Новый подход к лечению рака с применением иммуномодуляции



Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции
Новый подход к лечению рака с применением иммуномодуляции

Владельцы патента RU 2711380:

БАЙОКСЭЛ ТЕРАПЬЮТИКС, ИНК. (US)

Группа изобретений относится к области иммуноонкологии, в частности к способам лечения рака, усиления иммунного ответа у субъекта, страдающего раком, а также лечения, замедления или предотвращения метастазирования опухоли у субъекта, страдающего раком. Для этого вводят эффективное количество талабостата или его фармацевтически приемлемой соли в комбинации с антителом против PD-1. Также раскрыты способы лечения рака, усиления иммунного ответа у субъекта, страдающего раком, а также лечения, замедления или предотвращения метастазирования опухоли у субъекта, страдающего раком. Для этого вводят эффективное количество талабостата или его фармацевтически приемлемой соли в комбинации с антителом против CTLA4. Группа изобретений обеспечивает синергетический эффект при комбинировании талабостата с антителом против PD-1. 10 н. и 185 з.п. ф-лы, 9 ил., 8 табл., 1 пр.

 

Область техники

[1] Настоящее изобретение относится к области иммуноонкологии. В частности, оно относится к лечению рака или опухоли посредством иммуномодуляции с применением терапевтических агентов, включая малые молекулы, антитела, нанотела, искусственно сконструированные пептиды, искусственно сконструированные рецепторы, аутологический подход к усилению иммунитета или малую интерферирующую РНК (миРНК), селективно ингибирующих дипептидилпептидазу (например, белок активации фибробластов (FAP) или дипептидилпептидазу 8/9 (DPP 8/9)), в комбинации с ингибитором (ингибиторами) иммунной контрольной точки, с обеспечением иммуномодуляции. Предпочтительный селективный ингибитор дипептидилпептидазы представляет собой малую молекулу, например, талабостат (Talabostat).

Перекрестная ссылка на родственные заявки

[2] Настоящая заявка включает полное содержание предварительных заявок США серийные номера 62/193348 и 62/204495, поданных 16 июля 2015 года и 13 августа 2015 года соответственно, для всех мишеней.

Описание текстового файла, поданного в электронном виде

[3] Полное содержание текстового файла, поданного в электронном виде с настоящим документом, включено в настоящее описание посредством ссылки: копия Перечня последовательностей в машинно-читаемом формате (название файла: BIOX_008_02WO_SeqList, дата создания: 13 июля 2016 года; размер файла: 6 килобайт).

Уровень техники

[4] Рак представляет собой многоэтапный процесс, который начинается с незначительных преднеопластических изменений, которые могут прогрессировать до неоплазии, неопластических поражений, у которых может развиваться способность к инвазии, росту, метастазированию и гетерогенности. Современные виды терапии для лечения рака включают оперативное вмешательство, гормональную терапию, радиотерапию, химиотерапию и иммунотерапию. Иммунотерапия для лечения рака развивалась наряду с улучшением понимания иммунной системы. В частности, понимание способности раковых клеток нарушать противоопухолевый иммунный ответ послужило основанием для разработки новых видов иммунотерапии, которые направленно воздействуют на иммунные контрольные точки, ответственные за ускользание клеток опухоли от обнаружения и разрушения иммунной системой. Такие механизмы ускользания от иммунологического надзора реализуются либо непосредственно клетками опухоли, либо микроокружением опухоли. Известно, что клетки опухоли экспрессируют мембранные белки, секретируемые продукты, ферменты, противовоспалительные цитокины и хемокины, вызывающие изменения в их геноме, которые способствуют ускользанию от иммунологического надзора и ингибированию иммунного ответа. В то же время одну из ключевых ролей играет микроокружение опухоли.

[5] Молекулы, представляющие собой иммунные контрольные точки, такие как PD-1, PD-L1, CTLA-4, представляют собой сигнальный рецептор клеточной поверхности и играют важную роль в модуляции Т-клеточного ответа в микроокружении опухоли. Было показано, что клетки опухоли используют эти контрольные точки себе на пользу путем повышающей регуляции их экспрессии и активности. Соответственно, были разработаны ингибиторы иммунных контрольных точек, которые могут высвободить свойства иммунной системы, направленные на разрушение рака. Недавние находки позволили идентифицировать ммунные контрольные точки или мишени, такие как PD-1, PD-L1, PD-L2, CTLA4, TIM3, LAG3, CCR4, OX40, OX40L, IDO и A2AR, в качестве белков, ответственных за ускользание от иммунологического надзора, выступающих в роли тормозов иммунной системы. Специфичные ингибиторы иммунных контрольных точек, включая антитела к CTLA-4, рецептору PD-1 или его лиганду PD-L1, дали впечатляющие результаты в клинике в случае ряда раковых опухолей, что привело к тому, что FDA одобрила Ервой® (Ипилимумаб; антагонист CTLA-4), Опдиво® (Ниволумаб; антагонист PD-1) и Кейтруду® (Пембролизумаб; антагонист PD-1) при нескольких опухолевых заболеваний, а для многих других в настоящее время проводятся регистрационные исследования. Поскольку ингибиторы иммунных контрольных точек могут демонстрировать активность в случае многих или большинства типов опухолей, считается, что рынок данного типа терапии может вырасти до >100 миллиардов долларов США к 2020 году.

[6] К сожалению, ингибиторы контрольных точек имеют некоторые ограничения. Лишь меньшая часть пациентов, которых лечат ингибиторами контрольных точек, демонстрирует устойчивые противоопухолевые ответы, и большинство ответов являются частичными и временными. Многие пациенты вначале демонстрируют ответ, но затем происходит рецидиы вследствие появления путей резистентности, которые могут возникать по многим причинам, главным образом из-за образования клетками опухоли неиммунного пермиссивного микроокружения для преодоления действия ингибиторов иммунных контрольных точек; так называемые «невоспаленные» опухоли, или либо Т-клетки не рекрутируются в место локализации опухоли, либо даже в случае их присутствия, они не активируются. В данных случаях просто «отпускания тормоза» недостаточно для реализации полного противоопухолевого действия иммунной системы. Более того, противораковый иммунный цикл состоит из нескольких этапов, и современная гипотеза заключается в том, что комбинации различных ингибиторов, действующих на разных стадиях в данном цикле, позволят оптимизировать иммуноонкологическую терапию и повысить эффективность для более широкой популяции, и снизить резистентность.

[7] Эта гипотеза получила первое подтверждение после недавнего одобрения комбинации двух ингибиторов контрольных точек, ипилимумаба и ниволумаба, действующих на разных участках в противораковом иммунном цикле, которая повышала частоту ответов у пациентов с меланомой с 11% и 32%, наблюдаемых в случае соответствующей монотерапии, до 60% при применении указанной комбинации. К сожалению, главным недостатком данной комбинации является высокая токсичность, поскольку многие пациенты испытывают необычную токсичность, связанную с чрезмерным иммунным ответом, приводящим к пневмониту, гепатиту, колиту и другим нарушениям, связанным с иммунной системой. Также еще неизвестно, будет ли данная комбинация повышать частоту ответов в случае других опухолей помимо меланомы. Соответственно, в настоящее время исследования канцерогенеза направлены на определение применения терапевтических агентов, действующих в качестве иммуномодуляторов, которые воздействуют на опухоль или микроокружение опухоли. Используются различные базы данных, предоставляющие подробную информацию, относящуюся к геномике, протеомике и биоинформатике, для идентификации таких индивидуальных мищеней, на которые следует направленнонаправленно синергетически воздействовать для получения лучшего ответа на лечение. Авторы настоящего изобретения применяют в качестве мишенидипептидилпептидазу (DPP), которая, в частности, включает FAP и DPP 8/9, дипептидилпептидазу, связанную с ускользанием от иммунологического надзора.

[8] Анализ выявил существование нескольких подходов к направленному воздействию на дипептидилпептидазу (DPP), которая, в частности, включает FAP и DPP 8/9. Различные подходы включают малые молекулы, антитела, искусственно сконструированные пептиды, искусственно сконструированные рецепторы, аутологический подход к усилению иммунитета или миРНК, предпочтительным является подход на основе малых молекул, т.е. ингибитора, представляющего собой малую молекулу, такого как талабостат. Это клинически подтвержденная иммуномодулирующая малая молекула играет важную роль в ускользании от иммунологического надзора и регулирует и врожденный, и/или приобретенный иммунитет.

[9] Талабостат, также известный как PT-100 (Val-бороPro; L-валинил-L-боропролин), первоначально разрабатывался Point Therapeutics в 2000-2007 годах. Он представляет собой доступный в форме для перорального введения синтетический селективный ингибитор дипептидилпептидаз, таких как FAP и DPP8, и DPP9. Стереоизомер молекулы талабостата описан в патенте США № 6825169, а его препарат для перорального введения, такой как таблетка, капсула, пастилки, описан в патенте США № 7265118.

[10] В патенте США № 6949514, принадлежащем Point Therapeutics, Inc., описан способ лечения аномальной пролиферации клеток млекопитающего путем введения талабостата. В заявке PCT № 2007058957, принадлежащей Point Therapeutics, Inc., описана комбинация талабостата по меньшей мере с одним цитокином, таким как ИЛ-2, интерферон, гранулоцитарный колониестимулирующий фактор (G-CSF) или колониестимулирующий фактор гранулоцитов-макрофагов (GM-CSF). Эти цитокины не являются ингибиторами иммунных контрольных точек, хотя они стимулируют иммунную систему, но не «устраняют тормоза», поэтому настоящее изобретение полностью отличается от этого описания.

[11] В патенте США № 6890904, принадлежащем Point Therapeutics, Inc., описана комбинация талабостата по меньшей мере с одним противораковым лекарственным средством. Однако данные виды терапии талабостатом отдельно или в комбинации с цитокином или химиотерапевтическими агентами не эффективны для лечения рака и в клинических исследованиях рака поджелудочной железы и легкого. Талабостат достиг первичных, а также вторичных конечных точек.

[12] В заявке PCT № 2007059099, принадлежащей Point Therapeutics, Inc., описана комбинация талабостата с пеметрекседом или эрлотинибом, или Доцетакселом. Также описано, что указанная комбинированная терапия дополнительно включает введение ракового антигена, такого как B7-H1. Однако WO’099 не дает никакого описания комбинации талабостата с ингибиторами иммунных контрольных точек.

[13] В европейском патенте № 2782994, принадлежащем Trustees of Tufts College, описано соединение ARI-4175 или другие соединения, ингибирующие активность сериновых протеаз DASH млекопитающих, отдельно или в комбинации с иммунотерапевтическими средствами для лечения рака, при этом указанное соединение не является val-boro-pro. Соответственно, EP’994 сосредоточен на применении соединения ARI-4175 для лечения рака, при этом талабостат исключен из заявленного объема. Однако настоящее изобретение сфокусировано на применении талабостата в комбинации с ингибиторами иммунных контрольных точек.

[14] Талабостат демонстрирует различные нежелательные явления, и наиболее распространенные нежелательные явления представляют собой отек/периферическое опухание, гипотензию, гиповолемию и головокружение. Данные нежелательные явления, а также неудовлетворительные первичные и вторичные исходы в клинических исследованиях могут приводить к исключению молекулы талабостата.

[15] Новые факты в этом отношении включают селективный ингибитор дипептидилпептидазы (DPP) в комбинации с ингибитором иммунной контрольной точки, состоящим из нескольких элементов. Во-первых, комбинированная терапия неожиданно более эффективна в субтерапевтических дозах. Более того, было показано, что ингибитор DPP индуцирует отек, который также представляет собой основную токсичность, связанную с химиотерапевтическими агентами, и, следовательно, комбинация с химиотерапевтическим агентом индуцирует аддитивную, потенциально синергетическую токсичность, которая приводит к прекращению лечения и ограниченной эффективности. Ингибитор иммунной контрольной точки не вызывает отек в качестве соответствующей токсичности, поэтому данный новый комбинированный подход не будет иметь ограничения, наблюдаемого в случае предшествующей комбинации.

[16] Конечный элемент состоит из идентификации новой комбинации (т.е. селективного ингибитора DPP и ингибитора иммунной контрольной точки), обладающей сильным аддитивным/синергетическим механизмом действия.

[17] Подводя итог, авторы настоящего изобретения разработали комбинацию селективного ингибитора DPP, такого как талабостат, с ингибитором иммунной контрольной точки для устранения проблем уровня техники, которая может усиливать или продлевать противоопухолевое и иммуномодулирующее действие ингибитора иммунной контрольной точки, приводящее к разрушению микроокружения опухоли, усиливающее инфильтрацию и атаку иммунными клетками, превращающее неиммуногенную опухоль в иммуногенную опухоль, позволяющее субъекту отвечать на не отвечающий на лечение рак или снижающее дозу или токсичность талабостата и/или ингибитора иммунной контрольной точки.

[18] Соответственно, задачей настоящего изобретения является обеспечение улучшенных способов с применением новой комбинации для лечения рака.

Краткое описание изобретения

[19] Авторы настоящего изобретения неожиданно обнаружили, что существует сильный аддитивный/синергетический механизм действия, который обуславливает применение комбинации селективного ингибитора дипептидилпептидазы и ингибитора иммунной контрольной точки. Селективный ингибитор дипептидилпептидазы, в частности, ингибитор FAP (белок активации фибробластов) и DPP8/9, вызывает повышающую регуляцию хемокинов, что обеспечивает миграцию эффекторных клеток как врожденного, так и приобретенного иммунитета в опухоль. Селективный ингибитор дипептидилпептидазы демонстрирует синергетическое противоопухолевое действие совместно с ингибитором иммунной контрольной точки, поскольку он может стимулировать выработку иммунных клеток, способных распознавать клетки опухоли, а затем стимулировать миграцию данных иммунных клеток в опухоль. Ингибитор иммунной контрольной точки, такой как антагонист PD-1, действует путем «устранения тормоза», который создают клетки опухоли против иммунной системы. Селективный ингибитор дипептидилпептидазы, в частности ингибитор FAP и DPP8/9, действует как ускоритель стимуляции иммунной системы и трансформации не отвечающих на лечение опухолей с непермиссивным микроокружением в отвечающую и иммуннопермиссивную среду для увеличения числа и продолжительность ответов.

[20] В соответствии с главным аспектом настоящего изобретения предложено новое применение существующих или новых терапевтических агентов, селективно ингибирующих и направленно воздействующих на дипептидилпептидазу, в комбинации с ингибитором иммунной контрольной точки для лечения опухоли. Указанные терапевтические агенты включают малые молекулы, антитела, нанотела, искусственно сконструированныйпептид, искусственно сконструированныйбелок, вакцины, терапию миРНК или аутологические подходы к усилению иммунитета.

[21] Соответственно, другой аспект настоящего изобретения относится к способам усиления иммунного ответа, включающим введение субъекту эффективного количества терапевтического агента, селективно ингибирующего и направленно воздействующего на дипептидилпептидазу, в частности белок активации фибробластов (FAP) или дипептидилпептидазу 8/9 (DPP 8/9), в комбинации с ингибитором иммунной контрольной точки, влияющим на иммунный ответ или рост опухоли через иммунные контрольные точки или мишени. Примеры таких иммунных контрольных точек или мишеней включают, но не ограничиваются ими, PD-1, PD-L1, PD-L2, CTLA4, VISTA, TIM3, LAG3, KIR, IDO, A2AR.

[22] В соответствии с другим аспектом настоящего изобретения предложен способ усиления иммунного ответа у субъекта, включающий введение эффективного количества терапевтического агента (агентов), действующего на опухоли, клетки в их микроокружении, иммунные клетки или секретируемые продукты путем селективного ингибирования активности дипептидилпептидазы, в комбинации с ингибитором иммунной контрольной точки для усиления иммунного ответа у субъекта, где у указанного субъекта диагностирована опухоль.

[23] В соответствии с другим аспектом, представленном в настоящем описании, терапевтический агент выбран из группы, состоящей из малой молекулы, антитела, нанотела, искусственно сконструированного пептида, искусственно сконструированного белка, вакцины, терапии миРНК или аутологичного терапевтического средства, усиливающего иммунный ответ, предпочтительно малой молекулы. Терапевтический агент включает селективный ингибитор дипептидилпептидазы, который включает ингибирование белка активации фибробластов и/или дипептидилпептидазы 8/9. Предпочтительный терапевтический агент представляет собой малую молекулу или антитело. Примером предпочтительной малой молекулы является талабостат.

[24] В соответствии с другим аспектом настоящего изобретения предложен способ усиления, повышения, стимуляции, экспрессии, модуляции желаемого иммунного ответа у субъекта, включающий введение эффективного количества малой молекулы или антитела, селективно ингибирующего дипептидилпептидазу (например, FAP или DPP 8/9), в комбинации с ингибитором иммунной контрольной точки, выбранным из группы, состоящей из антагониста PD-1, антагониста PD-L1, антагониста PD-L2, антагониста CTLA4, при этом у указанного субъекта диагностирована опухоль, связанная с повышенными уровнями FAP или DPP 8/9. Указанная малая молекула предпочтительно представляет собой талабостат. Указанное антитело представляет собой анти-FAP-антитело.

[25] В соответствии с другим аспектом настоящего изобретения предложен способ идентификации опухолей с повышающей регуляцией белка активации фибробластов или дипептидилпептидазы 8/9, в отношении которых окажет полезный эффект ингибирование их активности и комбинирование лечения с ингибитором иммунной контрольной точки, выбранным из группы, состоящей из антагониста PD-1, антагониста PD-L1, антагониста PD-L2, антагониста CTLA4, у пациентов, страдающих раком.

[26] В соответствии с другим аспектом настоящего изобретения предложен способ лечения пролиферативных заболеваний, в том числе опухоли, включающий введение нуждающемуся в этом субъекту синергетически, терапевтически эффективного количества селективного ингибитора дипептидилпептидазы в комбинации с ингибитором иммунной контрольной точки.

[27] В соответствии с некоторыми аспектами настоящего изобретения предложен селективный ингибитор дипептидилпептидазы для применения для лечения опухоли, ослабляемой стимуляцией иммунного ответа, при этом в указанном лечении совместно вводят ингибитор иммунной контрольной точки.

[28] В соответствии с некоторыми аспектами настоящего изобретения предложена комбинированная терапия для лечения опухоли, при этом указанная комбинация содержит:

(i) селективный ингибитор дипептидилпептидазы и

(ii) ингибитор иммунной контрольной точки.

[29] Некоторые аспекты настоящего изобретения относятся к комбинации селективного ингибитора дипептидилпептидазы, в частности талабостата, и антагониста оси PD-1 для лечения опухоли.

[30] Некоторые аспекты настоящего изобретения относятся к комбинации селективного ингибитора дипептидилпептидазы, в частности талабостата, и антагониста CTLA4 для лечения опухоли.

[31] В соответствии с некоторыми аспектами настоящего изобретения предложена фармацевтическая композиция для применения в комбинации с ингибитором иммунной контрольной точки, включая антагонист PD-1, антагонист PD-L1, антагонист PD-L2 и антагонист CTLA4, для лечения опухоли, при этом указанная фармацевтическая композиция содержит селективный ингибитор дипептидилпептидазы совместно с одним или более фармацевтически приемлемыми носителями или адъювантами.

[32] В соответствии с другим аспектом настоящего изобретения предложено применение селективного ингибитора дипептидилпептидазы в комбинации с ингибитором иммунной контрольной точки в изготовлении фармацевтической композиции для лечения опухоли.

[33] В соответствии с некоторыми аспектами настоящего изобретения предложен набор, содержащий:

(i) первую композицию, содержащую селективный ингибитор (ингибиторы) дипептидилпептидазы, и

(ii) вторую композицию, содержащую ингибитор (ингибиторы) иммунной контрольной точки.

[34] Другие признаки, цели и преимущества настоящего изобретения будут очевидны исходя из описания и чертежей, и формулы изобретения.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

[35] Фиг. 1: показана противоопухолевая эффективность талабостата в качестве единственного агента, а также в комбинации с 5 мг/кг антагониста PD-1 (BioXcell; кат № BPO146) в модели аденокарциномы толстой кишки у мышей MC38. Исследование также показывает значительное ингибирование роста опухоли в 11 день после лечения.

[36] Фиг. 2: показана дозозависимая противоопухолевая эффективность талабостата в качестве единственного агента или в комбинации с 5 мг/кг антагониста PD1 (BioXcell; кат № BPO146) в модели аденокарциномы толстой кишки у мышей MC38. Также показано синергетическое противоопухолевое действие комбинации и также показана эквивалентная эффективная доза талабостата (20 мкг один раз в сутки так же эффективны, как и 10 мкг два раза в сутки).

[37] Фиг. 3A-G: показано действие одного агента по сравнению с комбинацией талабостата и антагониста PD-1 (BioXcell; кат № BPO146) в отношении высвобождения провоспалительных цитокинов и хемокинов. Указанная комбинация демонстрирует выраженное синергетическое действие по сравнению с одним агентом, наблюдаемое по увеличению профилей секреции IL-2 (Фиг. 3А), GM-CSF (Фиг. 3B), IL-12p40 (Фиг. 3C), IL-6 (Фиг. 3D), G-CSF (Фиг. 3Е), IL-15 (Фиг. 3F), IL-7 (Фиг. 3G) по данным анализа Luminex в образцах сыворотки мышей, несущих аденокарциному толстой кишки MC38, для указанных групп лечения и моментов времени.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

[38] Сокращения:

В настоящем описании следующие сокращения имеют следующие значения:

A2AR: A2A-аденозиновый рецептор

B.I.D: два раза в сутки

CTLA4: белок 4, ассоциированный с цитотоксическими Т-лимфоцитами

CART: Т-клетка с химерными антигенным рецептором

DPP: дипептидилпептидаза

DMEM: модифицированная по способу Дульбекко среда Игла

FAP: белок активации фибробластов

GM-CSF: гранулоцитарно-макрофагальный колониестимулирующий фактор

G-CSF: гранулоцитарный колониестимулирующий фактор

HBSS: сбалансированный солевой раствор Хенкса

IL: интерлейкин

IDO: индоламин-2,3-диоксигеназа

LAG3: белок гена активации лимфоцитов-3

PD-1: запрограммированная гибель клеток 1

KIR: белок гена активации лимфоцитов-3

KLH: гемоцианин фиссуреллы

NK: природный киллер

Q.D: каждый день

TIM3: молекула 3, содержащая Т-клеточный иммуноглобулиновый и муциновый домен

VISTA: супрессор активации Т-клеток, содержащий V-Ig-домен

[39] Ниже будет приведено дополнительное описание настоящего изобретения. В следующих частях более подробно определены различные аспекты настоящего изобретения. Каждый аспект, определенный таким образом, можно комбинировать с любым другим аспектом или аспектами, если явным образом не указано противоположное. В частности, любой признак, указанный как предпочтительный или подходящий, можно комбинировать с любым другим признаком или признаками, указанными как предпочтительные или подходящие.

[40] Согласно настоящему изобретению предложен такой иммуномодулирующий механизм ускользания от иммунологического надзора, на который можно направленно воздействовать в комбинации с различными терапевтическими агентами, чтобы препятствовать ускользанию от иммунологического надзора, выбираемому клетками опухоли и ее микроокружением. Это будет включать комбинацию нескольких иммуномодулирующих подходов, таких как увеличение доступа иммунных клеток к опухоли путем оказания антагонистического действия в отношении механизмов подавления иммунитета, оказания антагонистического действия в отношении ингибирующих иммунологических путей или путем активации иммуностимулирующих путей. Данные иммуномодулирующие направленно воздействующие агенты являются клинически активными при различных злокачественных опухолях, включая те, которые традиционно не относятся к иммуногенным.

