содержащая указанный полинуклеотид.

Предложенное изобретение относится к области биотехнологии, конкретно к иммунологии, и может быть использовано в медицине для противоопухолевой терапии. Описаны варианты антител и их антигенсвязывающих фрагментов, связывающихся с человеческим 4-1ВВ, также называемым CD137 или TNFRSF9.

Изобретение относится к способу получения полоксамера для применения в клеточной культуральной среде. Твердый полоксамер нагревают до 60-185°C до образования жидкого полоксамера.

Группа изобретений относится к концентрированным с низкой вязкостью малообъемным жидким фармацевтическим составам белков. Жидкий фармацевтический состав для инъекции содержит 174-230 мг/мл моноклонального антитела, имеющего молекулярную массу 120-250 кДа, прокаин или его фармацевтически приемлемую соль в концентрации 0,15-0,25 М и фармацевтически приемлемый растворитель, где указанный состав, находясь в объеме, подходящем для инъекции, имеет абсолютную вязкость 1-100 сП при 25°C, как измеряют, используя вискозиметр с конусом и плоскостью или микрожидкостный вискозиметр, и абсолютная вязкость указанного состава является меньшей, чем абсолютная вязкость контрольной композиции, содержащей указанное антитело и указанный фармацевтически приемлемый растворитель, но не содержащей прокаин или его фармацевтически приемлемую соль, и где абсолютная вязкость является экстраполированной вязкостью при нулевой скорости сдвига.

Настоящее изобретение относится к биотехнологии. Предложено антитело против пресепсина, а также антигенсвязывающий фрагмент антитела, полинуклеотид, экспрессирующий вектор, трансформированный штамм, способы получения антитела и его антигенсвязывающего фрагмента.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая применение нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для лечения рака или для предупреждения или лечения метастазов, применение комбинации нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для ингибирования роста злокачественной опухоли, которая экспрессирует мишень для иммуноцитокина, и/или повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую мишень для иммуноцитокина, применение комбинации нацеленного на карциноэмбриональный антиген (СЕА) иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим фибробластным активирующим белком (PD-L1), для ингибирования роста злокачественной опухоли, которая экспрессирует СЕА, и/или повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую СЕА, применение комбинации нацеленного на фибробластный активирующий белок (FAP) иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для ингибирования роста злокачественной опухоли, которая экспрессирует FAP, и/или повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую FAP, комбинацию нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для лечения рака, комбинацию нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, предназначенную для лечения пациента, имеющего экспрессирующую СЕА злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, имеющего экспрессирующую FAP злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или злокачественную опухоль, ассоциированную с экспрессией или сверхэкспрессией СЕА или FAP.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая фармацевтическую композицию для лечения заболевания или расстройства, поддающегося излечению посредством ингибирования активности GDF8 (варианты), и применение вышеуказанной фармацевтической композиции для получения лекарственного средства для лечения пациента, страдающего заболеванием или расстройством, которое поддается излечению посредством ингибирования активности GDF8, для диагностики такого заболевания или расстройства или для лечения пациента с риском развития такого заболевания или расстройства.

Изобретение относится к биотехнологии. Описан поксвирусный вектор для десенсибилизации, индукции переносимости или подавления аллергической реакции у субъекта на аллерген арахиса, который содержит нуклеотидную последовательность, кодирующую слитый белок, содержащий (i) по меньшей мере четыре аллергена арахиса, выбранных из группы, состоящей из ara h1, ara h2, ara h3, ara h4, ara5, ara h6, ara h7, ara h8, ara h9, ara h10 и ara h11, или их часть, содержащие аминокислотную последовательность, которая может быть объединена с MHC класса I и презентирована Т-лимфоцитам после деградации, и (ii) убиквитин для усиления внутриклеточной деградации слитого белка, последовательность контроля транскрипции и стартовый кодон для облегчения экспрессии слитого белка.

Изобретение относится к области биотехнологии, конкретно к композиции для инъекций, содержащей частицы, образованные посредством самосборки из полипептидов с SEQ ID NO: 1, индуцирующих адгезию и активацию тромбоцитов, и может быть использовано в медицине.

Настоящее изобретение относится к области биотехнологии, конкретно к иммуногенным пептидам, и может быть использовано для понижения или блокирования иммунного ответа к антигену, входящему в состав иммуногенного пептида.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению нейропротекторных белков, и может быть использовано в медицине для лечения инсульта. Конструируют гибридный белок, содержащий последовательность инсулиноподобного фактора роста 1 или его изоформы, обладающей нейропротекторной активностью, к которой с С-конца присоединена, напрямую или посредством линкера, последовательность SEQ ID NO: 3. Кроме этого изобретение относится к нуклеиновой кислоте, вектору, клетке-хозяину, фармацевтической композиции, способу лечения инсульта и применению, основанные на использовании указанного белка. Изобретение позволяет получить нейропротекторный белок, названный авторами «IGF-1-long», характеризующийся более длительным терапевтическим эффектом по сравнению с IGF-1, не слитым с дополнительным доменом. 7 н. и 9 з.п. ф-лы, 3 табл., 3 пр.

Наверх