[41] Одной из мишеней является дипептидилпептидаза, которая включает белок активации фибробластов (FAP), гомодимерную интегральную мембранную протеазу с активностью дипептидилпептидазы и дипептидилпептидазу (DPP 8/9), используемая в качестве одного из терапевтических подходов к лечению опухоли в комбинации со вторым иммуномодулирующим подходом, включающим направленное воздействие на лиганд запрограммированной гибели клеток 1 или PD-1, или белок 4, ассоциированный с цитотоксическими Т-лимфоцитами (CTLA4), или другие иммуномодулирующие мишени. Рецептор запрограммированной гибели клеток 1 (PD-1), его лиганды (PD-L1/2) и CTLA4 (белок 4, ассоциированный с цитотоксическими Т-лимфоцитами) играют роль в индуцируемой опухолью иммуносупрессии и способствовали критическому продвижению в разработке иммунотерапевтических лекарственных средств.

[42] Преимущество комбинации селективного ингибитора дипептидилпептидазы и терапевтических подходов, направленно воздействующих на молекулы иммунных контрольных точек, позволяет уменьшить развитие опухолей, уменьшить опухолевую массу или вызвать регрессию опухоли у хозяина, представляющего собой млекопитающее.

[43] Настоящее изобретение относится к комбинации селективного ингибитора дипептидилпептидазы и ингибитора иммунной контрольной точки для способствования эффективному противоопухолевому ответу. Ниже следует подробное описание различных признаков настоящего изобретения:

[44] Различные терапевтические агенты/антитела согласно настоящему изобретению описаны ниже:

I. Терапевтические агенты

[45] Терапевтический агент, селективно направленно воздействующий на и ингибирующий дипептидилпептидазу, представляет собой селективный ингибитор дипептидилпептидазы, который включает антитело (включая антитело или нанотело анти-FAP) или малую молекулу (например, талабостат). Предпочтительный селективный ингибитор дипептидилпептидазы представляет собой малую молекулу (например, талабостат).

a) Селективный ингибитор дипептидилпептидазы

[46] Семейство дипептидилпептидаза(DPP)-подобных генов представляет собой семейство молекул, имеющих родственную белковую структуру и функцию. Указанное семейство генов включает следующие молекулы: DPPIV (CD26), дипептидиламинопептидаза-подобный белок 6 (DPP6), дипептидиламинопептидаза-подобный белок 8 (DPP8), дипептидиламинопептидаза-подобный белок 9 (DPP9) и белок активации фибробластов (FAP). Селективный ингибитор дипептидилпептидазы включает, в частности, ингибиторы FAP и DPP 8/9. Применительно к онкологии, современное представление о DPP (в частности, FAP и DPP 8/9) имеет важное значение для механизма действия талабостата.

Ингибиторы белка активации фибробластов (FAP)

[47] Белок активации фибробластов (FAP) или сепраза является членом семейства интегральных мембранных сериновых пептидаз и относится к семейству пропилолигопептидаз. Он представляет собой пропилспецифичный фермент, проявляющий активность как эндопептидазы, так и дипептидилпептидазы. FAP представляет собой белок, экспрессируемый на фибробластах, присутствующих в микроокружении опухоли. Он существует в виде димера как на клеточной поверхности, так и в растворимой циркулирующей форме в крови. Он селективно экспрессируется в реактивных стромальных фибробластах многих гистологических типов эпителиальных раковых опухолей, таких как рак поджелудочной железы, молочной железы, легкого, толстой и прямой кишки, глиобластома. Он также связан с грануляционной тканью заживающих ран и злокачественными клетками некоторых сарком костных и мягких тканей. Было показано, что FAP из-за своей пептидазной активности ответственен за распад внеклеточного матрикса вокруг опухоли и облегчает метастатический процесс. Также было показано, что он увеличивает ангиогенез, таким образом приводя к росту опухоли. В то же время фибробласты, экспрессирующие FAP, могут продуцировать хемокины и цитокины, которые уменьшают иммунную инвазию опухоли. Следовательно, были разработаны ингибиторы FAP или антитела для ослабления роста опухоли.

[48] Ингибиторы FAP доступны на рынке в виде талабостата (PT-100, Val-боро-pro) и Сибротузумаба.

[49] Взаимозаменяемым названием талабостата является PT-100, талабостат (USAN) и [(2R)-I-I[(2S)-2-амино-3-метил-1-оксобутил]-2-пирролидинил]бороновая кислота. Регистрационный номер CAS для талабостата 149682-77-9. В соответствии с некоторыми аспектами можно применять свободное основание. В соответствии с другими аспектами талабостат может представлять собой сольват. В соответствии с другими аспектами можно применять производное талабостата. В большинстве клинических составов талабостат представлен в форме соли. Предпочтительно, солевую форму получают путем комбинирования талабостата в виде свободного основания с метансульфонатной солью. Форма соли может представлять собой мезилат талабостата. Соответственно, в настоящем описании термин «талабостат» включает мезилат талабостата. АФИ представляет собой единственный энантиомер, имеющий конфигурацию R, S. талабостат может существовать как в линейной, так и в циклической форме.

[50] Талабостат эффективен для лечения рака или опухоли за счет модуляции многочисленных внутриклеточных и внеклеточных дипептидилпептидаз. В частности, внутриклеточные и внеклеточные дипептидилпептидазы включают белок активации фибробластов, DPP 8/9, CD26/DPP4 и DPP2. Талабостат имеет двойной механизм действия, который включает направленно направленную на строму активность через ингибирование FAP и направленно направленную иммуностимулирующую активность через ингибирование DPP 8/9. Талабостат ингибирует ферментативную активность FAP, тем самым подавляя рост опухоли. Также ингибирует DPP8/9 и тем самым индуцирует ответ IL 1β (через каспазу-1) в строме опухоли и лимфатических узлах. Двойной механизм действия талабостата внедряет новый подход к лечению рака, поскольку он объединяет как направленно направленную на опухоль активность, так и иммуностимулирующую активность в одном агенте.

[51] Сибротузумаб, описанный в патенте США № 6445677, принадлежащем Boehringer Ingelheim. International Gmbh, представляет собой моноклональное антитело, которое связывается с FAP-α.

[52] Другие ингибиторы FAP включают, но не ограничиваются ими, такие как ARI-3099 (N-(пиридин-4-карбонил)-d-Ala-бороPro), описанный в Sar Sarah E. Poplawski et al.., 2013, V. 56(9), страница № 3467-3477; ARI-3996, описанный в заявке на патент США № 20140255300; MIP-1231 (MIP-1232 или MIP-1233), описанный в заявке на патент США № 20100098633; (4-хинолиноил)-глицил-2-цианопирролидины, описанные Koen Jansen et al., 2013, V. 4 (5), страница № 491-496; (2S)-1-(2-(1-нафтоиламино)ацетил)пирролин-2-карбонитрил, описанный в патенте США № 8183280; (S)-A-(2-(2-циано-4,4-дифторпирролидин-1-ил)-2-оксоэтил)-1-нафтамид и другие родственные производные, описанные в заявке РСТ № 2013107820; (2S)-1-((2S)-2-(2-метоксибензоиламино)-3-метилпентаноил)пирролидин-2-карбонитрил и другие родственные производные, описанные в заявке на патент США № 20120053222; Ac-Gly-бороPro, описанный Conrad Yap Edosada et al. 2006, Vo. 281(11), страница № 7437-7444; содержащие заместители диамиды 4-карбоксилметилпироглутаминовой кислоты, описанные в Ting-yueh Tsai et al., 2010, V. 53(18), 6572-6583; GEH200200, описанный P. Iveson et al., 2014, V. 41(7), 620; UAMC-1110, описанный в патенте США № 9346814; некоторые ингибиторы FAP, также описанные в заявке PCT № 2002038590, патенте США № 7399869; патенте США № 7998997.

[53] Другие патенты описывают антитело FAP-α, например, патент США № 8568727 (принадлежащий Boehringer Ingelheim. International Gmbh), Европейский патент № 1268550 (принадлежащий Boehringer Ingelheim. International Gmbh), патент США № 8999342 (принадлежащий Ludwig Institute for Cancer Research Ltd), патент США № 9011847 (принадлежащий Roche Glycart). Биспецифические антитела FAP с DR-5 описаны в заявке на патент США № 20140370019 и 20120184718; комбинация химерного антигенного рецептора и FAP описана в заявке на патент США № 20140099340.

[54] Антитело F11-24 представляет собой моноклональное антитело мыши, направленно воздействующее на FAP. Антитело анти-FAP-α включает антитела, выработанные у мыши к эпитопу синтетического пептида, конъюгированного с гемоцианином фиссуреллы (KLH), между аминокислотами 15-41 N-концевой области; аминокислотам Leu26-Asp760; и аминокислотам 525-625.

(PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS - (SEQ ID NO: 1)).

[55] Подобным образом, антитело анти-FAP включает антитела, выработанные у кролика к эпитопу N-конца белка активации фибробластов человека, альфа из 57-73 аминокислот с последовательностью FFPNWISGQEYLHQSAD (SEQ ID NO: 2); аминокислотам 26-280; аминокислотам 95-337; аминокислотам 300-380; аминокислотам 331-380 внутренней области FAP-1 человека; аминокислотам 350-400; kLH-конъюгированному синтетическому пептиду из аминокислот 396-426, аминокислоте Lys366; аминокислотам Ile523-Asp760 сепразы человека, экспрессированной в E.coli; аминокислотам 525-625; аминокислотам 544-599; аминокислотам Gly542-Asp761; аминокислотам 652-701; С-концевой области FAP человека с иммуногенной последовательностью

SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA (SEQ ID NO: 3);

ERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENKELE NALKNIQLPK EEIKKLEVDE ITLWYKM (SEQ ID NO: 4).

Таблица 1

Иммуногенная последовательность ID последовательности Поставщик
PPQFDRSKKYPLLIQVYGGPCSQS
VRSVFAVNWISYLASKEGMVIAL
VDGRGTAFQGDKLLYAVYRKLG
VYEVEDQITAVRKFIEMGFIDEKR
IAIWGWS
SEQ ID NO: 1 www.sigmaaldrich.com/catalog/product/sigma/sab1403805
www.antibodypedia.com/gene/33750/FAP/antibody/585989/H00002191-M02
FFPNWISGQEYLHQSAD SEQ ID NO: 2 www.bosterbio.com/anti-fibroblast-activation-protein-alpha-antibody-pa1913.html
SWEYYASVYTERFMGLPTKDDNL
EHYKNSTVMARAEYFRNVDYLLI
HGTA
SEQ ID NO: 3 www.avivasysbio.com/fap-antibody-c-terminal-region-arp46455-p050.html
ERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEI KILEENKELENALKNIQLPK EEIKKLEVDE ITLWYKM SEQ ID NO: 4 atlasantibodies.com/#!/products/FAP-antibody-HPA059739

Дипептидилпептидаза 8/9

[56] Было обнаружено, что DPP8 и DPP9 представляют собой два члена подсемейства пропилолигопептидаз S9b, которое включает также DPPIV и FAP. Оно характеризуется редкой способностью расщеплять постпролиновую связь двух остатков с N-конца субстрата. DPP8 и DPP9 демонстрируют уникальные паттерны клеточной локализации, повсеместно экспрессируются в тканях и линиях клеток и вносят важный вклад в различные биологические процессы, включая: поведение клеток, биологию рака, патогенез заболевания и иммунные ответы.

[57] Ингибирование дипептидилпептидазы (DPP 8/9) и DPP 8/9 приводит к индукции IL-1β (через активацию Каспазы-1) в строме опухоли и лимфатических узлов, приводит к выработке цитокинов и хемокинов, что применяют в качестве одного из терапевтических подходов к лечению рака в комбинации со вторым иммуномодулирующим подходом.

[58] Ген DPP8 локализован в хромосоме 15q22 человека, кодирует белок из 882 аминокислот. Он локализован в цитоплазме и имеет молекулярную массу 100 кДа.

[59] Специфические ингибиторы DPP8/9 представляют собой (2S,3R)-2-амино-1-(изоиндолин-2-ил)-3-метилпентан-1-он (алло-Ile-изоиндолин (UAMC00132); (S)-2,6-диамино-1-(изоиндолин-2-ил)гексан-1-он (Lys-изоиндолин (UAMC00071); 1G244 (PTX-1210; (S)-2-амино-4-{4-[бис-(4-фторфенил)-метил]пиперазин-1-ил}-1-(1,3-дигидроизоиндол-2-ил)-бутан-1,4-дион), PTX-1200 (циклогексилглицинизоиндолин); (2S)-2-амино-4-(4-((4-хлорфенил)(фенил)метил)пиперазин-1-ил)-1-(5-фторизоиндолин-2-ил)бутан-1,4-дион бис-(2,2,2-трифторацетат); (2S)-2-амино-4-(4-((4-хлорфенил)(фенил)метил)пиперазин-1-ил)-1-(изоиндолин-2-ил)бутан-1,4-дион бис(2,2,2-трифторацетат); (S)-2-амино-4-((S)-4-(бис(4-фторфенил)метил)-3-метилпиперазин-1-ил)-1-(изоиндолин-2-ил)бутан-1,4-дион бис(2,2,2-трифторацетат); (2S)-2-амино-4-((3R)-4-((3-фторфенил)(4-фторфенил)-метил)-3-метилпиперазин-1-ил)-1-(изоиндолин-2-ил)бутан-1,4-дион бис(2,2,2-трифторацетат, пептид SUMO1 EIL (описанный в заявке на патент США № 20150266922).

[60] В соответствии с другими аспектами антитело анти-FAP может представлять собой нанотело. Технология нанотел была разработана на основе обнаружения, что антитела от верблюдов и лам (Camelidae, верблюдовые) содержат тяжелые цепи, но не содержат легких цепей. Антигенсвязывающий центр таких антител является одним единственным доменом и может быть обозначен VHH. См., например, патент США №№ 5800988 и 6005079, и публикацию международной заявки №№ WO 94/04678, WO 94/25591 и ЕР 2673297, содержание которых включено посредством ссылки.

Ингибиторы иммунных контрольных точек

[61] Ингибитор иммунной контрольной точки включает антагонист PD1, антагонист PD-L1, антагонист PD-L2, антагонист CTLA4, антагонист VISTA, антагонист TIM3, антагонист LAG3, антагонист IDO, антагонист KIR2D, антагонист A2AR, антагонист B7-H3, антагонист B7-H4, антагонист BTLA, и предпочтительным является антагонист оси PD-1, антагонист CTLA4 или их комбинация.

[62] Антагонисты оси PD-1

[63] Антагонисты оси PD1 включают антагонист PD1 (например, антитело анти-PD-1), антагонист PD-L1 (например, антитело анти-PD-L1) и антагонист PD-L2 (например, антитело анти-PD-L2).

[64] В настоящем описании термины «запрограммированная гибель 1», «запрограммированная гибель клеток 1», «белок PD-1», «PD-1», «PD1», «PDCD1», «hPD-1» и «hPD-I» являются взаимозаменяемыми и включают варианты, изоформы, видовые гомологи PD-1 человека и аналоги, содержащие по меньшей мере один общий с PD-1 человека эпитоп. Полную последовательность PD-1 человека можно найти под номером доступа GenBank U64863. В соответствии с конкретными аспектами антагонист PD-1 связывает белок PD-1 последовательности SEQ ID NO:5 (uniprot ID Q15116).

[65] В настоящем описании термины «лиганд 1 запрограммированной гибели клеток 1», «PD-L1», «PDL1», «PDCD1L1», «PDCD1LG1», «CD274», «B7-гомолог 1», «B7-H1», «B7-H» и «B7H1» являются взаимозаменяемыми и включают варианты, изоформы, видовые гомологи PDL-1 человека и аналоги, содержащие по меньшей мере один общий с PDL-1 человека эпитоп.

[66] Белок запрограммированной гибели клеток 1 (PD-1) является ингибирующим членом CD28-семейства рецепторов, которое также включает CD28, CTLA-4, ICOS и BTLA.

[67] Были идентифицированы два лиганда для PD-1, PD-L1 и PD-L2, которые, как было показано, понижающе регулируют активацию Т-клеток после связывания с PD-1 (Freeman et al. (2000) J Exp. Med. 192: 1027-34; Latchman et al. (2001) Nat Immunol. 2:261-8; Carter et al. (2002) Eur. J Immunol 32:634-43). Как PD-L1, так и PD-L2 являются гомологами B7, которые связываются с PD-1, но не связываются с другими членами семейства CD28. PD-L1 в изобилии присутствует в различных раковых опухолях человека (Dong et al. (2002) Nat. Med. 8:787-9). Взаимодействие между PD-1 и PD-L1 приводит к уменьшению количества лимфоцитов, инфильтрирующих опухоль, снижению пролиферации Т-клеток, опосредуемой рецепторами, и ускользанию раковых клеток от иммунологического надзора. (Dong et al. (2003) J. Mol. Med. 81:281-7; Blank et al. (2005) Cancer Immunol. Immunother. 54:307- 314; Kenosha et al. (2004) Clin. Cancer Res. 10:5094-100). Иммуносупрессия может быть «отменена» путем ингибирования локального взаимодействия PD-1 с PD-L1, и данный эффект является аддитивным, когда также блокируется взаимодействие PD-1 с PD-L2 (Iwai et al. (2002) Proc. Nat'l. Acad. Sci. USA 99:12293-7; Brown et al. (2003) J. Immunol. 170: 1257-66).

[68] Способы согласно настоящему изобретению включают применение антагониста PD-1 (например, антитела) в комбинации с селективным ингибитором дипептидилпептидазы для лечения опухоли или рака. Соответственно, антагонисты PD-1 согласно настоящему изобретению связываются с лигандами PD-1 и нарушают, уменьшают или ингибируют связывание одного или более лигандов с рецептором PD-1 или связываются непосредственно с рецептором PD-1 без вовлечения в передачу сигнала через рецептор PD-1. В одном из вариантов реализации антагонист PD-1 непосредственно связывается с PD-1 и блокирует передачу ингибирующего сигнала PD-1. В другом варианте реализации антагонист PD-1 связывается с одним или более лигандами PD-1 (например, PD-L1 и PD-L2) и уменьшает или ингибирует запуск лигандом (лигандами) передачи ингибирующего сигнала через PD-1. В одном из вариантов реализации антагонист PD-1 связывается непосредственно с PD-L1, ингибируя или предотвращая связывание PD-L1 с PD-1, тем самым блокируя передачу ингибирующего сигнала PD-1.

[69] Антагонисты PD-1, применяемые в способах и композициях согласно настоящему изобретению, включают PD-1-связывающие каркасные белки и включают, но не ограничиваются ими, лиганды PD-1, антитела и многовалентные агенты. В конкретном варианте реализации антагонист представляет собой гибридный белок, такой как AMP-224. В другом варианте реализации антагонист представляет собой антитело анти-PD-1 («антитело PD-1»). Антитела к PD-1 человека (или VH- и/или VL-домены, полученные из них), подходящие для применения согласно настоящему изобретению, могут быть получены с использованием способов, хорошо известных в данной области техники.

[70] В некоторых вариантах реализации антитела, «мешающие» PD-1, представляют собой антитело анти-PD-1 или антагонист PD-1 (например, антитело человека, гуманизированное антитело или химерное антитело). В некоторых вариантах реализации антитело анти-PD-1 выбрано из группы, состоящей из MDX-1106 (также известного как Ниволумаб, MDX-1106-04, ONO-4538, BMS-936558 и Опдиво®), Merck 3475 (также известного как Пембролизумаб, MK-3475, Ламбролизумаб, Кейтруда® и SCH-900475) и CT-011 (также известного как Пидилизумаб, hBAT и hBAT-1). В некоторых вариантах реализации PD-1-связывающий антагонист представляет собой AMP-224 (также известный как B7-DCIg). В некоторых вариантах реализации антитело анти-PD-L1 выбрано из группы, состоящей из YW243.55.S70, MPDL3280A, MDX-1105 и MEDI4736. MDX-1105, также известный как BMS-936559, представляет собой антитело анти-PD-L1, описанное в WO2007/005874. Антитело YW243.55. S70 представляет собой анти-PD-L1, описанное в WO 2010/077634 A1. MEDI4736 представляет собой антитело анти-PD-L1, описанное в WO2011/066389 и US2013/034559. MDX-1106, также известный как MDX-1106-04, ONO-4538 или BMS-936558, представляет собой антитело анти-PD-1, описанное в US 8008449 и WO2006/121168. Merck 3745, также известный как MK-3475 или SCH-900475, представляет собой антитело анти-PD-1, описанное в US 8345509 и WO2009/114335. CT-011 (Пидизилумаб), также известный как hBAT или hBAT-1, представляет собой антитело анти-PD-1, описанное в WO2009/101611. AMP-224, также известный как B7-DCIg, представляет собой гибридный растворимый рецептор PD-L2-Fc, описанный в WO02010/027827 и WO2011/066342. Атезолимумаб представляет собой антитело анти-PD-L1, описанное в US 8217149. Авелумаб представляет собой антитело анти-PD-L1, описанное в US 20140341917. CA-170 представляет собой антагонист PD-1, описанный в WO2015033301 и WO2015033299. Другие антитела анти-PD1 описаны в US 8609089, US 2010028330 и/или US 20120114649.

[71] В некоторых вариантах реализации антитело анти-PD-1 представляет собой MDX-1106. Альтернативные названия для «MDX-1106» включают MDX-1106-04, ONO-4538, BMS-936558 или ниволумаб. В некоторых вариантах реализации антитело анти-PD-1 представляет собой ниволумаб (регистрационный номер CAS: 946414-94-4).

[72] В некоторых вариантах реализации антитело анти-PD-L2 представляет собой AMP-224 или rHIgM12B7.

[73] В одном из вариантов реализации ингибитор PD-1 представляет собой антитело анти-PD-1, выбранное из ниволумаба, пембролизумаба или пидилизумаба.

[74] Примеры антител анти-PD-L1, подходящих для способов согласно настоящему изобретению, и способы их получения описаны в заявке РСТ на патент WO 2010/077634 A1, содержание которой включено в настоящее описание посредством ссылки.

[75] Антитела анти-PD-L1 или антагонист PD-L1, подходящие согласно настоящему изобретению, включая композиции, содержащие такие антитела, такие как те, которые описаны в WO 2010/077634 A1 и патенте США № 8217149, можно применять в комбинации с селективным ингибитором дипептидилпептидазы для лечения рака.

[76] Антитело или его антигенсвязывающий фрагмент могут быть получены с применением способов, известных в данной области техники, например, способом, включающим культивирование клетки-хозяина, содержащей нуклеиновую кислоту, кодирующую любое из ранее описанных антител анти-PD-L1, анти-PD-1 или анти-PD-L2, или антигенсвязывающий фрагмент, в форме, подходящей для экспрессии, в условиях, подходящих для получения такого антитела или фрагмента, и выделение указанного антитела или фрагмента.

[77] Что касается антител анти-PD-1 или антагониста PD-1, они известны и включают ниволумаб и ламбролизумаб, AMP-224, MDPL3280A, MEDI4736 и MSB0010718C. Антитело анти-PD-1 может быть приобретено у BPS Biosciences и Bio X cell.

[78] В одном из вариантов реализации антагонист PD-1 выбран из группы, состоящей из ANA011, AUNP-12, BGB-A317, KD033, пембролизумаба, MCLA-134, mDX400, MEDI0680, muDX400, ниволумаба, PDR001, PF-06801591, пидилизумаба, REGN-2810, SHR-1210, STI-A1110, TSR-042, ANB011, 244C8, 388D4, TSR042 и XCE853, и предпочтительным является пембролизумаб, ниволумаб или пидилизумаб.

[79] В одном из вариантов реализации антагонист PD-L1 выбран из группы, состоящей из авелумаба, BMS-936559, CA-170, дурвалумаба, MCLA-145, SP142, STI-A1011, STIA1012, STI-A1010, STI-A1014, A110, KY1003 и атезолимумаба, и предпочтительным является авелумаб, дурвалумаб или атезолимумаб.

[80] В одном из вариантов реализации антагонист PD-L2 выбран из группы, состоящей из AMP-224 или rHIgM12B7.

Антагонисты CTLA4

[81] Подходящий антагонист анти-CTLA4 для применения в способах согласно настоящему изобретению включает, без ограничения, антитела анти-CTLA4, антитела анти-CTLA4 человека, антитела анти-CTLA4 мышей, антитела анти-CTLA4 млекопитающих, гуманизированные антитела анти-CTLA4, моноклональные антитела анти-CTLA4, поликлональные антитела анти-CTLA4, химерные антитела анти-CTLA4, MDX-010 (Ипилимумаб), тремелимумаб, антитела анти-CD28, аднектины анти-CTLA4, доменные антитела анти-CTLA4, одноцепочечные фрагменты анти-CTLA4, фрагменты тяжелой цепи анти-CTLA4, фрагменты легкой цепи анти-CTLA4, ингибиторы CTLA4, которые оказывают агонистическое действие в отношении костимулирующего пути, антитела, описанные в публикации PCT № WO 2001/014424, антитела, описанные в публикации PCT № WO 2004/035607, антитела, описанные в публикации США 2005/0201994, и антитела, описанные в выданном Европейском патенте № ЕР 1212422 В. Другие антитела к CTLA-4 описаны в патенте США №№ 5811097; 5855887; 6051227 и 6984720; в публикации PCT №№ WO 01/14424 и WO 00/37504; и в публикации США №№ 2002/0039581 и 2002/086014. Другие антитела анти-CTLA-4, которые можно применять в способе согласно настоящему изобретению, включают, например, те, которые описаны в WO 98/42752; патенте США №№ 6682736 и 6207156; Hurwitz et al., Proc. Natl. Acad. Sci. USA, 95(17): 10067- 10071 (1998); Camacho et al., J. Clin: Oncology, 22(145): Abstract No. 2505 (2004) (антитело CP-675206); Mokyr et al., Cancer Res., 58:5301-5304 (1998) и патенте США №№ 5977318, 6682736, 7109003 и 7132281.

[82] Предпочтительное клиническое антитело к CTLA-4 представляет собой моноклональное антитело человека (также называемое MDX-010 и ипилимумабом с CAS № 477202-00-9 и доступное у Medarex, Inc., Блумсбери, Нью-Джерси) и описано в WO 01/14424.

[83] Что касается антагонистов (антител) CTLA-4, они известны и включают Тремелимумаб (CP-675,206) и Ипилимумаб.

[84] Антагонист CTLA4 выбран из группы, состоящей из KAHR-102, AGEN1884, ABR002, KN044, тремелимумаба или ипилимумаба, и предпочтительным является тремелимумаб или ипилимумаб.

II. Способ применения

[85] Настоящее изобретение основано отчасти на неожиданно обнаруженном факте, что одновременное введение селективного ингибитора дипептидилпептидазы, такого как талабостат, и ингибитора иммунной контрольной точки, такого как антагонист PD-1, антагонист PDL1, антагонист CTLA4, обуславливало значительно более высокую противоопухолевую эффективность по сравнению с любым отдельно. Это обнаружение было неожиданным, поскольку данная комбинация оказывает общее усиленное противораковое действие, такое как улучшение Т-клеточного примирования, увеличение стимуляции Т-клеток, увеличение инфильтрации нейтрофилов и макрофагов в микроокружении опухоли, уменьшение объема опухоли, увеличение активации природных клеток-киллеров, усиление активации дендритных клеток, синергетическое увеличение провоспалительных цитокинов (IL2, IL6, IL12p40, IL 15, IL 7, G-CSF и GM-CSF), усиление вторичного противоопухолевого иммунного ответа и снижение токсичности.

[86] В одном из вариантов реализации настоящего изобретения предложен новый комбинированный подход, включающий:

(i) эффективное количество селективного ингибитора дипептидилпептидазы и

(ii) эффективное количество ингибитора иммунной контрольной точки.

[87] В одном из вариантов реализации настоящего изобретения предложено применение ингибитора активности белка активации фибробластов (FAP) или дипептидилпептидазы 8/9 (DPP8/9), а также фармацевтических композиций в комбинации с ингибитором иммунной контрольной точки для предотвращения и/или лечения опухоли или рака.

[88] В одном из вариантов реализации настоящего изобретения предложен способ лечения, замедления прогрессирования или предотвращения, или замедления рецидива опухоли, роста опухоли или распространения опухоли у субъекта с опухолью, включающий введение указанному субъекту эффективного количества селективного ингибитора дипептидилпептидазы (например, талабостата) и ингибитора иммунной контрольной точки (например, антагониста, связывающего ось PD-1).

[89] В одном из вариантов реализации настоящего изобретения предложен способ лечения, замедления прогрессирования или предотвращения, или замедления рецидива опухоли, роста опухоли или распространения опухоли у субъекта с опухолью, включающий введение указанному субъекту эффективного количества селективного ингибитора дипептидилпептидазы (например, талабостата) и одного или более ингибиторов иммунных контрольных точек (например, комбинации антагониста, связывающего ось PD-1).

[90] В одном из вариантов реализации настоящего изобретения предложен способ усиления иммунной функции у субъекта, страдающего раком, включающий введение указанному субъекту эффективного количества селективного ингибитора дипептидилпептидазы (например, талабостата) и ингибитора иммунной контрольной точки (например, антагониста, связывающего ось PD-1).

[91] В другом варианте реализации настоящего изобретения предложен способ инициирования, поддержания или усиления противоопухолевого иммунного ответа, при этом указанный способ включает введение субъекту:

(i) эффективного количества селективного ингибитора дипептидилпептидазы и

(ii) эффективного количества ингибитора иммунной контрольной точки.

[92] В другом варианте реализации настоящего изобретения предложен способ инициирования, поддержания или усиления противоопухолевого иммунного ответа, при этом указанный способ включает введение субъекту (а) талабостата и (b) антагониста, связывающего ось PD-1.

[93] Более того, введение (а) селективного ингибитора дипептидилпептидазы и (b) ингибитора иммунной контрольной точки, описанного в настоящем документе, может уменьшать эффективное количество ингибитора контрольной точки, вводимое субъекту или пациенту. Более того, указанное уменьшенное количество ингибитора контрольной точки может снижать токсичность ингибитора контрольной точки и повышать переносимость субъектом ингибитора контрольной точки.

[94] Раковые опухоли, описанные ниже, можно лечить селективным ингибитором дипептидилпептидазы и антагонистом, связывающим ось PD-1, включая лечение рака, экспрессирующего FAP. В некоторых вариантах реализации индивидуум, получающий лечение, страдает FAP-экспрессирующим раком.

[95] В некоторых вариантах реализации субъект страдает раком или подвержен риску развития рака. В некоторых вариантах реализации лечение приводит к устойчивому ответу у индивидуума после прекращения лечения. В некоторых вариантах реализации индивидуум страдает раком, который может быть на ранней стадии или поздней стадии. В некоторых вариантах реализации рак является метастатическим. В некоторых вариантах реализации индивидуум представляет собой человека.

[96] В одном из вариантов реализации настоящего изобретения предложена фармацевтическая композиция, содержащая:

(i) эффективное количество селективного ингибитора дипептидилпептидазы;

(ii) эффективное количество ингибитора иммунной контрольной точки; и

(iii) фармацевтически приемлемое вспомогательное вещество (вещества) или носитель (носители),

при этом введение указанной композиции субъекту с опухолью обеспечивает лечение, предотвращение или замедление роста или метастазирования опухоли у указанного субъекта.

[97] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая один или более селективных ингибиторов дипептидилпептидазы в комбинации с одним или более ингибиторами иммунных контрольных точек наряду с возможным противоопухолевым агентом (агентами) и одним или более фармацевтически приемлемыми носителями и/или адъювантами.

[98] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая:

(i) эффективное количество селективного ингибитора (ингибиторов) дипептидилпептидазы;

(ii) эффективное количество антагониста (антагонистов) оси PD-1;

(iii) один или более фармацевтически приемлемых носителей или адъювантов,

при этом введение указанной композиции субъекту с опухолью обеспечивает лечение, предотвращение или замедление роста или метастазирования опухоли у указанного субъекта.

[99] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая селективный ингибитор дипептидилпептидазы в комбинации с антагонистом PD-1 наряду с возможным противоопухолевым агентом (агентами) и одним или более фармацевтически приемлемыми носителями или адъювантами.

[100] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая селективный ингибитор дипептидилпептидазы в комбинации с антагонистом PD-L1 наряду с возможным противоопухолевым агентом (агентами) и одним или более фармацевтически приемлемыми носителями или адъювантами.

[101] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая селективный ингибитор дипептидилпептидазы в комбинации с антагонистом PD-L2 наряду с возможным противоопухолевым агентом (агентами) и одним или более фармацевтически приемлемыми носителями или адъювантами.

[102] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая:

(i) эффективное количество селективного ингибитора (ингибиторов) дипептидилпептидазы;

(ii) эффективное количество антагониста (антагонистов) CTLA4 и

(iii) один или более фармацевтически приемлемых носителей или адъювантов,

при этом введение указанной композиции субъекту с опухолью обеспечивает лечение, предотвращение или замедление роста или метастазирования опухоли у указанного субъекта.

[103] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая:

(i) эффективное количество селективного ингибитора (ингибиторов) дипептидилпептидазы;

(ii) эффективное количество антагониста (антагонистов) оси PD-1;

(iii) эффективное количество антагониста (антагонистов) CTLA4 и

(iv) один или более фармацевтически приемлемых носителей или адъювантов,

при этом введение указанной композиции субъекту с опухолью обеспечивает лечение, предотвращение или замедление роста или метастазирования опухоли у указанного субъекта.

[104] В другом варианте реализации настоящего изобретения предложена фармацевтическая композиция, содержащая селективный ингибитор дипептидилпептидазы в комбинации с антагонистом CTLA4 наряду с возможным противоопухолевым агентом (агентами) и одним или более фармацевтически приемлемыми носителями или адъювантами.

[105] Противоопухолевый агент может быть выбран из группы, состоящей из антитела или малой молекулы. Примеры противоопухолевых агентов включают, но не ограничиваются ими: циклофосфамид в низкой дозе, трастузумаб, бевацизумаб, цетуксимаб, панитумумаб, сунитиниб, сорафениб, гефитиниб, эрлотиниб, темсиролимус, адотрастузумаб, эмтанзин, кризотиниб, пертузумаб, рамуцирумаб, регорафениб, вемурафениб, абиратерона ацетат, зив-афлиберцепт и т.п. В качестве альтернативы или в комбинации с вышеуказанными комбинациями способы и композиции, описанные в настоящем документе, можно вводить в комбинации с одной или более вакцинами, например, терапевтической противораковой вакциной; или другими формами клеточной иммунотерапии.

[106] В другом варианте реализации настоящего изобретения предложен способ усиления, повышения, стимуляции, модуляции желаемого иммунного ответа у субъекта, включающий введение субъекту первой композиции, содержащей эффективное количество селективного ингибитора дипептидилпептидазы, и второй композиции, содержащей эффективное количество ингибитора иммунной контрольной точки, при этом у указанного субъекта диагностирована опухоль или рак, связанный с повышенными уровнями FAP или DPP 8/9 и/или молекулы (молекул) иммунной контрольной точки.

[107] В другом варианте реализации настоящего изобретения предложено применение селективного ингибитора дипептидилпептидазы (например, талабостата) для получения первой фармацевтической композиции для лечения, предотвращения или замедления прогрессирования опухоли у субъекта, при этом указанная первая фармацевтическая композиция содержит селективный ингибитор дипептидилпептидазы (например, талабостат) и один или более фармацевтически приемлемых носителей, и при этом лечение включает введение первой фармацевтической композиции в комбинации со второй фармацевтической композицией, содержащей ингибитор иммунной контрольной точки и один или более фармацевтически приемлемых носителей.

[108] В другом варианте реализации настоящего изобретения предложена первая фармацевтическая композиция, содержащая селективный ингибитор дипептидилпептидазы (например, талабостат) и один или более фармацевтически приемлемых носителей, для применения для лечения или замедления прогрессирования опухоли у субъекта, при этом лечение включает введение указанной первой фармацевтической композиции в комбинации со второй композицией, при этом указанная вторая композиция содержит ингибитор иммунной контрольной точки и один или более фармацевтически приемлемых носителей.

[109] В другом варианте реализации настоящего изобретения предложена вторая фармацевтическая композиция, содержащая ингибитор иммунной контрольной точки и один или более фармацевтически приемлемых носителей, для применения для лечения или замедления прогрессирования опухоли у субъекта, при этом лечение включает введение указанной второй фармацевтической композиции в комбинации с первой композицией, при этом указанная первая композиция содержит селективный ингибитор дипептидилпептидазы (например, талабостат) и один или более фармацевтически приемлемых носителей.

[110] В другом варианте реализации настоящего изобретения предложено применение селективного ингибитора дипептидилпептидазы (например, талабостата) для получения первой фармацевтической композиции для усиления иммунной функции у субъекта, страдающего раком или опухолью, при этом указанная первая фармацевтическая композиция содержит селективный ингибитор дипептидилпептидазы (например, талабостат) и один или более фармацевтически приемлемых носителей, и при этом лечение включает введение фармацевтической композиции в комбинации со второй композицией, содержащей ингибитор иммунной контрольной точки и один или более фармацевтически приемлемых носителей.

[111] В другом варианте реализации настоящего изобретения предложено применение ингибитора иммунной контрольной точки для получения второй фармацевтической композиции для усиления иммунной функции у субъекта, страдающего раком, при этом указанная вторая фармацевтическая композиция содержит ингибитор иммунной контрольной точки и один или более фармацевтически приемлемых носителей, и при этом лечение включает введение второй фармацевтической композиции в комбинации с первой композицией, содержащей селективный ингибитор дипептидилпептидазы (например, талабостат) и один или более фармацевтически приемлемых носителей.

[112] В другом варианте реализации настоящего изобретения предложен способ снижения токсичности селективного ингибитора DPP или обеспечения достижения терапевтических эффектов при более низкой дозе селективного ингибитора DPP, при этом указанный способ включает введение субъекту селективного ингибитора DPP и ингибитора контрольной точки, описанного в настоящем документе.

[113] В дополнительном варианте реализации настоящего изобретения предложен способ индуцирования иммунного ответа перед введением ингибитора контрольной точки, при этом указанный способ включает инициирование или обеспечение противоопухолевого иммунного ответа, или усиление предсуществующего противоопухолевого иммунного ответа с применением селективного ингибитора DPP с последующим введением одного или более ингибиторов контрольных точек, описанных в настоящем документе.

[114] В другом варианте реализации настоящего изобретения предложено основание для комбинирования селективного ингибитора дипептидилпептидазы и CAR-T- или CAR-NK-клеток. Авторы настоящего изобретения обнаружили, что селективный ингибитор дипептидилпептидазы включает многофункциональный механизм действия, отражающий способность усиливать активность CART при необходимости. Селективный ингибитор дипептидилпептидазы и антагонист PD-1 демонстрируют синергию в высвобождении IL-15 и IL-7; данные цитокины связаны с метаболическими путями, необходимыми для генерации Т-клеток памяти, и таким образом продлевают противоопухолевый иммунный ответ CART.

[115] В частности, согласно настоящему изобретению предложена комбинация, содержащая:

(i) талабостат

(ii) ингибитор иммунной контрольной точки

(iii) искусственно сконструированные CAR-T- или CAR-NK-клетки.

[116] Другой вариант реализации настоящего изобретения относится к способам лечения рака талабостатом, селективно ингибирующим активность дипептидилпептидазы (например, FAP или DPP 8/9), в комбинации с иммуномодулирующим подходом с применением искусственно сконструированных Т-клеток или NK-клеток, направленно воздействующих на один или более опухолевых антигенов, включая, но не ограничиваясь данным перечнем, CTLA4, PD-1, PD-L1, PD-L2, TIM3, LAG3, VISTA, KIR2D, IDO, A2AR, OX 40.

III. Раковые опухоли/опухоли:

[117] Любой из предложенных способов можно применять для лечения рака, представляющего собой опухоль, такую как опухоль, которая представляет собой солидную опухоль. В некоторых примерах указанная опухоль характеризуется экспрессией дипептидилпептидазы от умеренной до высокой, в частности, экспрессией FAP или экспрессией DPP 8/9. Типичные раковые опухоли, которые можно лечить предложенными способами, включают, но не ограничиваются ими, рак поджелудочной железы, рак толстой и прямой кишки, рак яичников, рак легкого, рак молочной железы, глиобластому, рак желудка, астроглиальные, нейроэктодермальные опухоли, рак головы и шеи, трижды отрицательный рак молочной железы, гастроэзофагеальный рак, немелкоклеточный рак легкого.

[118] Настоящее изобретение также подходит для лечения метастатических раковых опухолей, особенно метастатических раковых опухолей, которые экспрессируют PD-L1 или CTLA4.

[119] В некоторых вариантах реализации настоящего изобретения предложен способ лечения рака у субъекта, включающий введение указанному субъекту терапевтически эффективного количества селективного ингибитора дипептидилпептидазы (например, ингибитора FAP или ингибитора DPP 8/9) и терапевтически эффективного количества ингибитора иммунной контрольной точки.

[120] Предпочтительные раковые опухоли, рост которых можно ингибировать с применением комбинированной терапии селективным ингибитором дипептидилпептидазы, например, талабостатом, и антагонистом PD-1, включают раковые опухоли, как правило, отвечающие на иммунотерапию. Неограничивающие примеры предпочтительных раковых опухолей для лечения включают злокачественную меланому, немелкоклеточный рак легкого, рак почки, болезнь Ходжкина, рак желудка, глиобластому; рак головы и шеи, печеночно-клеточную карциному, множественную миелому, рак пищевода, мелкоклеточный рак легкого, урогенитальный рак, острый миелоидный лейкоз, рак молочной железы, хронический лимфоцитарный лейкоз, диффузную В-крупноклеточную лимфому, фолликулярную лимфому; миелодиспластические синдромы; рак яичников; увеальную меланому, рак толстой и прямой кишки, гематологические злокачественные опухоли, неходжкинскую лимфому, хронический миелоидный лейкоз и глиому. Более того, настоящее изобретение включает рефрактерные или рецидивирующие злокачественные опухоли, рост которых можно ингибировать с применением антител согласно настоящему изобретению.

[121] Предпочтительные раковые опухоли, рост которых можно ингибировать с применением комбинированной терапии селективным ингибитором дипептидилпептидазы, например, талабостатом, и антагонистом CTLA4, включают раковые опухоли, как правило, отвечающие на иммунотерапию. Неограничивающие примеры предпочтительных раковых опухолей для лечения включают меланому (например, метастатическую злокачественную меланому), рак почки (например, светлоклеточную карциному), рак предстательной железы (например, гормонорефрактерную аденокарциному предстательной железы), рак молочной железы, глиобластому, рак толстой кишки и рак легкого (например, немелкоклеточный рак легкого, мелкоклеточный рак легкого), рак желудка, миелодиспластические синдромы; рак пищевода; рак яичников; урогенитальный рак; увеальную меланому, рак надпочечников; рак печени. Более того, настоящее изобретение включает рефрактерные или рецидивирующие злокачественные опухоли, рост которых можно ингибировать с применением антител согласно настоящему изобретению.

[122] В некоторых вариантах способов, применения, композиций и наборов, описанных в настоящем документе, рак представляет собой солидную опухоль. В некоторых вариантах реализации рак представляет собой урогенитальные раковые опухоли (такие как рак предстательной железы, почечно-клеточный рак, рак мочевого пузыря), рак щитовидной железы, рак яичка, рак вульвы, опухоль Вильмса, гормоночувствительный или гормонорефрактерный рак предстательной железы, гинекологические раковые опухоли (такие как рак яичников, рак шейки матки, рак эндометрия, рак матки), рак легкого, немелкоклеточный рак легкого, мелкоклеточный рак легкого, стромальные раковые опухоли желудочно-кишечного тракта, раковые опухоли желудочно-кишечного тракта (такие как неметастатический или метастатический рак толстой и прямой кишки, рак поджелудочной железы, рак желудка, рак пищевода, печеночно-клеточный рак, холангиоцеллюлярный рак), злокачественную глиобластому, злокачественную мезотелиому, неметастатический или метастатический рак молочной железы (такой как гормонорефрактерный метастатический рак молочной железы, трижды отрицательный рак молочной железы), злокачественную меланому, меланому, метастатическую меланому, карциному из клеток Меркеля или саркомы костных и мягких тканей, плоскоклеточную карциному полости рта, глиобластому, рак головного мозга, остеосаркому, нейробластому, запущенную метастатическую, воспалительную миофибробластическую опухоль (ВМО), холангиокарциному, цистаденокарциному, амелобластому, хондросаркому, дерматофибросаркому, ганглиоглиому, лейомиосаркому, медуллобластому, остеобластому и неоперабельное невоспалительное местнораспространенное заболевание и т.п. Наиболее предпочтительный рак представляет собой солидную опухоль (например, рак поджелудочной железы, рак толстой и прямой кишки, рак яичников, рак легкого, рак молочной железы, глиобластому, рак желудка, астроглиальные, нейроэктодермальные опухоли, рак головы и шеи, трижды отрицательный рак молочной железы, гастроэзофагеальный рак, немелкоклеточный рак легкого и т.п.) или рак гематопоэтической системы (лейкоз, лимфому, лимфоцитарный лейкоз, неходжкинскую лимфому, лимфому Ходжкина, анапластическую крупноклеточную лимфому, миелоидный лейкоз, множественную миелому, острый лимфобластный лейкоз, хронический миелоидный лейкоз, острый миелоидный лейкоз).

[123] В некоторых вариантах реализации раковые опухоли, рост которых можно ингибировать с применением комбинированной терапии селективным ингибитором (ингибиторами) дипептидилпептидазы и ингибитором (ингибиторами) иммунной контрольной точки, представляют собой вирус-ассоциированные раковые опухоли. Типичные вирус-ассоциированные раковые опухоли включают, но не ограничиваются ими, раковые опухоли, ассоциированные с вирусом Эпштейна-Барр (ВЭБ), вирусом гепатита В (ВГВ), вирусом гепатита С (ВГС), вирусами папилломы человека (ВПЧ), Т-лимфотропным вирусом человека 1 типа (HTLV-1), Т-лимфотропным вирусом человека 2 типа (HTLV-2) и вирусом герпеса человека, таким как вирус герпеса человека 8 (ВГЧ-8). Раковые опухоли, ассоциированные с конкретными вирусами, известны специалисту в данной области техники. Например, примеры ВЭБ-ассоциированных раковых опухолей включают, но не ограничиваются ими, лимфомы, рак носоглотки, карциному желудка, карциному околоушной железы, карциному молочной железы и лейомиосаркому. Примеры раковых опухолей, ассоциированных с вирусом гепатита В (ВГВ) и вирусом гепатита С (ВГС), включают, но не ограничиваются ими, раковые опухоли печени. Примеры раковых опухолей, ассоциированных с вирусами папилломы человека (ВПЧ), включают, но не ограничиваются ими, орофарингеальный рак головы и шеи, носоглоточный рак головы и шеи, и рак шейки матки, вульвы, влагалища, пениса и заднего прохода. Примеры раковых опухолей, ассоциированных с Т-лимфотропным вирусом человека 1 типа (HTLV-1) и 2 типа (HTLV-2), включают, но не ограничиваются ими, Т-клеточный лейкоз взрослых и волосатоклеточный лейкоз соответственно. Примеры раковых опухолей, ассоциированных с вирусом герпеса человека 8 (ВГЧ-8), включают, но не ограничиваются ими, саркому Капоши. В некоторых вариантах реализации вирус-ассоциированный рак представляет собой рак, ассоциированный с ВПЧ. В других вариантах реализации вирус-ассоциированный рак представляет собой рак, ассоциированный с ВГС.

[124] В одном из вариантов реализации настоящего изобретения предложены способы и композиции для индуцирования или усиления иммунного ответа у хозяина для лечения рака. Поскольку данные способы действуют путем усиления иммунного ответа путем блокирования ингибирующих рецепторов на Т-клетках и NK-клетках, они применимы к очень широкому спектру раковых опухолей.

[125] В некоторых вариантах способов, применения, композиций и наборов, описанных в настоящем документе, субъект представляет собой человека. В некоторых вариантах реализации субъект страдает раком или у него был диагностирован рак. В некоторых вариантах реализации субъект страдает рецидивирующим или рефрактерным раком (таким как солидная опухоль). В некоторых вариантах реализации субъект страдает солидной опухолью (такой как рак поджелудочной железы, рак толстой и прямой кишки, рак яичников, рак легкого, рак молочной железы, глиобластома, рак желудка, астроглиальные, нейроэктодермальные опухоли, рак головы и шеи, трижды отрицательный рак молочной железы, гастроэзофагеальный рак, немелкоклеточный рак легкого и т.п.).

[126] В некоторых вариантах реализации субъект страдает раком или у него был диагностирован рак. В некоторых вариантах реализации субъект страдает редким неиммуногенным раком, включая, но не ограничиваясь ими, медуллоэпителиому, альвеолярную саркому мягких тканей, мезотелиому плевры, ретинобластому, рабдомиосаркому, плоскоклеточную карциному головы и шеи, карциному тимуса, тимому, недифференцированную плеоморфную саркому, карциному влагалища.

[127] Способы согласно настоящему изобретению могут найти применение в лечении состояний, в которых для лечения рака повышенная иммуногенность является желательной, например, возрастающая иммуногенность опухоли. Можно лечить различные раковые опухоли или можно замедлять их прогрессирование, включая, но не ограничиваясь ими, рак, который представляет собой солидную опухоль. В некоторых вариантах реализации рак представляет собой рефрактерный или метастатический рак. В некоторых вариантах реализации рак представляет собой лимфому или лейкоз. В некоторых вариантах реализации лейкоз представляет собой хронический лимфоцитарный лейкоз (ХЛЛ) или острый миелоидный лейкоз (ОМЛ). В некоторых вариантах реализации лимфома представляет собой фолликулярную лимфому (ФЛ), диффузную В-крупноклеточную лимфому (ДВКЛ) или неходжкинскую лимфому (НХЛ).

IV. Введение

[128] Подходящие протоколы введения/лечения для лечения рака или опухоли у субъекта включают, например, введение пациенту эффективного количества селективного ингибитора дипептидилпептидазы (например, талабостата) и ингибитора иммунной контрольной точки.

[129] В некоторых вариантах реализации комбинированная терапия согласно настоящему изобретению включает введение селективного ингибитора дипептидилпептидазы (например, талабостата) и ингибитора иммунной контрольной точки. Селективный ингибитор дипептидилпептидазы и ингибитор иммунной контрольной точки можно вводить любым подходящим способом, известным в данной области техники. Например, селективный ингибитор дипептидилпептидазы и ингибитор иммунной контрольной точки можно вводить последовательно (в разное время) или одновременно (в одно и то же время).

[130] В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят перед введением селективного ингибитора дипептидилпептидазы (например, талабостата). В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят одновременно с введением селективного ингибитора дипептидилпептидазы. В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят после введения селективного ингибитора дипептидилпептидазы.

[131] В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы или ингибитор иммунной контрольной точки вводят непрерывно. В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы или ингибитор иммунной контрольной точки вводят через интервал.

[132] В некоторых вариантах реализации ингибитор иммунной контрольной точки и селективный ингибитор дипептидилпептидазы вводят совместно, например, введение указанного ингибитора иммунной контрольной точки и селективного ингибитора дипептидилпептидазы (например, талабостата) в виде двух отдельных составов. Совместное введение может быть одновременным или последовательным в любом порядке. В одном из дополнительных вариантов реализации существует период времени, в течение которого оба (или все) терапевтических агента одновременно проявляют свою биологическую активность. Указанный ингибитор иммунной контрольной точки и селективный ингибитор дипептидилпептидазы (например, талабостат) совместно вводят либо одновременно, либо последовательно, например, перорально или внутривенно (в/в) путем непрерывной инфузии. Когда оба терапевтических агента совместно вводят последовательно, указанные терапевтические агенты вводят в двух отдельных введениях, которые разделены «конкретным периодом времени». Термин «конкретный период времени» означает в пределах от 1 часа до 30 дней. Например, один из агентов можно вводить в пределах примерно 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 дня или 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 часа от введения другого терапевтического агента, и в одном из вариантов реализации конкретный период времени составляет 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 день, или 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 час. В некоторых вариантах реализации «одновременное» введение означает в одно и то же время или в пределах короткого периода времени, обычно менее 1 часа.

[133] В настоящем описании термин «период введения доз» означает период времени, в течение которого каждый терапевтический агент вводили по меньшей мере один раз. Период введения доз, как правило, составляет примерно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 или 30 дней, и в одном из вариантов реализации - 6, 7, 8, 9, 10, 11, 12, 13, 14, 16 или 24 дня, например, 8 или 16, или 24 дня.

[134] В некоторых вариантах реализации нуждающемуся в лечении субъекту вводят несколько (например, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более) доз селективного ингибитора дипептидилпептидазы (например, талабостата) и несколько (например, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более) доз ингибитора иммунной контрольной точки.

[135] В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят в дозе, составляющей 0,01 мг/кг, 0,05 мг/кг, 0,1 мг/кг, 0,2 мг/кг, 0,3 мг/кг, 0,5 мг/кг, 0,7 мг/кг, 1 мг/кг, 2 мг/кг, 3 мг/кг, 4 мг/кг, 5 мг/кг, 6 мг/кг, 7 мг/кг, 8 мг/кг, 9 мг/кг, 10 мг/кг, 15 мг/кг, 20 мг/кг, 25 мг/кг или 30 мг/кг. Доза ингибитора иммунной контрольной точки может варьировать от примерно 0,01 мг/кг до 30 мг/кг, предпочтительно от 0,1 мг/кг до 20 мг/кг, более предпочтительно от 1 мг/кг до 10 мг/кг. В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят путем инъекции (например, подкожно или внутривенно) в дозе, составляющей от примерно 0,01 мг/кг до 30 мг/кг, например, от примерно 0,1 мг/кг до 20 мг/кг, от примерно 1 мг/кг до 10 мг/кг, от примерно 1 мг/кг до 5 мг/кг или от примерно 1 до 3 мг/кг.

[136] В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят одной дозой в сутки, одной дозой каждые 2 дня, одной дозой каждые 3 дня, одной дозой каждые 4 дня, одной дозой каждые 5 дней, один раз в неделю, один раз в две недели, один раз в три недели или один раз в четыре недели, предпочтительно один раз в неделю. В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят в виде однократной дозы, в двух дозах, в трех дозах, в четырех дозах, в пяти дозах или в 6 или более дозах. Режим дозирования может варьировать, например, от одного раза в неделю до одного раза в 2, 3 или 4 недели. В одном из вариантов реализации ингибитор иммунной контрольной точки вводят в дозе от примерно 1 мг/кг до 10 мг/кг один раз в неделю.

[137] В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы (например, талабостат) вводят в дозе, составляющей 0,001 мг/кг, 0,002 мг/кг, 0,003 мг/кг, 0,004 мг/кг, 0,005 мг/кг, 0,006 мг/кг, 0,007 мг/кг, 0,008 мг/кг, 0,009 мг/кг, 0,010 мг/кг, 0,012 мг/кг, 0,013 мг/кг, 0,014 мг/кг, 0,020 мг/кг, 0,025 мг/кг, 0,030 мг/кг и 0,035 мг/кг. В предпочтительных вариантах реализации каждую дозу селективного ингибитора дипептидилпептидазы вводят в величине 0,002 мг/кг, 0,003 мг/кг, 0,004 мг/кг, 0,005 мг/кг, 0,006 мг/кг, 0,007 мг/кг, 0,009 мг/кг, 0,01 мг/кг, 0,013 мг/кг и 0,014 мг/кг. В другом варианте реализации доза селективного ингибитора дипептидилпептидазы согласно настоящему изобретению, вводимого для предотвращения и/или лечения рака, связанного с повышенными уровнями FAP или DPP 8/9, у пациента, представляет собой единичную дозу, составляющую от примерно 0,001 мг/кг до примерно 10 мг/кг, от 0,001 мг/кг до примерно 1 мг/кг, от примерно 0,001 мг/кг до 0,05 мг/кг, от примерно 0,001 мг/кг до 0,035 мг/кг, от примерно 0,002 мг/кг до примерно 5 мг/кг, от примерно 0,002 мг/кг до примерно 3 мг/кг, от примерно 0,002 мг/кг до примерно 2 мг/кг, от примерно 0,002 мг/кг до примерно 0,05 мг/кг, от примерно 0,002 мг/кг до примерно 0,035 мг/кг, от примерно 0,003 мг/кг до примерно 2,0 мг/кг, от примерно 0,003 мг/кг до примерно 2,0 мг/кг, от примерно 0,004 мг/кг до примерно 2,5 мг/кг, от примерно 0,005 мг/кг до примерно 2,5 мг/кг, от примерно 0,006 мг/кг до примерно 2,5 мг/кг, от примерно 0,007 мг/кг до примерно 2,5 мг/кг, от примерно 0,008 мг/кг до примерно 2,5 мг/кг, от примерно 0,009 мг/кг до примерно 2,5 мг/кг, от примерно 0,010 мг/кг до примерно 1,5 мг/кг, от примерно 0,011 до примерно 1,5 мг/кг, от примерно 0,012 мг/кг до примерно 1 мг/кг, от примерно 0,013 мг/кг до примерно 1 мг/кг. Общая суточная доза селективного ингибитора дипептидилпептидазы может варьировать от примерно 100 мкг до 200 мг, предпочтительно от примерно 100 мкг до 50 мг, наиболее предпочтительно от примерно 100 мкг до 10 мг. Общая суточная доза талабостата может варьировать от примерно 50 мкг до 3 мг, предпочтительно от примерно 100 мкг до 2,5 мг, наиболее предпочтительно от примерно 100 мкг до 2,0 мг. Доза селективного ингибитора дипептидилпептидазы может варьировать от примерно 0,001 мг/кг до 10 мг/кг, предпочтительно от 0,001 мг/кг до 3 мг/кг, более предпочтительно от примерно 0,001 мг/кг до 2 мг/кг. Доза талабостата может варьировать от примерно 0,001 мг/кг до 1 мг/кг, предпочтительно от 0,001 мг/кг до 0,05 мг/кг, более предпочтительно от примерно 0,001 до 0,035 мг/кг.

[138] В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы вводят два раза в сутки, одной дозой в сутки, одной дозой каждые 2 дня, одной дозой каждые 3 дня, одной дозой каждые 4 дня, одной дозой каждые 5 дней, один раз в неделю, один раз в две недели или один раз в четыре недели, предпочтительно одной дозой в сутки. В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы вводят в виде однократной дозы, в двух дозах, в трех дозах, в четырех дозах, в пяти дозах или в 6 или более дозах. Режим дозирования может варьировать, например, от одного раза в сутки до одного раза в 2, 3 или 4 недели. В одном из вариантов реализации селективный ингибитор дипептидилпептидазы вводят в дозе от примерно 0,001 мг/кг до 3 мг/кг один раз в сутки. В некоторых вариантах реализации частота введения доз может варьировать от двух раз в сутки до одного раза в месяц.

[139] Подходящие протоколы лечения пациента-человека, страдающего раком, включают, например, введение указанному пациенту эффективного количества каждого из:

(i) талабостата

(ii) антагониста оси PD-1,

при этом указанный способ включает по меньшей мере один цикл введения, при этом указанный цикл представляет собой период, состоящий из 24 дней, причем для каждого из по меньшей мере одного цикла талабостат вводят непрерывно в течение семи дней в дозе от примерно 0,001 мг/кг до 0,035 мг/кг массы тела, и антагонист оси PD-1 вводят в дозе 0,1-20 мг/кг массы тела в каждый восьмой день, и после этого 24-дневного цикла рекомендован периода отдыха, составляющий 7 дней, а затем начинают следующий цикл введения до облегчения болезненного состояния или в соответствии с указаниями врача. Это включает введение антагониста оси PD-1 с регулярным интервалом (например, один раз в неделю) после введения доз селективного ингибитора дипептидилпептидазы (например, талабостата).

[140] В другом варианте реализации селективный ингибитор дипептидилпептидазы представлен в форме для перорального введения и/или антагонист оси PD-1 представлен в форме для внутривенного введения. В одном из вариантов реализации антагонист оси PD-1 вводят в 8, 16, 24 день каждого цикла. В другом варианте реализации селективный ингибитор дипептидилпептидазы вводят ежедневно. В предпочтительном варианте реализации цикл введения включает введение талабостата один раз в сутки в 1, 2, 3, 4, 5, 6, 7, 9, 10, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 22 и 23 день; и введение антагониста оси PD-1 один раз в сутки в 8, 16 и 24 день с последующим периодом отдыха, составляющим 1 неделю.

[141] В другом варианте реализации 21 дозу селективного ингибитора дипептидилпептидазы вводят в течение 24-дневного цикла. В другом варианте реализации 3 дозы антагониста оси PD-1 вводят в каждый восьмой день в течение 24-дневного цикла.

[142] В другом варианте реализации цикл введения составляет 24 дня и может быть повторен при необходимости. В другом варианте реализации лечение состоит из вплоть до 12 циклов.

[143] В некоторых вариантах реализации каждую дозу селективного ингибитора дипептидилпептидазы вводят в величине 0,001, 0,003, 0,005, 0,006, 0,007, 0,008, 0,009, 0,01, 0,012, 0,013, 0,020, 0,025, 0,030 мг/кг и 0,035 мг/кг массы тела. В предпочтительных вариантах реализации каждую дозу селективного ингибитора дипептидилпептидазы (например, ингибитора FAP или ингибитора DPP 8/9) вводят в величине примерно 0,003 мг/кг, примерно 0,004 мг/кг, примерно 0,005 мг/кг, примерно 0,006 мг/кг, примерно 0,007 мг/кг, примерно 0,009 мг/кг, примерно 0,01 мг/кг, примерно 0,013 мг/кг и примерно 0,014 мг/кг.

[144] В других вариантах реализации каждую дозу антагониста оси PD-1 вводят в величине 0,1, 0,3, 1, 3, 6, 10 или 20 мг/кг массы тела. В предпочтительных вариантах реализации каждую дозу антагониста оси PD-1 вводят в величине 0,3, 1, 3 или 10 мг/кг. В более предпочтительных вариантах реализации антагонист оси PD-1 вводят в дозе 2 мг/кг каждые три недели (Кейтруда®) или 3 мг/кг каждые две недели (Опдиво®), или 1200 мг каждые три недели (Тецентрик®).

[145] В одном из вариантов реализации талабостат и антагонист оси PD-1 или антагонист CTLA вводят в следующих дозах:

a) примерно 0,002 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

b) примерно 0,003 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

c) примерно 0,004 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

d) примерно 0,005 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

e) примерно 0,006 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

f) примерно 0,007 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

g) примерно 0,008 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

h) примерно 0,009 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

i) примерно 0,010 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

j) примерно 0,012 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4;

k) примерно 0,013 мг/кг талабостата и 2 мг/кг или 3 мг/кг, или 1200 мг антагониста оси PD-1 или 3 мг/кг антагониста CTLA4.

[146] В другом варианте реализации дозу селективного ингибитора дипептидилпептидазы и/или антагониста оси PD-1 варьируют со временем. Например, селективный ингибитор дипептидилпептидазы и/или антагонист оси PD-1 можно вначале вводить в высокой дозе и доза может быть снижена со временем. В другом варианте реализации селективный ингибитор дипептидилпептидазы и/или антагонист оси PD-1 вначале вводят в низкой дозе и дозу повышают со временем.

[147] В другом варианте реализации количество вводимого селективного ингибитора дипептидилпептидазы и/или антагониста оси PD-1 является постоянным для каждой дозы. В другом варианте реализации количество вводимого терапевтического агента варьируется с каждой дозой. Например, поддерживающая (или последующая) доза терапевтического агента может быть выше или такой же, как ударная доза, которую вводят первой. В другом варианте реализации поддерживающая доза терапевтического агента может быть ниже или такой же, как ударная доза.

[148] Ингибитор иммунной контрольной точки можно вводить с той же частотой, что и селективный ингибитор дипептидилпептидазы или с другой частотой, при этом каждому введению ингибитора иммунной контрольной точки предшествует введение селективного ингибитора дипептидилпептидазы не более чем за 48 часов. Например, ингибитор иммунной контрольной точки можно вводить два раза в неделю, один раз в неделю, один раз в 2 недели, один раз в 3 недели, один раз в 4 недели, один раз в 6 недель, один раз в 2 месяца, один раз в 3 месяца, один раз в 4 месяца, один раз в 5 месяцев или один раз в 6 месяцев; при этом каждому введению ингибитора иммунной контрольной точки предшествует введение селективного ингибитора дипептидилпептидазы не более чем за 10 дней, не более чем за 9 дней, не более чем за 8 дней, не более чем за 7 дней, не более чем за 6 дней, не более чем за 5 дней, не более чем за 4 дня, не более чем за 3 дня, не более чем за 2 дня, не более чем за 1 день.

[149] В других вариантах реализации селективный ингибитор дипептидилпептидазы и/или антагонист PD-1 вводят до тех пор, пока не наблюдают полезный клинический эффект или до достижения полного ответа, подтвержденного прогрессирования заболевания или неуправляемой токсичности.

[150] В другом варианте реализации антагонист PD-1 и селективный ингибитор дипептидилпептидазы вводят в качестве лечения первой линии (например, начального или первого лечения). В другом варианте реализации антагонист PD-1 и селективный ингибитор дипептидилпептидазы вводят в качестве лечения второй линии (например, после начального или первого лечения, в том числе после рецидива и/или когда первое лечение было неудачным).

[151] Другой аспект настоящего изобретения характеризует любой из вышеупомянутых вариантов реализации, в котором антагонист PD-1 заменяют на или комбинируют с антагонистом PD-L1 или антагонистом PD-L2, и антагонист оси PD-1 включает антагонист PD-1, антагонист PD-L1 и антагонист PD-L2.

[152] Подходящая доза селективного ингибитора дипептидилпептидазы (например, талабостата) и/или ингибитора иммунной контрольной точки может быть определена на основе типа заболевания, которое лечат, типа селективного ингибитора дипептидилпептидазы и ингибитора иммунной контрольной точки, тяжести и течения заболевания, клинического состояния субъекта, истории болезни субъекта и ответа на лечение, вовлеченных симптомов, массы тела, пола, иммунного статуса субъекта и решения лечащего врача. Подходящие режимы могут быть выбраны специалистом в данной области техники с учетом таких факторов и следуя, например, дозам, описанным в литературе и рекомендованным в Physician's Desk Reference (59th ed., 2005).

[153] Предпочтительно, дозы терапевтических агентов, применяемых в видах комбинированной терапии согласно настоящему изобретению, ниже доз, которые применяли или в настоящее время применяют для предотвращения и/или лечения опухоли, связанной с повышенными уровнями FAP или DPP 8/9, и/или молекулы иммунной контрольной точки.

[154] В некоторых вариантах реализации способ лечения рака будут осуществлять даже с низкой вероятностью успеха, но когда он с учетом истории болезни и предполагаемой выживаемости пациента, тем не менее, как полагают, индуцирует общий благоприятный курс действия.

[155] Соответственно, в одном из вариантов реализации дозу селективного ингибитора дипептидилпептидазы и ингибитора иммунной контрольной точки рассчитывают в виде мг/кг массы тела. Однако в другом варианте реализации доза селективного ингибитора дипептидилпептидазы и/или ингибитора иммунной контрольной точки представляет собой постоянную фиксированную дозу, которую фиксируют независимо от массы тела пациента.

[156] Селективный ингибитор дипептидилпептидазы (например, талабостат) и ингибитор иммунной контрольной точки можно вводить одним и тем же путем введения или разными путями введения. В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы вводят перорально, внутривенно, внутримышечно, подкожно, топически, ректально, трансдермально, интратрахеально, вагинально, интраперитонеально, интраорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально. Предпочтительным путем введения является пероральный. Селективный ингибитор дипептидилпептидазы можно вводить субъекту любым путем, который доставляет указанный ингибитор в пораженный участок либо напрямую, либо опосредованно. Доставка может быть местной (например, мукозальной) или системной. Селективный ингибитор дипептидилпептидазы вводят перорально и ингибитор иммунной контрольной точки вводят непероральным путем.

[157] В некоторых вариантах реализации ингибитор иммунной контрольной точки вводят внутривенно, внутримышечно, подкожно, топически, перорально, трансдермально, интраперитонеально, интраорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально, предпочтительно внутривенно. В некоторых вариантах реализации ингибитор иммунной контрольной точки представляет собой антагонист PD-L1 (например, антитело анти-PD-L1). В некоторых вариантах реализации антитело анти-PD-L1 вводят субъекту внутривенно в дозе 120 мг один раз в три недели. В некоторых вариантах реализации антитело анти-PD-L1 вводят совместно с селективным ингибитором дипептидилпептидазы (например, талабостатом или его фармацевтически приемлемыми солями, сольватами, производным).

V. Фармацевтические композиции/составы

[158] Согласно настоящему изобретению также предложены фармацевтические композиции или составы, содержащие селективный ингибитор дипептидилпептидазы (например, талабостат) и/или ингибитор иммунной контрольной точки, и один или более фармацевтически приемлемых носителей или адъювантов. Селективный ингибитор дипептидилпептидазы (талабостат) может быть представлен отдельно или совместно с ингибитором иммунной контрольной точки. Термин «представленные совместно» означает, что агенты присутствуют в одной композиции перед введением субъекту. Термин «представленные отдельно» означает, что агенты присутствуют в отдельных и различных композициях перед введением субъекту.

[159] В одном из вариантов реализации настоящего изобретения предложена композиция, содержащая селективный ингибитор дипептидилпептидазы (например, талабостат) и один или более фармацевтически приемлемых носителей. Можно применять любой из фармацевтически приемлемых носителей, описанных в настоящем документе или известных в данной области техники.

[160] В другом варианте реализации настоящего изобретения предложена композиция, содержащая ингибитор иммунной контрольной точки, такой как антагонист PD-1, антагонист PD-L1 или антагонист PD-L2, или антагонист CTLA4, представленный в настоящем документе, и один или более фармацевтически приемлемых носителей или адъювантов. Можно применять любой из фармацевтически приемлемых носителей, описанных в настоящем документе или известных в данной области техники.

[161] В настоящем описании термин «фармацевтическая композиция» относится к композиции, содержащей по меньшей мере один активный терапевтический агент (например, селективный ингибитор дипептидилпептидазы или ингибитор иммунной контрольной точки) и один или более фармацевтически приемлемых носителей. Фармацевтически приемлемые носители или адъюванты хорошо известны специалисту в данной области техники и, как правило, зависят от выбранного пути введения, даже вода включена в качестве примера носителя или адъюванта. В некоторых вариантах реализации смесь содержит по меньшей мере один селективный ингибитор дипептидилпептидазы (например, талабостат) в количестве, которое обуславливает аддитивный или синергетический эффект совместно по меньшей мере с одним ингибитором иммунной контрольной точки у субъекта, когда оба вводят одновременно (например, в одном составе или одновременно в виде отдельных составов). В некоторых вариантах реализации первая композиция, содержащая селективный ингибитор дипептидилпептидазы и один или более фармацевтически приемлемых носителей, и вторая композиция, содержащая ингибитор иммунной контрольной точки и один или более фармацевтически приемлемых носителей, при этом обе присутствуют в количестве, обуславливающем аддитивный или синергетический эффект, когда обе вводят последовательно (в виде отдельных составов) субъекту. В другом предпочтительном варианте реализации комбинацию согласно настоящему изобретению, применяемую для лечения, предотвращения и ослабления опухоли, вводят перорально и/или подкожно или внутривенно.

[162] Фармацевтические композиции, подходящие для введения пациентам-людям, как правило, представлены в форме для парентерального введения, например, в жидком носителе, или подходят для восстановления с образованием жидкого раствора или суспензии для парентерального введения. В целом, такие композиции, как правило, содержат фармацевтически приемлемый носитель. В настоящем описании термин «фармацевтически приемлемый» означает одобренный государственным регулирующим органом или перечисленный в Фармакопее США или другой общепризнанной фармакопее для применения у животных, в частности, у людей. Фармацевтические композиции и составы, описанные в настоящем документе, могут быть получены путем смешивания терапевтического агента (например, антитела) желаемой степени чистоты с одним или более фармацевтически приемлемыми носителями (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)) в форме лиофилизированных составов или водных растворов. Термин «носитель» относится к разбавителю, адъюванту, вспомогательному веществу или носителю, совместно с которым вводят соединение. Фармацевтически приемлемые носители, как правило, нетоксичны для реципиентов в применяемых дозах и концентрациях, и включают, но не ограничиваются ими: буферы, такие как фосфат, цитрат и другие органические кислоты; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (такие как октадецилдиметилбензиламмония хлорид, гексаметония хлорид, бензалкония хлорид, бензетония хлорид, фенол, бутиловый или бензиловый спирт, хлорбутанол, тимеросал, алкилпарабены, такие как метил- или пропилпарабен, катехол, резорцин, циклогексанол, 3-пентанол и м-крезол); низкомолекулярные (менее примерно 10 остатков) полипептиды; белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин или лизин; хелатирующие агенты, такие как EDTA; моносахариды, дисахариды и другие углеводы, включая сахара, такие как сахароза, маннитол, трегалоза или сорбитол, глюкоза, манноза или декстрины; солеобразующие противоионы, такие как натрий; комплексы металлов (например, комплексы Zn-белок); и/или неионные поверхностно-активные вещества, такие как полиэтиленгликоль (ПЭГ). Типичные фармацевтически приемлемые носители согласно настоящему изобретению также включают агенты диспергирования лекарственных средств в интерстициальном пространстве, такие как растворимые нейтрально-активные гиалуронидазные гликопротеины (sHASEGP), например, растворимые гиалуронидазные гликопротеины PH-20 человека, такие как rHuPH20 (HYLENEX®, Baxter International, Inc.). Носитель может представлять собой растворитель или восстанавливающую среду, или дисперсионную среду, содержащую, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль, и т.п.) и их подходящие смеси. Для внутривенного введения подходящие носители включают физиологический раствор, бактериостатическую воду, Кремофор EL (BASF, Парсиппани, Нью-Джерси) или фосфатный буферный раствор (ФБР). Пролонгированная абсорбция композиций для инъекций может быть обеспечена путем включения в композицию агента, замедляющего абсорбцию, например, моностеарата алюминия и желатина.

[163] Растворы или суспензии, применяемые для подкожного введения, как правило, содержат один или более следующих компонентов: стерильный носитель, такой как вода для инъекций, физиологический раствор, нелетучие масла, полиэтиленгликоли, глицерин, пропиленгликоль или другие синтетические растворители; антибактериальные агенты, такие как бензиловый спирт или метилпарабены; антиоксиданты, такие как аскорбиновая кислота или бисульфит натрия; хелатирующие агенты, такие как этилендиаминтетрауксусная кислота; буферы, такие как ацетаты, цитраты или фосфаты; и агенты для регулирования тоничности, такие как хлорид натрия или декстроза. рН можно регулировать кислотами или основаниями, такими как хлористоводородная кислота или гидроксид натрия. Такие препараты могут быть заключены в ампулы, одноразовые шприцы или изготовленные из стекла или пластика флаконы, содержащие несколько доз. Согласно настоящему изобретению также предложены другие составы, такие как микрокапсулы, наночастицы или композиции с замедленным высвобождением, композиции для интраназального введения, композиции для перорального введения. Активные агенты могут быть заключены в микрокапсулы, полученные, например, методами коацервации или путем полимеризации на границе фаз, например, в микрокапсулы из гидроксиметилцеллюлозы или желатина и микрокапсулы из поли(метилметакрилата) соответственно, в коллоидные системы доставки лекарственных средств (например, липосомы, альбуминовые микросферы, микроэмульсии, наночастицы и нанокапсулы) или в макроэмульсии. Такие методики описаны в Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). В некоторых вариантах реализации терапевтические агенты, описанные в настоящем документе, получают совместно с носителями, которые будут защищать соединение от быстрого выведения из организма, например, в виде состава с контролируемым высвобождением, включая имплантаты и микроинкапсулированные системы доставки. Могут быть использованы биоразлагаемые биосовместимые полимеры, такие как этиленвинилацетат, полиангидриды, полигликолевая кислота, коллаген, сложные полиортоэфиры и полимолочная кислота. Способы получения таких составов очевидны специалисту в данной области техники. Липосомальные суспензии, содержащие антитела, описанные в настоящем документе, можно также применять в качестве фармацевтически приемлемых носителей. Подходящие примеры препаратов с замедленным высвобождением включают полупроницаемые матрицы твердых гидрофобных полимеров, содержащие терапевтический агент (например, антитело), при этом указанные матрицы имеют определенную форму изделий, например, пленок или микрокапсул. Составы, применяемые для введения in vivo, как правило, стерильны. Стерильности можно легко достичь, например, путем фильтрации через стерильные фильтрационные мембраны.

[164] Для перорального применения фармацевтические композиции согласно настоящему изобретению можно вводить, например, в форме таблеток или капсул, порошков, диспергируемых гранул или облаток, или в виде водных растворов или суспензий. Композиции для перорального введения, как правило, содержат инертный носитель (например, разбавитель) или съедобный носитель. Они могут быть заключены в желатиновые капсулы или спрессованы в таблетки. Для перорального введения терапевтические агенты можно комбинировать с носителями и применять в форме таблеток, пастилок или капсул. Фармацевтически совместимые связующие агенты и/или вещества, представляющие собой адъюванты, могут быть включены в композицию в качестве ее части. Таблетки, пилюли, капсулы, пастилки и т.п. могут содержать любой из следующих ингредиентов или соединений схожей природы: связующее вещество, такое как микрокристаллическая целлюлоза, трагакантовая камедь или желатин; вспомогательное вещество, такое как крахмал или лактоза, разрыхлитель, такой как альгиновая кислота, примогель или кукурузный крахмал; смазывающее вещество, такое как магния стеарат или стеараты; вещество, способствующее скольжению, такое как коллоидный диоксид кремния; подсластитель, такой как сахароза или сахарин; или ароматизатор, такой как перечная мята, метилсалицилат или апельсиновый ароматизатор.

[165] Жидкие препараты могут также включать растворы для интраназального введения.

[166] Аэрозольные препараты, подходящие для ингаляции, могут включать растворы и твердые вещества в форме порошка, которые могут быть в комбинации с фармацевтически приемлемым носителем, таким как инертный сжатый газ.

[167] Количество селективного ингибитора дипептидилпептидазы (например, талабостата), присутствующее в композиции, должно, в целом, находиться в диапазоне от примерно 0,01 до примерно 30 масс. % и предпочтительно в количестве от 0,5 до 20 масс. % от массы композиции. Подобным образом, количество ингибитора иммунной контрольной точки, присутствующее в композиции, находится в диапазоне от примерно 0,01 до примерно 30% масс. % и предпочтительно в количестве от 0,5 до 20 масс. % от массы композиции. Ингибитор иммунной контрольной точки выбран из группы, состоящей из антагониста PD-1, антагониста PD-L1, антагониста PD-L2, антагониста CTLA4.

[168] Точная доза для применения в составе будет также зависеть от пути введения и тяжести рака, и должна быть определена в соответствии с оценкой врача и обстоятельств каждого пациента. Эффективные дозы могут быть экстраполированы из кривых доза-ответ, полученных в тест-системах in vitro или в моделях у животных.

[169] В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы, описанный в настоящем документе, находится в составе, содержащем эффективное количество селективного ингибитора дипептидилпептидазы и один или более фармацевтически приемлемых носителей или адъювантов, выбранных из группы, включающей наполнитель, буфер, поверхностно-активное вещество, модификатор рН, и указанный состав имеет подходящий рН.

[170] В некоторых вариантах реализации селективный ингибитор дипептидилпептидазы, описанный в настоящем документе, находится в составе, содержащем эффективное количество селективного ингибитора дипептидилпептидазы (например, талабостата) и один или более фармацевтически приемлемых носителей или адъювантов, выбранных из группы, включающей разбавитель, связующее вещество, разрыхлитель, вещество, способствующее скольжению, поверхностно-активное вещество, и указанный состав не содержит органической кислоты.

[171] В некоторых вариантах реализации антагонист PD-L1 (например, антитело анти-PD-L1), описанный в настоящем документе, находится в составе, содержащем антитело в количестве примерно 60 мг/мл, ацетат гистидина в концентрации примерно 20 мМ, сахарозу в концентрации примерно 120 мМ и полисорбат (например, полисорбат 20) в концентрации 0,04% (масс./об.), и рН указанного состава составляет примерно 5,8. В некоторых вариантах реализации антитело анти-PD-L1, описанное в настоящем документе, находится в составе, содержащем антитело в количестве примерно 125 мг/мл, ацетат гистидина в концентрации примерно 20 мМ, сахарозу в концентрации примерно 240 мМ и полисорбат (например, полисорбат 20) в концентрации 0,02% (масс./об.), и рН указанного состава составляет примерно 5,5.

[172] В некоторых вариантах реализации включены различные способы получения вышеупомянутых составов или композиций, и такие композиции могут быть изготовлены любым из способов, известных в данной области техники.

[173] Другой вариант реализации настоящего изобретения относится к фармацевтической композиции талабостата для перорального введения и способу получения такого состава. В некоторых предпочтительных вариантах реализации талабостат представлен в виде таблетки для перорального введения. Фармацевтическая таблетка может представлять собой таблетку с немедленным высвобождением или модифицированным высвобождением. Таблетка может быть в форме матрицы или в форме с покрытием.

[174] Типичная таблетка с немедленным высвобождением содержит эффективное количество талабостата и фармацевтически приемлемый носитель, выбранный из разбавителей, связующих веществ, разрыхлителей, веществ, способствующих скольжению, смазывающих веществ, рН-модифицирующих агентов и их комбинаций.

[175] Разбавители: один или более разбавителей включают, но не ограничиваются ими, двухосновный фосфат кальция, пуллулан, мальтодекстрин, изомальт, сахарные гранулы, маннитол, высушенный распылением маннитол, микрокристаллическую целлюлозу, дигидрат двухосновного фосфата кальция, лактозу, сахара, сорбитол, смесь микрокристаллической целлюлозы и гуаровой камеди (Авицел CE-15), смесь маннитола, полипласдона и силоида (Pharmaburst), смесь маннитола, кросповидона и поливинилацетата (Ludiflash), изомальт, Panexcea, F-Melt, сахарозу, соли кальция и подобные неорганические соли, тяжелый карбонат магния и т.п., и их смеси. Предпочтительно, разбавитель представляет собой лактозу или микрокристаллическую целлюлозу.

[176] Связующие вещества: один или более связующих веществ включают, но не ограничиваются ими, гидроксипропилцеллюлозу с низкой степенью замещения, ксантановую камедь, поливинилпирролидон (повидон), желатин, сахара, глюкозу, природные камеди, камеди, синтетические целлюлозы, полиметакрилат, гидроксипропилметилцеллюлозу, гидроксипропилцеллюлозу, карбоксиметилцеллюлозу, метилцеллюлозу и другие производные целлюлозы и т.п., и их смеси. Предпочтительно, связующее вещество представляет собой поливинилпирролидон или гидроксипропилцеллюлозу, или гидроксипропилметилцеллюлозу.

[177] Разрыхлители: один или более разрыхлителей включают, но не ограничиваются ими, по меньшей мере один из или смесь крахмалгликолята натрия, кроскармеллозы натрия, кросповидона, альгината натрия, камедей, крахмала и алюмосиликата магния. Предпочтительно, разрыхлитель представляет собой крахмалгликолят натрия.

[178] Смазывающие вещества: одно или более смазывающих веществ включают, но не ограничиваются ими, стеарилфумарат натрия, лаурилсульфат натрия, стеарат магния, полиэтиленгликоль, стеараты металлов, гидрогенизированное касторовое масло и т.п., и их смеси. Предпочтительно, смазывающее вещество представляет собой стеарат магния.

[179] Вещество, способствующее скольжению: одно или более веществ, способствующих скольжению, включают, но не ограничиваются ими, стеариновую кислоту, коллоидный диоксид кремния, тальк, силикат алюминия и т.п., и их смеси. Предпочтительно, вещество, способствующее скольжению, представляет собой тальк.

[180] рН-модифицирующие агенты: один или более рН-модифицирующих агентов включают, но не ограничиваются ими, органическую кислоту или ее соли, например, фосфорную кислоту, лимонную кислоту и т.п.

[181] В одном из вариантов реализации настоящего изобретения предложены проценты или концентрации фармацевтически приемлемых вспомогательных веществ, приведенные в таблице ниже:

Таблица 2:

Содержимое состава Количество (масс. %)
талабостат в качестве АФИ 0,01-2
Связующее вещество 5-50
Разрыхлитель 2-15
Смазывающее вещество 0,1-5
Разбавитель 30-98
рН-модифицирующий агент 0-15

[182] Предпочтительно, типичная таблетка талабостата с немедленным высвобождением содержит следующее:

Таблица 3:

Содержимое состава Количество (масс. %) Предпочтительные диапазоны (масс. %)
талабостат талабостат (69% свободного основания) в качестве АФИ 0,01-2 0,145
Поливинилпирролидон или гидроксипропилцеллюлоза, или гидроксипропилметилцеллюлоза, или предварительно желатинизированный крахмал в качестве связующего вещества 5-50 1,00
Крахмалгликолят натрия или кросповидон в качестве разрыхлителя 5-15 2,5
Стеариновая кислота в качестве смазывающего вещества 0,1-5 1,500
Лактоза в качестве разбавителя 30-90 85,315
Микрокристаллическая целлюлоза в качестве разбавителя 5-20 9,480
Одноосновный фосфат натрия, моногидрат в качестве pH-модифицирующего агента 0-15 0,060
Фосфорная кислота в качестве pH-модифицирующего агента Для регулировки pH Для регулировки pH

[183] В некоторых предпочтительных вариантах реализации количество талабостата в единичной дозе составляет примерно 100 микрограмм на таблетку, примерно 200 микрограмм на таблетку, примерно 300 микрограмм на таблетку, примерно 400 микрограмм на таблетку, примерно 500 микрограмм на таблетку, примерно 600 микрограмм на таблетку, примерно 700 микрограмм на таблетку, примерно 800 микрограмм на таблетку.

[184] В некоторых предпочтительных вариантах реализации талабостат представлен в виде матричной таблетки с модифицированным высвобождением. Типичная таблетка с пролонгированным высвобождением содержит эффективное количество талабостата, и фармацевтически приемлемый носитель или адъювант выбраны из разбавителей, связующих веществ, вещества с модифицированным высвобождением, веществ, способствующих скольжению, смазывающих веществ, красителей и их комбинаций. В качестве альтернативы, таблетка с модифицированным высвобождением содержит ядро с немедленным высвобождением и покрытие, при этом указанное покрытие содержит вещество с модифицированным высвобождением и другие фармацевтические вспомогательные вещества.

[185] Вещество с модифицированным высвобождением включает, но не ограничивается ими, поливинилпирролидон (K90), гидроксипропилметилцеллюлозу (K4M, K10), гидроксипропилцеллюлозу (высокая степень вязкости), карнаубский воск, глицерилбегенат, касторовый воск, поливинилацетат, карбоксиметилэтилцеллюлозу, этилцеллюлозу, фталаты или сукцинаты целлюлозы, в частности, ацетатфталат целлюлозы и фталат гидроксипропилметилцеллюлозы, сукцинат гидроксипропилметилцеллюлозы или сукцинат ацетата гидроксипропилметилцеллюлозы; высокомолекулярные полиалкиленоксиды, такие как полиэтиленоксид и полипропиленоксид, и сополимеры этиленоксида и пропиленоксида, и т.п. Предпочтительно, оно представляет собой поливинилпирролидон (K90) или гидроксипропилметилцеллюлозу (K4M, K10), или гидроксипропилцеллюлозу (высокая степень вязкости-HF), полиэтиленоксид и т.п. Вещество с модифицированным высвобождением присутствует в диапазоне 10-50 масс. % от массы таблетки.

[186] Предпочтительно, типичная таблетка талабостата с модифицированным высвобождением содержит следующее:

Таблица 4:

Содержимое состава Количество (масс. %)
талабостат в качестве АФИ 0,01-2
Поливинилпирролидон (K90) или гидроксипропилметилцеллюлоза (K4M, K10), или гидроксипропилцеллюлоза (высокая степень вязкости-HF), или полиэтиленоксид в качестве вещества с модифицированным высвобождением 10-50
Крахмалгликолят натрия или кросповидон в качестве разрыхлителя 0-10
Стеарат магния или стеариновая кислота в качестве смазывающего вещества 0,1-10
Лимонная кислота или фосфорная кислота в качестве pH-модифицирующего агента 0-15
Лактоза в качестве наполнителя 30-90

[187] Таким образом, в соответствии с одним из аспектов настоящего изобретения предложена фармацевтическая таблетка, содержащая частицы, по существу состоящие из талабостата, разбавитель (например, моногидрат лактозы) и возможно связующее вещество. Указанные частицы могут быть смешаны с одним или более из: связующего вещества, смазывающего вещества и разрыхлителя, а затем спрессованы.

[188] Для изготовления таблеток согласно настоящему изобретению можно применять различные способы. Более предпочтительно, способ включает растворение талабостата в подходящем растворителе (со связующим веществом или без него), и данный раствор равномерно распределяют по всем частицам наполнителя (могут содержать другие вещества) с получением агломерированных частиц/гранул. Для этого можно использовать способ влажной грануляции, нанесения покрытия или распыления. Полученные гранулы доводят до требуемого размера в соответствии с требованием или гранулы могут быть дополнительно обработаны методом сухой грануляции/комкования/вальцевания с последующим этапом размола с получением подходящих гранул с конкретным распределением частиц по размеру. Затем доведенные до нужного размера гранулы смешивают с другими компонентами и/или затем смазывают в подходящем смесителе и прессуют в таблетки конкретных размеров с использованием соответствующего инструмента. Нанесение покрытия может быть выполнено с помощью соответствующего оборудования.

VI. Наборы

[189] В некоторых вариантах реализации комбинация включает состав селективного ингибитора дипептидилпептидазы и ингибитора иммунной контрольной точки совместно с инструкциями по комбинированному применению или комбинированным продуктам, или без них. Комбинированные лекарственные средства может быть изготовлены и/или получены одним и тем же или разными производителями. Таким образом, комбинированные лекарственные средства могут представлять собой полностью раздельные фармацевтические лекарственные формы или фармацевтические композиции, которые также продаются независимо друг от друга. В вариантах реализации инструкции по их комбинированному применению предложены: (i) до выпуска для врачей (например, в случае «составного набора», содержащего первый терапевтический агент и другой терапевтический агент); (ii) самими врачами (или под руководством врача) незадолго до введения; (iii) самим пациентам врачом или медицинским персоналом.

[190] В соответствии с другим аспектом предложен набор, содержащий селективный ингибитор дипептидилпептидазы и/или ингибитор иммунной контрольной точки, для лечения или замедления прогрессирования рака у субъекта или для усиления иммунной функции субъекта, страдающего раком. В некоторых вариантах реализации набор содержит селективный ингибитор дипептидилпептидазы и листок-вкладыш в упаковке, содержащий инструкции по применению указанного селективного ингибитора дипептидилпептидазы в комбинации с ингибитором иммунной контрольной точки для лечения или замедления прогрессирования рака у субъекта или для усиления иммунной функции субъекта, страдающего раком. В некоторых вариантах реализации набор содержит ингибитор иммунной контрольной точки и листок-вкладыш в упаковке, содержащий инструкции по применению указанного ингибитора иммунной контрольной точки в комбинации с селективным ингибитором дипептидилпептидазы для лечения или замедления прогрессирования рака у субъекта или для усиления иммунной функции субъекта, страдающего раком. В некоторых вариантах реализации набор содержит селективный ингибитор дипептидилпептидазы и ингибитор иммунной контрольной точки, и листок-вкладыш в упаковке, содержащий инструкции по применению указанного селективного ингибитора дипептидилпептидазы и указанного ингибитора иммунной контрольной точки для лечения или замедления прогрессирования рака у субъекта или для усиления иммунной функции субъекта, страдающего раком. Любой из селективных ингибиторов дипептидилпептидазы (например, талабостат) и/или ингибиторов иммунных контрольных точек, описанных в настоящем документе, может быть включен в наборы.

[191] В некоторых вариантах реализации набор содержит емкость, содержащую один или более из: селективного ингибитора дипептидилпептидазы и ингибиторов иммунных контрольных точек, описанных в настоящем документе. Подходящие емкости включают, например, бутылки, флаконы (например, двухкамерные флаконы), шприцы (например, одно- или двухкамерные шприцы) и пробирки. Емкость может быть изготовлена из различных материалов, таких как стекло или пластик. В некоторых вариантах реализации набор может содержать этикетку (например, на емкости или связанную с ней) или листок-вкладыш в упаковке. Указанная этикетка или листок-вкладыш в упаковке может указывать, что содержащееся в нем соединение может подходить или быть предназначенным для лечения или замедления прогрессирования рака у субъекта или для усиления иммунной функции субъекта, страдающего раком. Набор может дополнительно содержать другие материалы, необходимые с коммерческой и пользовательской точки зрения, включая другие буферы, разбавители, фильтры, иглы и шприцы. В одном из вариантов реализации настоящего изобретения ингибитор иммунной контрольной точки представляет собой антагонист PD-1, антагонист PD-L1, антагонист PD-L2 или антагонист CTLA4.

[192] Таким образом, некоторые варианты реализации настоящего изобретения относятся к наборам, которые содержат первую композицию, содержащую один или более селективных ингибиторов дипептидилпептидазы, и вторую композицию, содержащую один или более ингибиторов иммунных контрольных точек. В некоторых вариантах реализации первая и вторая композиции могут быть смешаны перед введением субъекту. В некоторых вариантах реализации первую и вторую композиции можно вводить либо одновременно, либо последовательно (т.е. с растяжением во времени) для получения от указанной комбинации максимальной эффективности, аддитивности, синергии или их комбинации.

[193] Режим дозирования действующих начал и фармацевтической композиции, описанной в настоящем документе, может быть выбран лечащим врачом на основе знаний в данной области техники, включая информацию, публикуемую регулирующими органами. Например, ниволумаб (Опдиво®), как правило, вводят внутривенно. Согласно Управлению США по контролю за качеством пищевых продуктов и лекарственных средств (FDA) рекомендуемая доза Опдиво® составляет 3 мг/кг, вводимые в виде внутривенной инфузии в течение 60 минут каждые 2 недели до прогрессирования заболевания.

[194] В некоторых вариантах способов, применения, композиций и наборов, описанных в настоящем документе, ингибитор иммунной контрольной точки выбран из группы, состоящей из антагониста PD-1, антагониста PD-L1 и антагониста PD-L2. В некоторых вариантах реализации антагонист, связывающий ось PD-1, представляет собой антагонист PD-1. В некоторых вариантах реализации антагонист анти-PD-1 ингибирует связывание PD-1 с его партнерами по связыванию, представляющими собой лиганды. В некоторых вариантах реализации антагонист PD-1 ингибирует связывание PD-1 с PD-L1, PD-1 с PD-L2 или PD-1 как с PD-L1, так и с PD-L2.

VII. Исходы

[195] Пациенты, получающие лечение в соответствии со способами, описанными в настоящем документе, предпочтительно испытывают облегчение по меньшей мере одного признака рака. В одном из вариантов реализации облегчение измеряют по уменьшению количества и/или размера измеряемых опухолевых поражений. В другом варианте реализации поражения могут быть измерены на рентгенограммах органов грудной клетки или КТ- или МРТ-снимках. В другом варианте реализации для оценки отвечаемости на терапию можно использовать цитологию или гистологию. В другом варианте реализации обеспечивают увеличение выживаемости без прогрессирования и/или общей выживаемости.

[196] В соответствии с конкретными аспектами противоопухолевый ответ представляет собой опухолеспецифический ответ, клинический ответ, уменьшение размера/объема опухоли, уменьшение опухолеспецифических биомаркеров, увеличение количества противоопухолевых цитокинов или их комбинацию.

[197] В соответствии с конкретным аспектом клинический ответ представляет собой снижение роста опухоли и/или уменьшение размера опухоли. В соответствии с конкретным аспектом инициирование, поддержание или усиление противоопухолевого иммунного ответа предназначено для лечения рака.

[198] В соответствии с другим аспектом противоопухолевый ответ представляет собой ингибирование роста опухоли, индуцирование гибели клеток опухоли, регрессию опухоли, предотвращение или замедление возникновения рецидива опухоли, роста опухоли, распространения опухоли или устранение опухоли.

[199] В конкретных вариантах реализации ответ опухоли представляет собой уменьшение количества клеток опухоли. В конкретных вариантах реализации ответ опухоли представляет собой снижение скорости роста опухоли. В конкретных вариантах реализации ответ опухоли представляет собой блокировку ферментативной активности дипептидилпептидазы. В конкретных вариантах реализации ответ опухоли представляет собой индуцирование ответа провоспалительных цитокинов и ответа цитотоксических Т-клеток.

[200] Рассматриваемые способы приводят к ингибированию размера опухоли более чем примерно 10%, более чем примерно 20%, более чем примерно 30%, более чем примерно 35%, более чем примерно 42%, более чем примерно 43%, более чем примерно на 44%, более чем примерно 45%, более чем примерно 46%, более чем примерно 47%, более чем примерно 48%, более чем примерно 49%, более чем примерно 50%, более чем примерно 51%, более чем примерно 52%, более чем примерно 53%, более чем примерно 54%, более чем примерно 55%, более чем примерно 56%, более чем примерно 57%, более чем примерно 58%, более чем примерно 59%, более чем примерно 60%, более чем примерно 65%, более чем примерно 70%, более чем примерно 75%, более чем примерно 80%, более чем примерно 85%, более чем примерно 90%, более чем примерно 95% или более чем примерно 100%.

[201] В одном из вариантов реализации пациент, получающий лечение, демонстрирует полный ответ (CR), частичный ответ (PR), стабильное заболевание (SD), связанное с иммунной системой полное заболевание (irCR), связанный с иммунной системой частичный ответ (irPR) или связанное с иммунной системой стабильное заболевание (irSD). В другом варианте реализации у пациента, получающего лечение, происходит уменьшение массы опухоли и/или снижение скорости роста, т.е. подавление роста опухоли. В другом варианте реализации происходит снижение или ингибирование нежелательной пролиферации клеток. В другом варианте реализации может происходить одно или более из следующего: число раковых клеток может быть уменьшено; размер опухоли может быть уменьшен; инфильтрация раковых клеток в периферические органы может быть ингибирована, задержана, замедлена или остановлена; метастазирование опухоли может быть замедлено или ингибировано; рост опухоли может быть ингибирован; рецидив опухоли может быть предотвращен или отсрочен; один или более симптомов, связанных с раком, могут быть в некоторой степени облегчены.

[202] В других вариантах реализации введение эффективных количеств селективного ингибитора дипептидилпептидазы (например, ингибитора FAP или ингибитора DPP 8/9) и антагониста PD-1 в соответствии с любым из способов, предложенных согласно настоящему изобретению, обеспечивает по меньшей мере один терапевтический эффект, выбранный из группы, состоящей из уменьшения размера опухоли, уменьшения количества метастатических поражений, возникающих со временем, полной ремиссии, частичной ремиссии или стабильного заболевания. В других вариантах реализации способы лечения обеспечивают лучшую сравнимую частоту клинической эффективности (CBR=CR+PR+SD ≥6 месяцев), чем достигаемая одним ингибитором FAP или ингибитором DPP 8/9, или антагонистом PD-1. В других вариантах реализации улучшение частоты клинической эффективности составляет примерно 20%, 30%, 40%, 50%, 60%, 70%, 80% или более по сравнению с одним ингибитором FAP или ингибитором DPP 8/9, или антагонистом PD-1. В некоторых вариантах реализации CD8+ T-клетки у индивидуума демонстрируют усиленное примирование, активацию, пролиферацию и/или цитолитическую активность в присутствии комбинации селективного ингибитора дипептидилпептидазы и антагониста оси PD-1 по сравнению с введением одного агента.

[203] В некоторых вариантах реализации примирование CD8+ Т-клеток характеризуется повышенной экспрессией CD44 и/или повышенной цитолитической активностью CD8+ Т-клеток. В некоторых вариантах реализации активация CD8+ Т-клеток характеризуется повышенной частотой γ-IFN+ CD8+ Т-клеток. В некоторых вариантах реализации CD8+ Т-клетка представляет собой антигенспецифическую Т-клетку. В некоторых вариантах реализации ускользание от иммунологического надзора ингибируется путем ингибирования передачи сигнала через экспрессию PD-L1 на поверхности.

[204] В некоторых вариантах реализации количество CD4+ и/или CD8+ T-клеток увеличено по сравнению с моментом до введения комбинации. В некоторых вариантах реализации активированные CD4+ и/или CD8+ Т-клетки характеризуются γ-IFN+ - продуцирующими CD4+ и/или CD8+ Т-клетками, и/или повышенной цитолитической активностью по сравнению с моментом до введения комбинации. В некоторых вариантах реализации CD4+ и/или CD8+ Т-клетки демонстрируют повышенное высвобождение цитокинов, выбранных из группы, состоящей из IFN-γ, TNF-α и интерлейкинов (IL-2, IL-6, IL-12p40, IL-15).

[205] В некоторых вариантах реализации CD4+ и/или CD8+ Т-клетка представляет собой эффекторную Т-клетку памяти. В некоторых вариантах реализации эффекторная CD4+ и/или CD8+ Т-клетка памяти характеризуется γ-IFN+ - продуцирующими CD4+ и/или CD8+ T-клетками и/или повышенной цитолитической активностью. В некоторых вариантах реализации эффекторная CD4+ и/или CD8+ Т-клетка памяти характеризуется наличием экспрессии CD44выс CD62Lниз, а также связана с высвобождением цитокинов IL-15 и IL-7.

[206] В некоторых вариантах реализации антигенпредставляющие клетки у индивидуума демонстрируют повышенное созревание и активацию в присутствии комбинации селективного ингибитора дипептидилпептидазы и антагониста PD-1 по сравнению с введением одного агента. В некоторых вариантах реализации антигенпредставляющие клетки представляют собой дендритные клетки. В некоторых вариантах реализации созревание антигенпредставляющих клеток характеризуется повышенной частотой CD83+ дендритных клеток. В некоторых вариантах реализации активация антигенпредставляющих клеток характеризуется повышенной экспрессией CD80+ и CD86+ на дендритных клетках.

[207] В некоторых вариантах реализации сывороточные уровни цитокина IL-2 и/или хемокина GM-CSF, G-CSF у субъекта повышаются в присутствии комбинации селективного ингибитора дипептидилпептидазы и антагониста PD-1 по сравнению с введением одного агента.

[208] В некоторых вариантах реализации рак демонстрирует повышенные уровни инфильтрации Т-клетками в присутствии комбинации селективного ингибитора дипептидилпептидазы и антагониста PD-1 по сравнению с введением одного агента.

[209] Что касается целевых поражений, ответы на терапию могут включать: полный ответ (CR), частичный ответ (PR), прогрессирующее заболевание (PD), стабильное заболевание (SD), связанный с иммунной системой полный ответ (irCR), связанный с иммунной системой частичный ответ (irPR), связанное с иммунной системой прогрессирующее заболевание (irPD) или связанное с иммунной системой стабильное заболевание (irSD).

[210] Что касается нецелевых поражений, ответы на терапию могут включать: полный ответ (CR), прогрессирующее заболевание (PD), связанный с иммунной системой полный ответ (irCR) и связанное с иммунной системой прогрессирующее заболевание (irPD).

[211] Конкретные варианты реализации настоящего изобретения являются следующими:

[212] Вариант реализации 1. Способ усиления иммунного ответа у субъекта, включающий введение эффективного количества терапевтического агента (агентов), действующего на опухоли, клетки в их микроокружении, иммунные клетки или секретируемые продукты путем ингибирования активности дипептидилпептидазы, в комбинации с ингибитором иммунной контрольной точки для усиления иммунного ответа у субъекта, при этом у указанного субъекта диагностирована опухоль.

[213] Вариант реализации 2. Способ согласно варианту реализации 1, в котором терапевтический агент выбран из группы, состоящей из малой молекулы, антитела, нанотела, искусственно сконструированного пептида, искусственно сконструированного белка, вакцины, терапии миРНК или аутологичного терапевтического средства, усиливающего иммунный ответ, предпочтительно малой молекулы.

[214] Вариант реализации 3. Способ согласно вариантам реализации 1 и 2, в котором терапевтический агент включает селективный ингибитор дипептидилпептидазы, который включает ингибирование белка активации фибробластов и/или дипептидилпептидазы 8/9.

[215] Вариант реализации 4. Способ согласно варианту реализации 2, в котором указанная малая молекула представляет собой талабостат.

[216] Вариант реализации 5. Способ лечения пролиферативных заболеваний, в том числе опухоли, включающий введение нуждающемуся в этом субъекту синергетически, терапевтически эффективного количества селективного ингибитора дипептидилпептидазы в комбинации с ингибитором иммунной контрольной точки.

[217] Вариант реализации 6. Применение терапевтического агента, селективно ингибирующего активность дипептидилпептидазы, включая белок активации фибробластов и/или дипептидилпептидазу 8/9, в комбинации с ингибитором иммунной контрольной точки в изготовлении фармацевтической композиции для лечения опухоли.

[218] Вариант реализации 7. Способ лечения пролиферативных заболеваний, в том числе опухоли, включающий введение нуждающемуся в этом субъекту синергетически, терапевтически эффективного количества талабостата в комбинации с ингибитором иммунной контрольной точки.

[219] Вариант реализации 8. Применение талабостата в комбинации с ингибитором иммунной контрольной точки в изготовлении фармацевтической композиции для лечения опухоли.

[220] Вариант реализации 9. Селективный ингибитор дипептидилпептидазы для применения для лечения опухоли, ослабляемой стимуляцией иммунного ответа, при этом в указанном лечении совместно вводят ингибитор иммунной контрольной точки.

[221] Вариант реализации 10. талабостат для применения для лечения опухоли, ослабляемой стимуляцией иммунного ответа, при этом в указанном лечении совместно вводят ингибитор иммунной контрольной точки.

[222] Вариант реализации 11. Комбинированная терапия для лечения опухоли, при этом указанная комбинация содержит:

(i) эффективное количество селективного ингибитора (ингибиторов) дипептидилпептидазы и

(ii) эффективное количество ингибитора (ингибиторов) иммунной контрольной точки.

[223] Вариант реализации 12. Комбинированная терапия для лечения опухоли, при этом указанная комбинация содержит:

(i) эффективное количество талабостата и

(ii) эффективное количество ингибитора (ингибиторов) иммунной контрольной точки.

[224] Вариант реализации 13. Способ лечения опухоли, включающий введение нуждающемуся в этом субъекту

(i) эффективного количества селективного ингибитора (ингибиторов) дипептидилпептидазы и

(ii) эффективного количества ингибитора (ингибиторов) иммунной контрольной точки,

для обеспечения комбинированной терапии, оказывающей повышенный терапевтический эффект по сравнению с эффектом селективного ингибитора дипептидилпептидазы и ингибитора иммунной контрольной точки, каждый из которых вводят отдельно.

[225] Вариант реализации 14. Способ согласно вариантам реализации 1 и 5-13, в котором указанный ингибитор иммунной контрольной точки выбран из группы, включающей антагонист PD1, антагонист PD-L1, антагонист PD-L2, антагонист CTLA4, антагонист VISTA, антагонист TIM3, антагонист LAG3, антагонист IDO, антагонист KIR2D, антагонист A2AR, антагонист B7-H3, антагонист B7-H4, антагонист BTLA, и предпочтительным является антагонист оси PD1, антагонист CTLA4 или их комбинация.

[226] Вариант реализации 15. Способ согласно вариантам реализации 5, 6, 9, 11 и 13, в котором селективный ингибитор дипептидилпептидазы выбран из группы, состоящей из малой молекулы, антитела, нанотела, искусственно сконструированного пептида, искусственно сконструированного белка, вакцины, терапии миРНК или аутологичного терапевтического средства, усиливающего иммунный ответ, предпочтительно малой молекулы.

[227] Вариант реализации 16. Способ согласно варианту реализации 15, в котором указанная малая молекула представляет собой талабостат.

[228] Вариант реализации 17. Способ согласно вариантам реализации 1 и 5-13, в котором опухоль представляет собой солидную опухоль или гематологическую злокачественную опухоль.

[229] Вариант реализации 18. Способ согласно варианту реализации 17, в котором опухоль/рак выбран из группы, состоящей из рака поджелудочной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиальных, нейроэктодермальных опухолей, плоскоклеточного рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака, немелкоклеточного рака легкого, метастатической меланомы и т.п.

[230] Вариант реализации 19. Способ согласно варианту реализации 14, в котором антагонист PD-1 выбран из группы, состоящей из ANA011, BGB-A317, KD033, пембролизумаба, MCLA-134, mDX400, MEDI0680, muDX400, ниволумаба, PDR001, PF-06801591, пидилизумаба, REGN-2810, SHR 1210, STI-A1110, TSR-042, ANB011, 244C8, 388D4, TSR042 и XCE853, и предпочтительным является Пембролизумаб, ниволумаб или Пидилизумаб.

[231] Вариант реализации 20. Способ согласно варианту реализации 14, в котором антагонист PD-L1 выбран из группы, состоящей из авелумаба, BMS-936559, CA-170, дурвалумаба, MCLA-145, SP142, STI-A1011, STI-A1012, STI-A1010, STI-A1014, A110, KY1003 и атезолимумаба, и предпочтительным является Дурвалумаб или атезолимумаб.

[232] Вариант реализации 21. Способ согласно варианту реализации 14, в котором антагонист PD-L2 выбран из AMP-224 и rHIgM12B7.

[233] Вариант реализации 22. Способ согласно варианту реализации 14, в котором антагонист CTLA4 выбран из группы, состоящей из KAHR-102, AGEN1884, ABR002, KN044, тремелимумаба или Ипилимумаба, и предпочтительным является Тремелимумаб и Ипилимумаб.

[234] Вариант реализации 23. Фармацевтическая композиция, содержащая:

(i) эффективное количество селективного ингибитора (ингибиторов) дипептидилпептидазы;

(ii) эффективное количество ингибитора (ингибиторов) иммунной контрольной точки и

(iii) фармацевтически приемлемый носитель или адъювант (адъюванты),

при этом введение указанной композиции субъекту с опухолью обеспечивает лечение, предотвращение или замедление роста или метастазирования опухоли у указанного субъекта.

[235] Вариант реализации 24. Фармацевтическая композиция, содержащая:

(i) эффективное количество селективного ингибитора (ингибиторов) дипептидилпептидазы;

(ii) эффективное количество ингибитора (ингибиторов) иммунной контрольной точки и

(iii) эффективное количество возможного противоопухолевого агента (агентов) и

(iv) один или более фармацевтически приемлемых носителей или адъювантов,

при этом введение указанной композиции субъекту с опухолью обеспечивает лечение, предотвращение или замедление роста или метастазирования опухоли у указанного субъекта.

[236] Вариант реализации 25. Фармацевтическая композиция для применения в комбинации с ингибитором иммунной контрольной точки для лечения опухоли, при этом указанная фармацевтическая композиция содержит талабостат совместно с одним или более фармацевтически приемлемыми носителями или адъювантами.

[237] Вариант реализации 26. Фармацевтическая композиция согласно варианту реализации 25, в которой талабостат представлен в виде таблетки, содержащей лактозу и микрокристаллическую целлюлозу в качестве разбавителя, предварительно желатинизированный крахмал в качестве связующего вещества, кросповидон в качестве разрыхлителя, стеариновую кислоту в качестве смазывающего вещества и возможно моногидрат одноосновного фосфата натрия и фосфорную кислоту в качестве модификатора рН.

[238] Вариант реализации 27. Фармацевтическая композиция согласно варианту реализации 25, в которой талабостат представлен в виде таблетки с модифицированным высвобождением, содержащей лактозу и микрокристаллическую целлюлозу в качестве разбавителя, гидроксипропилметилцеллюлозу или гидроксипропилцеллюлозу, или поливинилпирролидон в качестве вещества с модифицированным высвобождением, стеариновую кислоту в качестве смазывающего вещества и возможно моногидрат одноосновного фосфата натрия и/или фосфорную кислоту в качестве модификатора рН.

[239] Вариант реализации 28. Способ лечения пролиферативных заболеваний, в том числе опухоли, включающий введение нуждающемуся в этом субъекту синергетически, терапевтически эффективного количества селективного ингибитора дипептидилпептидазы в комбинации с CAR-T- или CAR-NK-клетками.

[240] Вариант реализации 29. Способ согласно вариантам реализации 23, 24 и 28, в котором селективный ингибитор дипептидилпептидазы выбран из группы, состоящей из малой молекулы, антитела, нанотела, искусственно сконструированного пептида, искусственно сконструированного белка, вакцины, терапии миРНК или аутологичного терапевтического средства, усиливающего иммунный ответ, предпочтительно малой молекулы.

[241] Вариант реализации 30. Фармацевтическая композиция согласно варианту реализации 29, в которой указанная малая молекула представляет собой талабостат.

[242] Вариант реализации 31. Фармацевтическая композиция согласно варианту реализации 30, в которой талабостат представлен в виде таблетки, капсулы, суспензии, раствора, таблетки с пролонгированным высвобождением, таблетки с контролируемым высвобождением, капсулы с пролонгированным высвобождением, капсулы с контролируемым высвобождением, липосомы, микрочастиц, наночастиц и т.п.

[243] Вариант реализации 32. Фармацевтическая композиция согласно варианту реализации 26 и 27, при этом указанная фармацевтическая композиция не содержит органической кислоты.

[244] Вариант реализации 33. Фармацевтическая композиция согласно вариантам реализации 23 и 24, при этом селективный ингибитор дипептидилпептидазы вводят путем введения, выбранным из группы, состоящей из: перорального, трансбуккального, внутривенного, подкожного, внутриартериального, внутримышечного, трансдермального, ингаляционного пути и любой их комбинации, предпочтительно перорально.

[245] Вариант реализации 34. Способ лечения пролиферативного заболевания, в том числе опухоли, включающий: введение первой композиции, содержащей селективный ингибитор дипептидилпептидазы, при этом указанный селективный ингибитор дипептидилпептидазы представляет собой малую молекулу; и затем введение второй композиции, содержащей ингибитор иммунной контрольной точки, при этом указанный селективный ингибитор дипептидилпептидазы вводят одновременно, последовательно или через интервал с указанным ингибитором иммунной контрольной точки.

[246] Вариант реализации 35. Способ согласно варианту реализации 34, в котором композиции вводят одним и тем же путем введения или разными путями введения.

[247] Вариант реализации 36. Набор, содержащий

(i) первую композицию, содержащую селективный ингибитор (ингибиторы) дипептидилпептидазы, и

(ii) вторую композицию, содержащую ингибитор (ингибиторы) иммунной контрольной точки.

[248] Вариант реализации 37. Набор, содержащий первую емкость, вторую емкость и листок-вкладыш в упаковке, при этом указанная первая емкость содержит по меньшей мере одну дозу фармацевтической композиции, содержащей ингибитор иммунной контрольной точки, указанная вторая емкость содержит по меньшей мере одну дозу фармацевтической композиции, содержащей талабостат, и указанный листок-вкладыш в упаковке содержит инструкции по лечению рака у субъекта с применением указанных фармацевтических композиций.

[249] Вариант реализации 38. Набор для лечения субъекта, страдающего опухолью, при этом указанный набор содержит:

(i) дозу талабостата в диапазоне от примерно 0,001 мг/кг до 0,035 мг/кг массы тела;

(ii) дозу ингибитора иммунной контрольной точки, ингибирующего цель-иммунную контрольную точку, в диапазоне от примерно 0,1 мг/кг до 20,0 мг/кг массы тела и

(iii) инструкции по применению талабостата и ингибитора иммунной контрольной точки.

[250] Вариант реализации 39. Способ идентификации пациента, у которого диагностирована опухоль, связанная с повышенным уровнем дипептидилпептидазы (FAP или DPP8/9) и/или мишени (мишеней), представляющей собой иммунную контрольную точку, у которого существует повышенная вероятность достижения увеличенной общей выживаемости после терапии селективным ингибитором дипептидилпептидазы и ингибитором (ингибиторами) иммунной контрольной точки путем совместного введения.

[251] Вариант реализации 40. Способ лечения, замедления или предотвращения метастазирования опухоли у субъекта, включающий введение субъекту эффективного количества селективного ингибитора дипептидилпептидазы в комбинации с антагонистом оси PD-1, при этом у указанного субъекта диагностирована опухоль, связанная с повышенными уровнями DPP (FAP или DPP8/9) и/или оси PD-1.

[252] Вариант реализации 41. Способ лечения, замедления или предотвращения метастазирования опухоли у субъекта, включающий введение субъекту эффективного количества селективного ингибитора дипептидилпептидазы в комбинации с антагонистом CTLA4, при этом у указанного субъекта диагностирована опухоль, связанная с повышенными уровнями DPP (FAP или DPP8/9) и/или CTLA4.

[253] Вариант реализации 42. Способ лечения субъекта, получающего ингибитор иммунной контрольной точки для лечения рака, при этом улучшение включает введение эффективного количества селективного ингибитора дипептидилпептидазы указанному субъекту в сочетании с указанным ингибитором иммунной контрольной точки, при этом эффект заключается в усилении противоопухолевого действия указанного ингибитора иммунной контрольной точки, при этом указанный ингибитор иммунной контрольной точки представляет собой антагонист PD-1, антагонист PD-L1, антагонист PD-L2, антагонист CTLA4.

[254] Вариант реализации 43. Способ усиления выработки провоспалительных цитокинов у человека с опухолью, включающий введение человеку с опухолью терапевтически эффективных количеств (i) талабостата и (ii) ингибитора иммунной контрольной точки, при этом указанная комбинация талабостата и ингибитора иммунной контрольной точки обеспечивает синергетическое увеличение выработки провоспалительных цитокинов, при этом указанный ингибитор иммунной контрольной точки представляет собой антагонист PD-1, антагонист PD-L1, антагонист PD-L2, антагонист CTLA4.

[255] Вариант реализации 44. Способ индуцирования апоптоза в опухоли, включающий введение человеку с опухолью терапевтически эффективных количеств (i) талабостата и (ii) ингибитора иммунной контрольной точки, при этом указанная комбинация талабостата и ингибитора иммунной контрольной точки обеспечивает синергетическое увеличение апоптоза, при этом указанный ингибитор иммунной контрольной точки представляет собой антагонист PD-1, антагонист PD-L1, антагонист PD-L2, антагонист CTLA4.

[256] Вариант реализации 45. Способ согласно любому из предшествующих вариантов реализации, в котором ингибитор иммунной контрольной точки вводят в дозе от примерно 0,01 до 30 мг/кг, предпочтительно от 0,1 до 20 мг/кг, более предпочтительно от 1 до 10 мг/кг.

[257] Вариант реализации 46. Способ согласно любому из предшествующих вариантов реализации, в котором селективный ингибитор дипептидилпептидазы вводят в дозе от примерно 0,001 до 10 мг/кг, предпочтительно от 0,001 до 3 мг/кг, более предпочтительно от 0,001 до 2 мг/кг.

[258] Вариант реализации 47. Способ согласно любому из предшествующих вариантов реализации 36, 39, 40, 41 и 42, в котором селективный ингибитор дипептидилпептидазы выбран из группы, состоящей из малой молекулы, антитела, нанотела, искусственно сконструированного пептида, искусственно сконструированного белка, вакцины, терапии миРНК или аутологичного терапевтического средства, усиливающего иммунный ответ, предпочтительно малой молекулы.

[259] Вариант реализации 48. Способ согласно варианту реализации 46, в котором указанная малая молекула представляет собой талабостат.

[260] Вариант реализации 49. Способы согласно вариантам реализации 23-25, 34, 36, 37, 38 и 39, в которых указанный ингибитор иммунной контрольной точки выбран из группы, включающей антагонист PD-1, антагонист PD-L1, антагонист PD-L2, антагонист CTLA4, антагонист VISTA, антагонист TIM3, антагонист LAG3, антагонист IDO, антагонист KIR2D, антагонист A2AR, антагонист B7-H3, антагонист B7-H4, антагонист BTLA, и предпочтительным является антагонист оси PD1, антагонист CTLA4 или их комбинация.

[261] Вариант реализации 50. Способ согласно варианту реализации 40, в котором антагонист оси PD1 выбран из группы, состоящей из антагониста PD-1, антагониста PD-L1 и антагониста PD-L2.

[262] Вариант реализации 51. Способ согласно вариантам реализации 42, 43, 44, 49 и 50, в котором антагонист PD-1 выбран из группы, состоящей из ANA011, BGB-A317, KD033, пембролизумаба, MCLA-134, mDX400, MEDI0680, muDX400, ниволумаба, PDR001, PF-06801591, пидилизумаба, REGN-2810, SHR 1210, STI-A1110, TSR-042, ANB011, 244C8, 388D4, TSR042 и XCE853, и предпочтительным является Пембролизумаб, ниволумаб или Пидилизумаб.

[263] Вариант реализации 52. Способ согласно вариантам реализации 42, 43, 44, 49 и 50, в котором антагонист PD-L1 выбран из группы, состоящей из авелумаба, BMS-936559, CA-170, дурвалумаба, MCLA-145, SP142, STI-A1011, STI-A1012, STI-A1010, STI-A1014, A110, KY1003 и атезолимумаба, и предпочтительным является дурвалумаб или атезолимумаб.

[264] Вариант реализации 53. Способ согласно вариантам реализации 42, 43, 44, 49 и 50, в котором антагонист PD-L2 выбран из AMP-224 и rHIgM12B7.

[265] Вариант реализации 54. Способ согласно вариантам реализации 41 и 49, в котором антагонист CTLA4 выбран из группы, состоящей из KAHR-102, AGEN1884, ABR002, KN044, тремелимумаба и ипилимумаба, и предпочтительным является Тремелимумаб и Ипилимумаб.

[266] Вариант реализации 55. Способ согласно вариантам реализации 2, 15, 29 и 47, в котором малая молекула представляет собой ARI-3099, MIP-1231, (4-хинолиноил)-глицил-2-цианопирролидин, -(2-(1-нафтоиламино)ацетил)пирролин-2-карбонитрил, (2S)-1-((2S)-2-(2-метоксибензоиламино)-3-метилпентаноил)пирролидин-2-карбонитрил, Ac-Gly-бороPro, GEH200200, UAMC-1110, UAMC00132, 1G244, PTX-1200, UAMC00071, (2S)-2-амино-4-(4-((4-хлорфенил)(фенил)метил)пеперазин-1-ил)-1-(5-фторизоиндолин-2-ил)бутан-1,4-дион бис-(2,2,2-трифторацетат); (2S)-2-амино-4-(4-((4- хлорфенил)(фенил)метил)пеперазин-1-ил)-1-(изоиндолин-2-ил)бутан-1,4-дион бис(2,2,2- трифторацетат); (S)-2-амино-4-((S)-4-(бис(4-фторфенил)метил)-3-метилпиперазин-1-ил)-1-(изоиндолин-2-ил)бутан-1,4-дион бис(2,2,2-трифторацетат); (2S)-2-амино-4-((3R)-4-((3-фторфенил)(4-фторфенил)-метил)-3-метилпиперазин-1-ил)-1-(изоиндолин-2-ил)бутан-1,4-дион бис(2,2,2-трифторацетат), пептид SUMO1 EIL.

Предложенные комбинации согласно настоящему изобретению:

[267] В одном из вариантов реализации селективный ингибитор дипептидилпептидазы (например, талабостат) применяют в комбинации с ингибитором иммунной контрольной точки (например, антагонистом PD-1 или антагонистом PD-L1, или антагонистом PD-L2, или антагонистом CTLA4) для лечения солидной опухоли или рака.

[268] В одном из вариантов реализации селективный ингибитор дипептидилпептидазы (например, талабостат) применяют в комбинации с ингибитором иммунной контрольной точки (например, антагонистом PD-1 или антагонистом PD-L1, или антагонистом PD-L2, или антагонистом CTLA4) для лечения гематологического рака.

[269] В одном из вариантов реализации селективный ингибитор дипептидилпептидазы (например, талабостат) применяют в комбинации с Ниволумабом, пембролизумабом, Авелумабом или Ипилимумабом для лечения солидной опухоли или гематологического рака.

[270] В одном из вариантов реализации талабостат применяют в комбинации с ингибитором иммунной контрольной точки (например, антагонистом PD-1 или антагонистом PD-L1, или антагонистом PD-L2, или антагонистом CTLA4) для лечения солидной опухоли или гематологического рака.

[271] В одном из вариантов реализации селективный ингибитор дипептидилпептидазы (например, талабостат) применяют в комбинации с ингибитором иммунной контрольной точки (например, антагонистом PD-1 или антагонистом PD-L1, или антагонистом PD-L2, или антагонистом CTLA4) для лечения солидной опухоли (такой как рак поджелудочной железы, рак толстой и прямой кишки, рак яичников, рак легкого, рак молочной железы, глиобластома, рак желудка, астроглиальные, нейроэктодермальные опухоли, рак головы и шеи, трижды отрицательный рак молочной железы, гастроэзофагеальный рак, немелкоклеточный рак легкого) или гематологического рака (лейкоза, лимфомы, лимфоцитарного лейкоза, неходжкинской лимфомы, лимфомы Ходжкина, анапластической крупноклеточной лимфомы, миелоидного лейкоза, множественной миеломы, острого лимфобластного лейкоза, хронического миелоидного лейкоза, острого миелоидного лейкоза).

[272] В одном из вариантов реализации талабостат применяют в комбинации с ингибитором иммунной контрольной точки (например, ниволумабом, иембролизумабом, атезолизумабом, авелумабом или ипилимумабом) для лечения солидной опухоли (такой как рак поджелудочной железы, рак толстой и прямой кишки, рак яичников, рак легкого, рак молочной железы, глиобластома, рак желудка, астроглиальные, нейроэктодермальные опухоли, рак головы и шеи, трижды отрицательный рак молочной железы, гастроэзофагеальный рак, немелкоклеточный рак легкого) или гематологического рака (лейкоза, лимфомы, лимфоцитарного лейкоза, неходжкинской лимфомы, лимфомы Ходжкина, анапластической крупноклеточной лимфомы, миелоидного лейкоза, множественной миеломы, острого лимфобластного лейкоза, хронического миелоидного лейкоза, острого миелоидного лейкоза).

[273] В одном из вариантов реализации талабостат применяют в комбинации с одним или более ингибиторами иммунных контрольных точек (например, ниволумабом, пембролизумабом, атезолизумабом, авелумабом или ипилимумабом) для лечения меланомы, немелкоклеточного рака легкого, рака почки, болезни Ходжкина, неоперабельной или метастатической меланомы, рака желудка, рака пищевода, урогенитального рака, печеночно-клеточной карциномы, глиобластомы, рака головы и шеи, мелкоклеточного рака легкого, рака молочной железы, рака толстой и прямой кишки или множественной миеломы.

[274] В одном из вариантов реализации один из: ниволумаба, пембролизумаба, атезолизумаба, авелумаба или ипилимумаба применяют в комбинации с талабостатом для лечения опухоли или рака, или нарушения, описанного в настоящем документе.

Примеры:

Пример 1:

Материалы и способы

Животные

[275] В исследованиях использовали самок мышей C57/BL6 в возрасте от шести до семи недель. Мыши получали питание и воду без ограничения. Протокол исследования, процедуры, в которые вовлечен уход за животными и их использование, были рассмотрены и одобрены Институциональным комитетом по содержанию и использованию животных (IACUC) для обеспечения соблюдения правил Ассоциации по оценке и аккредитации условий содержания лабораторных животных (AAALAC).

Реагенты и антитела

[276] Среду DMEM (кат №: 11960-044), Глутамакс (кат №: 35050061), трипсин-EDTA (0,25%) (кат №: 25200-056), Пенициллин-Стрептомицин (кат №: 15070-063), HBSS (кат №: 14175-095) приобретали у Gibco, тогда как фетальную бычью сыворотку (FBS), кат №: 004-001-1A, приобретали у Biological Industries. Антагонист PD1 (кат №: BE0146) поставлял BioXcell в количестве 2 мг/мл. Исходные растворы анти-PD-1, 2 мг/мл, выдерживали при 4°С перед применением. Растворы анти-PD-1 для введения получали свежеприготовленными перед каждым введением в стерильном фосфатном буферном растворе (pH 7,0) и выдерживали при 4°C. Тестируемый препарат талабостат был предоставлен Aptuit Ltd., и его получали свежеприготовленным в исходной концентрации 100 мкг/мл перед каждым введением в стерильном фосфатном буферном растворе (pH 7,0), и выдерживали при 4°С. Набор для анализа Luminex: MCYTOMAG-70K-32 коммерчески доступен от Millipore.

Модель опухоли

[277] Линия клеток рака толстой кишки MC38 мыши была предоставлена GenScript. Клетки опухоли выдерживали в виде монослойной культуры в DMEM с добавлением 10% фетальной бычьей сыворотки (FBS), 1% глутамакса и 1% пенициллина-стрептомицина при 37°C в атмосфере с 5% CO2. Клетки рутинно субкультивировали каждые 2 дня для поддержания экспоненциальной фазы роста. Клетки опухоли, растущие в экспоненциальной фазе роста, собирали путем трипсинизации с последующим центрифугированием в центрифуге с центробежным ускорением (RCF) 335xg. Затем надосадочную жидкость удаляли путем аспирации. Осадок клеток ресуспендировали в приблизительно 10x объеме среды для культивирования клеток и подсчитывали. Суспензию клеток снова центрифугировали и обрабатывали, как указано выше, и, наконец, ресуспендировали в HBSS-/- с плотностью 1×107 клеток на мл. Путем окрашивания трипановым синим определяли, что жизнеспособность клеток составляла ≥95%. Суспензии клеток имплантировали в подкожное пространство в боку самок мышей C57/BL6 (2,0×106 клеток MC-38 в 0,2 мл сбалансированного солевого раствора Хенкса). Мышей инокулировали подкожно в нижнюю часть правого бока (около дорсальной области бедра) одним объемом 0,1 мл суспензии клеток, содержащим примерно 1×106 клеток.

Размер опухоли и массу тела измеряли два раза в неделю.

[278] Размер опухоли измеряли два раза в неделю в 2 измерениях с применением штангенциркуля (фиксировали до одной десятой). Объем опухоли, выраженный в мм3, рассчитывали с использованием следующей формулы, в которой «a» и «b» представляли собой длинный и короткий диаметры опухоли соответственно.

V (мм3) = (a × b2)/2

[279] Тарзальную толщину, выраженную в мм, измеряли штангенциркулем в соответствии с ростом опухоли в указанный период времени. Определи массу тела животных и рандомизировали их в группы лечения, когда средний размер опухоли составлял примерно 120 мм3 в 0 день.

Статистический анализ

[280] Данные, относящиеся к объему опухоли, массе опухоли и массе тела, представляли в виде среднего значения и стандартной ошибки среднего (SEM). Статистический анализ проводили с использованием t-критерия Стьюдента. P<0,05 считали статистически значимым. ★ и ★★ обозначают P<0,05 и P<0,01 соответственно.

[281] Конечную точку - ответ опухоли выражали в виде замедления роста опухоли (значение T-C), рассчитываемого как разница во времени (дни) между получавшими лечение (T) и контрольными (C) группами до достижения опухолью предварительно определенного целевого размера. Отсрочивание достижения целевого размера группами, получавшими лечение, больше времени удвоения объема опухоли в >1 раз, считали активным результатом. Терапевтическую синергию определяли как противоопухолевое действие, при котором комбинация агентов демонстрировала значительное превосходство (р < 0,05) по сравнению с активностью, демонстрируемой каждым агентом отдельно.

[282] Противоопухолевое действие введения однократной дозы (каждый день), а также два раза в сутки (bid) для талабостата отдельно и в комбинации с антагонистом PD-1 в различных режимах дозирования оценивали у мышей, несущих опухоль МС-38 (толстой кишки мыши). После развития опухолей мышей распределяли в различные группы со средним объемом опухоли ~ 200 мм3. Тестируемый препарат и антитело вводили в соответствии с режимами дозирования, описанными в таблицах 5 и 6.

[283] Также анализировали иммуномодулирующее действие введения однократной дозы (каждый день), а также два раза в сутки (bid) для талабостата отдельно и в комбинации с антагонистом PD-1 в различных режимах дозирования. Для этого собирали 100 мкл крови в соответствующие периоды времени после первого введения доз в соответствии с исследованием. Образцы крови собирали для получения сыворотки и хранили при -80°C до проведения анализа. В случае первого исследования анализировали IL-2, IL-6 и G-CSF в 1, 2, 4 и 6 группах, тогда как для второго исследования оценивали уровни G-CSF, GM-CSF, IL-2, IL-6, IL-7, IL-12 (p40), IL-15. В обоих случаях использовали анализ Luminex. Данные нормализовали.

[284] Таблица 5: Исследование 1, группы лечения и режим дозирования

[285] Таблица 6: Исследование 2, группы лечения и режим дозирования

[286] Таблица 7: влияние талабостата в качестве единственного агента и в комбинации с антагонистом PD-1 на подавление карциномы толстой кишки мыши

T = талабостат; PD1 = антагонист PD-1 Примечание: средний (±SEM) объем опухоли (см3), измеренный в 13 день

[287] Таблица 8: сравнение дозы QD с дозой BID талабостата в присутствии или отсутствии антагониста PD-1 в отношении подавления карциномы толстой кишки мыши

T = талабостат; PD1 = анти-PD1 Примечание: средний (±SEM) объем опухоли (см3), измеренный в 11 день

Biw = два раза в неделю, п/о = перорально, и/п = интраперитонеально; BID = два раза в сутки, QD = каждый день, cc = кубический сантиметр

[288] Результаты: в первом исследовании (как представлено в таблице 5) мышей лечили талабостатом, 10 мкг или 20 мкг два раза в сутки, вводимым либо отдельно, либо в комбинации с 5 и 10 мг/кг антагониста PD-1. Животных рандомизировали по группам лечения, когда средний размер опухоли составлял примерно 175 мм3 в 0 день. Мышам делали два раза в неделю инъекцию антагониста PD-1 или носителя. Два раза в сутки вводили физиологический раствор в качестве контроля или талабостат посредством желудочного зонда. Мышей контрольной группы, получавшей носитель, подвергали эвтаназии в 13 день после введения доз из-за размера опухоли более 2000 мм3. В 8-13 дни комбинированная терапия талабостатом и антагонистом PD-1 демонстрировала значительное уменьшение объема опухоли по сравнению с введением одного агента для любого из указанных двух агентов. Более того, группы лечения одним талабостатом и антагонистом PD-1 также демонстрировали значительно больший эффект по сравнению с контрольной группой, получавшей носитель (фиг. 1 и таблица 7). Доза талабостата 20 мкг два раза в сутки в комбинации с антагонистом PD-1 демонстрировала плохую переносимость с ранней смертью нескольких получавших лечение животных.

[289] Во втором эксперименте (как представлено в таблице 6) мышей лечили талабостатом в дозе 2,5, 5 и 10 мкг два раза в сутки или 20 мкг каждый день, вводимым либо отдельно, либо в комбинации с 5 мг/кг антагониста PD-1. Животных рандомизировали по группам лечения, когда средний размер опухоли составлял примерно 120 мм3 в 0 день. Мышам делали два раза в неделю инъекцию антагониста PD-1 или носителя. Два раза в сутки или каждый день вводили физиологический раствор в качестве контроля или талабостат посредством желудочного зонда. Мышей контрольной группы, получавшей носитель, подвергали эвтаназии в 11 день после введения доз из-за размера опухоли более 3000 мм3. Начиная с 8 дня комбинированная терапия талабостатом 5 и 10 мкг два раза в сутки и 20 мкг каждый день и антагонистом PD-1 демонстрировала значительно больший эффект по сравнению с соответствующей группой, получавшей лечение одним талабостатом и одним антагонистом PD-1. Важно отметить, что дозы 10 мкг два раза в сутки и 20 мкг каждый день в комбинации с антагонистом PD-1 демонстрировали эквивалентную эффективность с точки зрения уменьшения объема опухоли (фиг. 2 и таблица 8).

[290] Более того, иммуномодуляция, обеспечиваемая талабостатом, демонстрировала синергетический эффект при комбинировании с антагонистом PD-1, наблюдаемый в повышающей регуляции провоспалительных цитокинов, включая IL-2, IL-6, IL-12p40, а также в профилях хемокинов, которые уменьшают иммуносупрессивное микроокружение, включая GM-CSF и G-CSF. У мышей, несущих опухоль, талабостат, вводимый в дозе 20 мкг каждый день в комбинации с антагонистом PD-1 в указанных условиях, демонстрировал синергетический эффект в отношении высвобождения GM-CSF, IL-2 и IL-12p40 в 11 день после лечения, тогда как IL-6 и G-CSF демонстрировали значительное увеличение при указанной комбинации через 4 часа после лечения. Более того, указанная комбинация также демонстрировала синергию в выработке IL-15 и IL-7, которые содержат общую гамма-цепь в своих рецепторах. Как установлено в литературе, присутствие IL-15 и IL-7 в иммунной среде уменьшает гликолиз при одновременном усилении окислительного фосфорилирования в активированных CD8+ Т-клетках, что сдвигает фенотип Т-клеток в сторону клеток памяти, а не эффекторных Т-клеток. Это указывает на то, что указанная комбинация обладает действием по вызову ответа Т-клеток памяти (фиг. 3А-3G).

VIII. Определения:

[291] Термин «субъект» включает любой организм, предпочтительно животное, более предпочтительно млекопитающее (например, крысу, мышь, собаку, кошку, кролика) и наиболее предпочтительно человека.

[292] В настоящем описании термин «рак» может быть взаимозаменяемым с термином «опухоль». Термин «рак» относится к раку широкого спектра типов, включая как солидные опухоли, так и несолидные опухоли, такие как лейкоз и лимфома. Карциномы, саркомы, миеломы, лимфомы и лейкоз все можно лечить с применением настоящего изобретения, включая раковые опухоли смешанного типа.

[293] Термины «примерно» и «приблизительно» в целом означают приемлемый уровень ошибки для измеренного количества с учетом характера или точности измерений. Типичные уровни ошибки находятся в пределах 20 процентов (%), как правило, в пределах 10% и чаще в пределах 5% от конкретного значения или диапазона значений.

[294] Термин «лечение» в контексте настоящего изобретения означает облегчение симптомов, связанных с нарушением или заболеванием, или прекращение дальнейшего прогрессирования или ухудшения этих симптомов, или предотвращение или профилактику указанного заболевания или нарушения. Например, в контексте лечения пациентов применительно к селективному ингибитору дипептидилпептидазы и ингибитору иммунной контрольной точки успешное лечение может включать уменьшение адгезии и фиксации опухоли; облегчение симптомов, связанных с раковой опухолью или опухолью, или пролиферацией ткани, пораженной заболеванием; прекращение прогрессирования заболевания, такого как рак, или роста раковых клеток. Лечение может также включать введение фармацевтических составов селективного ингибитора дипептидилпептидазы в комбинации с ингибитором иммунной контрольной точки. Их можно вводить до, во время или после оперативного вмешательства и/или радиотерапии. Согласно настоящему изобретению селективный ингибитор дипептидилпептидазы и ингибитор иммунной контрольной точки можно совместно вводить субъекту, представляющему собой человека, и суточная доза, как правило, будет определена лечащим врачом, при этом доза, как правило, варьируется в зависимости от возраста, массы тела и ответа отдельного пациента, а также тяжести симптомов пациента. При введении элементов, описанных в настоящем документе, формы единственного числа и термин «указанный» означают, что присутствует один или более указанных элементов.

[295] В настоящем описании термин «эффективное количество» может быть взаимозаменяемым с термином «терапевтически эффективная доза» или «терапевтически эффективное количество», и он относится к количеству, достаточному для оказания желаемого эффекта.

[296] В настоящем описании термин «фармацевтически приемлемый носитель» относится к среде-носителю, которая не нарушает эффективности биологической активности активных ингредиентов и которая не токсична для пациента или субъекта. В настоящем описании термин «носитель» может быть взаимозаменяемым с термином «адъювант».

[297] Согласно настоящему изобретению термин «фармацевтическая композиция» относится к композициям, которые могут быть получены любым традиционным способом с использованием одного или более фармацевтически приемлемых носителей или адъювантов.

[298] В настоящем описании термин «антитело» понимается в широком смысле и включает молекулы иммуноглобулина, включая поликлональные антитела, моноклональные антитела, включая антитела мыши, человека, антитела, адаптированные к человеку, гуманизированные и химерные синтетические, рекомбинантные, гибридные, мутированные, искусственно сконструированные, привитые антитела, фрагменты антител, моноспецифические, биспецифические или полиспецифические антитела, димерные, тетрамерные или мультимерные антитела, нанотела, одноцепочечные антитела и конъюгат антитело-лекарственное средство. Антитела также включают рекомбинантное моноклональное антитело. В настоящем описании, если не указано иное, термин «фрагмент антитела» или «антигенсвязывающий фрагмент» относится к антигенсвязывающим фрагментам антител, т.е. фрагментам антител, сохраняющим способность специфично связываться с антигеном, связываемым полноразмерным антителом, например, фрагментам, сохраняющим одну или более CDR-областей. Примеры связывающих фрагментов антител включают, но не ограничиваются ими, Fab, F(ab')2, Fv, scFv, bi-scFv, bi-Ab, Fd, dAb и другие фрагменты антител, которые сохраняют антигенсвязывающую функцию, т.е. способность специфично связывать FAP или DPP; диатела; линейные антитела; одноцепочечные молекулы антител, например sc-Fv; нанотела и полиспецифические антитела, образованные из фрагментов антител.

[299] Нанотело (Nb) представляет собой наименьший функциональный фрагмент или один вариабельный домен (VHH) встречающегося в природе одноцепочечного антитела и известен специалисту в данной области техники. Их получают из антител, содержащих только тяжелую цепь, которые наблюдаются у верблюдовых (Hamers-Casterman et al. 1993; Desmyter et al. 1996). В семействе «верблюдовых» обнаружены иммуноглобулины, не содержащие легких полипептидных цепей. «Верблюдовые» включают верблюдовых Старого света (Camelus bactrianus и Camelus dromedarius) и верблюдовых Нового света (например, Lama paccos, Lama glama, Lama guanicoe и Lama vicugna). В настоящем описании указанное антитело с тяжелой цепью с одним вариабельным доменом называется нанотелом или VHH-антителом. Нанотело™, Нанотела™ и Наноклон™ являются товарными знаками Ablynx NV (Бельгия).

[300] В настоящем описании термин «синергия» в целом относится к достижению комбинированного эффекта, который больше суммы двух отдельных эффектов. В настоящем описании термины «терапевтическая синергия» и «синергетический эффект (действие)» в контексте терапии относятся к явлению, при котором лечение пациентов комбинацией терапевтических агентов (например, селективным ингибитором дипептидилпептидазы в комбинации с антагонистом PD-1 или антагонистом PD-L1, или антагонистом CTLA4) демонстрирует терапевтически лучший исход по сравнению с исходом, достигаемым каждым отдельным компонентом указанной комбинации, применяемым в оптимальной дозе (см., например, T. H. Corbett et al., 1982, Cancer Treatment Reports, 66, 1187). В данном контексте терапевтически лучшим исходом является тот, при котором пациенты либо а) демонстрируют меньшее число случаев нежелательных явлений при получении полезного терапевтического эффекта, равного или больше эффекта в случае, когда каждый отдельный компонент комбинации вводят в виде монотерапии в той же дозе, что и в комбинации, либо b) не демонстрируют дозолимитирующей токсичности при получении полезного терапевтического эффекта, равного или больше эффекта лечения каждым отдельным компонентом комбинации, когда каждый компонент вводят в тех же дозах в комбинации (комбинациях), что и при введении в виде отдельных компонентов, либо с) оба в случае комбинации оказывают усиленные эффекты по сравнению с тем, когда их вводят отдельно, например, увеличение высвобождения IL-2. В моделях ксенотрансплантатов комбинация, применяемая в максимально переносимой дозе, в которой каждый из компонентов будет присутствовать в дозе, как правило, не превышающей его индивидуальную максимально переносимую дозу, демонстрирует терапевтическую синергию, когда уменьшение роста опухоли, достигаемое путем введения указанной комбинации, больше значения уменьшения роста опухоли в случае лучшего компонента, когда указанный компонент вводят отдельно.

1. Способ усиления иммунного ответа у субъекта, страдающего раком, включающий введение указанному субъекту эффективного количества талабостата или его фармацевтически приемлемой соли в комбинации с антителом против PD-1.

2. Способ по п. 1, дополнительно включающий введение антитела против CTLA4.

3. Способ по п. 2, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

4. Способ по п. 3, где антитело против CTLA4 представляет собой тремелимумаб.

5. Способ по п. 3, где антитело против CTLA4 представляет собой ипилимумаб.

6. Способ по п. 1, где антитело против PD-1 выбрано из группы, состоящей из пембролизумаба, ниволумаба, BGB-A317, MEDI0680, PDR001, PF-06801591, REGN-2810 и TSR-042.

7. Способ по п. 6, где антитело против PD-1 представляет собой пембролизумаб.

8. Способ по п. 6, где антитело против PD-1 представляет собой ниволумаб.

9. Способ по п. 6, где антитело против PD-1 представляет собой MEDI0680.

10. Способ по любому из пп. 1-9, где у субъекта диагностирована гематологическая злокачественная опухоль.

11. Способ по любому из пп. 1-9, где у субъекта диагностирована солидная опухоль.

12. Способ по любому из пп. 1-9, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

13. Способ по любому из пп. 1-12, где антитело против PD-1 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

14. Способ по любому из пп. 1-12, где антитело против PD-1 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

15. Способ по любому из пп. 1-12, где антитело против PD-1 вводят в дозе от 1 мг/кг до 10 мг/кг.

16. Способ по любому из пп. 2-12, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

17. Способ по любому из пп. 2-12, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

18. Способ по любому из пп. 2-12, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 1 мг/кг до 10 мг/кг.

19. Способ по любому из пп. 1-18, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

20. Способ по любому из пп. 1-18, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

21. Способ по любому из пп. 1-18, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

22. Способ по любому из пп. 1-21, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1.

23. Способ по любому из пп. 2-22, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1 и антителом против CTLA4.

24. Способ по любому из пп. 1-23, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

25. Способ лечения, замедления или предотвращения метастазирования опухоли у субъекта, страдающего раком, включающий введение указанному субъекту эффективного количества талабостата или его фармацевтически приемлемой соли в комбинации с антителом против PD-1, где рак имеет повышенные уровни одного или более из DPP8, DPP9, FAP, CTLA4, PD-1 и PD-L1.

26. Способ по п. 25, дополнительно включающий введение антитела против CTLA4.

27. Способ по п. 26, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

28. Способ по п. 27, где антитело против CTLA4 представляет собой тремелимумаб.

29. Способ по п. 27, где антитело против CTLA4 представляет собой ипилимумаб.

30. Способ по п. 25, где антитело против PD-1 выбрано из группы, состоящей из пембролизумаба, ниволумаба, BGB-A317, MEDI0680, PDR001, PF-06801591, REGN-2810 и TSR-042.

31. Способ по п. 30, где антитело против PD-1 представляет собой пембролизумаб.

32. Способ по п. 30, где антитело против PD-1 представляет собой ниволумаб.

33. Способ по п. 30, где антитело против PD-1 представляет собой MEDI0680.

34. Способ по любому из пп. 25-33, где у субъекта диагностирована гематологическая злокачественная опухоль.

35. Способ по любому из пп. 25-33, где у субъекта диагностирована солидная опухоль.

36. Способ по любому из пп. 25-33, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

37. Способ по любому из пп. 25-36, где антитело против PD-1 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

38. Способ по любому из пп. 25-36, где антитело против PD-1 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

39. Способ по любому из пп. 25-36, где антитело против PD-1 вводят в дозе от 1 мг/кг до 10 мг/кг.

40. Способ по любому из пп. 26-36, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

41. Способ по любому из пп. 26-36, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

42. Способ по любому из пп. 26-36, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 1 мг/кг до 10 мг/кг.

43. Способ по любому из пп. 25-42, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

44. Способ по любому из пп. 25-42, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

45. Способ по любому из пп. 25-42, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

46. Способ по любому из пп. 25-45, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1.

47. Способ по любому из пп. 26-46, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1 и антителом против CTLA4.

48. Способ по любому из пп. 25-47, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

49. Способ усиления выработки провоспалительных цитокинов у человека, страдающего раком, включающий введение человеку, страдающему раком, терапевтически эффективных количеств (i) талабостата или его фармацевтически приемлемой соли и (ii) антитела против PD-1, при этом указанная комбинация талабостата или его фармацевтически приемлемой соли и антитела против PD-1 обеспечивает синергетическое увеличение выработки провоспалительных цитокинов.

50. Способ по п. 49, дополнительно включающий введение антитела против CTLA4.

51. Способ по п. 50, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

52. Способ по п. 51, где антитело против CTLA4 представляет собой тремелимумаб.

53. Способ по п. 51, где антитело против CTLA4 представляет собой ипилимумаб.

54. Способ по п. 49, где антитело против PD-1 выбрано из группы, состоящей из пембролизумаба, ниволумаба, BGB-A317, MEDI0680, PDR001, PF-06801591, REGN-2810 и TSR-042.

55. Способ по п. 54, где антитело против PD-1 представляет собой пембролизумаб.

56. Способ по п. 54, где антитело против PD-1 представляет собой ниволумаб.

57. Способ по п. 54, где антитело против PD-1 представляет собой MEDI0680.

58. Способ по любому из пп. 49-57, где у субъекта диагностирована гематологическая злокачественная опухоль.

59. Способ по любому из пп. 49-57, где у субъекта диагностирована солидная опухоль.

60. Способ по любому из пп. 49-57, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

61. Способ по любому из пп. 49-60, где антитело против PD-1 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

62. Способ по любому из пп. 49-60, где антитело против PD-1 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

63. Способ по любому из пп. 49-60, где антитело против PD-1 вводят в дозе от 1 мг/кг до 10 мг/кг.

64. Способ по любому из пп. 50-60, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

65. Способ по любому из пп. 50-60, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

66. Способ по любому из пп. 50-60, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 1 мг/кг до 10 мг/кг.

67. Способ по любому из пп. 49-66, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

68. Способ по любому из пп. 49-66, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

69. Способ по любому из пп. 49-66, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

70. Способ по любому из пп. 49-69, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1.

71. Способ по любому из пп. 50-70, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1 и антителом против CTLA4.

72. Способ по любому из пп. 49-71, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

73. Способ индуцирования апоптоза в опухоли, включающий введение человеку, страдающему раком, терапевтически эффективных количеств (i) талабостата или его фармацевтически приемлемой соли и (ii) антитела против PD-1, при этом указанная комбинация талабостата или его фармацевтически приемлемой соли и антитела против PD-1 обеспечивает синергетическое увеличение апоптоза.

74. Способ по п. 73, дополнительно включающий введение антитела против CTLA4.

75. Способ по п. 74, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

76. Способ по п. 75, где антитело против CTLA4 представляет собой тремелимумаб.

77. Способ по п. 75, где антитело против CTLA4 представляет собой ипилимумаб.

78. Способ по п. 73, где антитело против PD-1 выбрано из группы, состоящей из пембролизумаба, ниволумаба, BGB-A317, MEDI0680, PDR001, PF-06801591, REGN-2810 и TSR-042.

79. Способ по п. 78, где антитело против PD-1 представляет собой пембролизумаб.

80. Способ по п. 78, где антитело против PD-1 представляет собой ниволумаб.

81. Способ по п. 78, где антитело против PD-1 представляет собой MEDI0680.

82. Способ по любому из пп. 73-81, где у субъекта диагностирована гематологическая злокачественная опухоль.

83. Способ по любому из пп. 73-81, где у субъекта диагностирована солидная опухоль.

84. Способ по любому из пп. 73-81, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

85. Способ по любому из пп. 73-84, где антитело против PD-1 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

86. Способ по любому из пп. 73-84, где антитело против PD-1 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

87. Способ по любому из пп. 73-84, где антитело против PD-1 вводят в дозе от 1 мг/кг до 10 мг/кг.

88. Способ по любому из пп. 74-84, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

89. Способ по любому из пп. 74-84, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

90. Способ по любому из пп. 74-84, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 1 мг/кг до 10 мг/кг.

91. Способ по любому из пп. 73-90, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

92. Способ по любому из пп. 73-90, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

93. Способ по любому из пп. 73-90, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

94. Способ по любому из пп. 73-93, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1.

95. Способ по любому из пп. 74-94, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1 и антителом против CTLA4.

96. Способ по любому из пп. 73-95, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

97. Способ лечения пролиферативных заболеваний, включающий введение нуждающемуся в этом субъекту синергетически, терапевтически эффективного количества талабостата или его фармацевтически приемлемой соли в комбинации с антителом против PD-1.

98. Способ по п. 97, дополнительно включающий введение антитела против CTLA4.

99. Способ по п. 98, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

100. Способ по п. 99, где антитело против CTLA4 представляет собой тремелимумаб.

101. Способ по п. 99, где антитело против CTLA4 представляет собой ипилимумаб.

102. Способ по п. 97, где антитело против PD-1 выбрано из группы, состоящей из пембролизумаба, ниволумаба, BGB-A317, MEDI0680, PDR001, PF-06801591, REGN-2810 и TSR-042.

103. Способ по п. 102, где антитело против PD-1 представляет собой пембролизумаб.

104. Способ по п. 102, где антитело против PD-1 представляет собой ниволумаб.

105. Способ по п. 102, где антитело против PD-1 представляет собой MEDI0680.

106. Способ по любому из пп. 97-105, где у субъекта диагностирована гематологическая злокачественная опухоль.

107. Способ по любому из пп. 97-105, где у субъекта диагностирована солидная опухоль.

108. Способ по любому из пп. 97-105, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

109. Способ по любому из пп. 97-108, где антитело против PD-1 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

110. Способ по любому из пп. 97-108, где антитело против PD-1 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

111. Способ по любому из пп. 97-108, где антитело против PD-1 вводят в дозе от 1 мг/кг до 10 мг/кг.

112. Способ по любому из пп. 98-108, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,01 мг/кг до 30 мг/кг.

113. Способ по любому из пп. 98-108, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 0,1 мг/кг до 20 мг/кг.

114. Способ по любому из пп. 98-108, где антитело против PD-1 и антитело против CTLA4 вводят в дозе от 1 мг/кг до 10 мг/кг.

115. Способ по любому из пп. 97-114, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

116. Способ по любому из пп. 97-114, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

117. Способ по любому из пп. 97-114, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

118. Способ по любому из пп. 97-117, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1.

119. Способ по любому из пп. 98-118, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против PD-1 и антителом против CTLA4.

120. Способ по любому из пп. 97-119, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

121. Способ усиления иммунного ответа у субъекта, страдающего раком, включающий введение указанному субъекту эффективного количества талабостата или его фармацевтически приемлемой соли в комбинации с антителом против CTLA4.

122. Способ по п. 121, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

123. Способ по п. 122, где антитело против CTLA4 представляет собой тремелимумаб.

124. Способ по п. 122, где антитело против CTLA4 представляет собой ипилимумаб.

125. Способ по любому из пп. 121-124, где у субъекта диагностирована гематологическая злокачественная опухоль.

126. Способ по любому из пп. 121-124, где у субъекта диагностирована солидная опухоль.

127. Способ по любому из пп. 121-124, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

128. Способ по любому из пп. 121-127, где антитело против CTLA4 вводится в дозе от 0,01 мг/кг до 30 мг/кг.

129. Способ по любому из пп. 121-127, где антитело против CTLA4 вводится в дозе от 0,1 мг/кг до 20 мг/кг.

130. Способ по любому из пп. 121-127, где антитело против CTLA4 вводится в дозе от 1 мг/кг до 10 мг/кг.

131. Способ по любому из пп. 121-130, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

132. Способ по любому из пп. 121-130, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

133. Способ по любому из пп. 121-130, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

134. Способ по любому из пп. 121-133, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против CTLA4.

135. Способ по любому из пп. 121-134, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

136. Способ лечения, замедления или предотвращения метастазирования опухоли у субъекта, страдающего раком, включающий введение указанному субъекту эффективного количества талабостата или его фармацевтически приемлемой соли в комбинации с антителом против CTLA4, где рак имеет повышенные уровни одного или более из DPP8, DPP9, FAP или CTLA4.

137. Способ по п. 136, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

138. Способ по п. 137, где антитело против CTLA4 представляет собой тремелимумаб.

139. Способ по п. 137, где антитело против CTLA4 представляет собой ипилимумаб.

140. Способ по любому из пп. 136-139, где у субъекта диагностирована гематологическая злокачественная опухоль.

141. Способ по любому из пп. 136-139, где у субъекта диагностирована солидная опухоль.

142. Способ по любому из пп. 136-139, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

143. Способ по любому из пп. 136-142, где антитело против CTLA4 вводится в дозе от 0,01 мг/кг до 30 мг/кг.

144. Способ по любому из пп. 136-142, где антитело против CTLA4 вводится в дозе от 0,1 мг/кг до 20 мг/кг.

145. Способ по любому из пп. 136-142, где антитело против CTLA4 вводится в дозе от 1 мг/кг до 10 мг/кг.

146. Способ по любому из пп. 136-145, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

147. Способ по любому из пп. 136-145, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

148. Способ по любому из пп. 136-145, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

149. Способ по любому из пп. 136-148, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против CTLA4.

150. Способ по любому из пп. 136-149, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

151. Способ усиления выработки провоспалительных цитокинов у человека, страдающего раком, включающий введение человеку, страдающему раком, терапевтически эффективных количеств (i) талабостата или его фармацевтически приемлемой соли и (ii) антитела против CTLA4, при этом указанная комбинация талабостата или его фармацевтически приемлемой соли и антитела против CTLA4 обеспечивает синергетическое увеличение выработки провоспалительных цитокинов.

152. Способ по п. 151, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

153. Способ по п. 152, где антитело против CTLA4 представляет собой тремелимумаб.

154. Способ по п. 152, где антитело против CTLA4 представляет собой ипилимумаб.

155. Способ по любому из пп. 151-154, где у субъекта диагностирована гематологическая злокачественная опухоль.

156. Способ по любому из пп. 151-154, где у субъекта диагностирована солидная опухоль.

157. Способ по любому из пп. 151-154, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

158. Способ по любому из пп. 151-157, где антитело против CTLA4 вводится в дозе от 0,01 мг/кг до 30 мг/кг.

159. Способ по любому из пп. 151-157, где антитело против CTLA4 вводится в дозе от 0,1 мг/кг до 20 мг/кг.

160. Способ по любому из пп. 151-157, где антитело против CTLA4 вводится в дозе от 1 мг/кг до 10 мг/кг.

161. Способ по любому из пп. 151-160, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

162. Способ по любому из пп. 151-160, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

163. Способ по любому из пп. 151-160, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

164. Способ по любому из пп. 151-163, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против CTLA4.

165. Способ по любому из пп. 151-164, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

166. Способ индуцирования апоптоза в опухоли, включающий введение человеку, страдающему раком, терапевтически эффективных количеств (i) талабостата или его фармацевтически приемлемой соли и (ii) антитела против CTLA4, при этом указанная комбинация талабостата или его фармацевтически приемлемой соли и антитела против CTLA4 обеспечивает синергетическое увеличение апоптоза.

167. Способ по п. 166, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

168. Способ по п. 167, где антитело против CTLA4 представляет собой тремелимумаб.

169. Способ по п. 167, где антитело против CTLA4 представляет собой ипилимумаб.

170. Способ по любому из пп. 166-169, где у субъекта диагностирована гематологическая злокачественная опухоль.

171. Способ по любому из пп. 166-169, где у субъекта диагностирована солидная опухоль.

172. Способ по любому из пп. 166-169, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

173. Способ по любому из пп. 166-172, где антитело против CTLA4 вводится в дозе от 0,01 мг/кг до 30 мг/кг.

174. Способ по любому из пп. 166-172, где антитело против CTLA4 вводится в дозе от 0,1 мг/кг до 20 мг/кг.

175. Способ по любому из пп. 166-172, где антитело против CTLA4 вводится в дозе от 1 мг/кг до 10 мг/кг.

176. Способ по любому из пп. 166-175, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

177. Способ по любому из пп. 166-175, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

178. Способ по любому из пп. 166-175, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

179. Способ по любому из пп. 166-178, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против CTLA4.

180. Способ по любому из пп. 166-179, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.

181. Способ лечения пролиферативных заболеваний, включающий введение нуждающемуся в этом субъекту синергетически, терапевтически эффективного количества талабостата или его фармацевтически приемлемой соли в комбинации с антителом против CTLA4.

182. Способ по п. 181, где антитело против CTLA4 выбрано из группы, состоящей из тремелимумаба и ипилимумаба.

183. Способ по п. 182, где антитело против CTLA4 представляет собой тремелимумаб.

184. Способ по п. 182, где антитело против CTLA4 представляет собой ипилимумаб.

185. Способ по любому из пп. 181-184, где у субъекта диагностирована гематологическая злокачественная опухоль.

186. Способ по любому из пп. 181-184, где у субъекта диагностирована солидная опухоль.

187. Способ по любому из пп. 181-184, где рак выбран из группы, состоящей из рака поджелудочной железы, рака предстательной железы, рака толстой и прямой кишки, рака яичников, рака легкого, рака молочной железы, глиобластомы, рака желудка, астроглиального рака, нейроэктодермального рака, рака головы и шеи, трижды отрицательного рака молочной железы, гастроэзофагеального рака и немелкоклеточного рака легкого.

188. Способ по любому из пп. 181-187, где антитело против CTLA4 вводится в дозе от 0,01 мг/кг до 30 мг/кг.

189. Способ по любому из пп. 181-187, где антитело против CTLA4 вводится в дозе от 0,1 мг/кг до 20 мг/кг.

190. Способ по любому из пп. 181-187, где антитело против CTLA4 вводится в дозе от 1 мг/кг до 10 мг/кг.

191. Способ по любому из пп. 181-190, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 10 мг/кг.

192. Способ по любому из пп. 181-190, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 3 мг/кг.

193. Способ по любому из пп. 181-190, где талабостат или его фармацевтически приемлемую соль вводят в дозе от 0,001 мг/кг до 2 мг/кг.

194. Способ по любому из пп. 181-193, где талабостат или его фармацевтически приемлемую соль вводят одновременно, последовательно или через интервал с антителом против CTLA4.

195. Способ по любому из пп. 181-194, где талабостат или его фармацевтически приемлемая соль представляет собой мезилат талабостата.



 

Похожие патенты:

Изобретение относится к фармацевтической промышленности, а именно к иммуностимулятору для усиления иммунного ответа. Иммуностимулятор для усиления иммунного ответа, индуцированного антигеном, содержащий в качестве активного ингредиента модифицированный β-глюкан, обладающий иммуностимулирующим эффектом, причем β-глюкан ковалентно связан биосовместимой полигидроксикислотой.

Изобретение относится к ветеринарии, а именно к лекарственному средству для нормализации метаболических процессов у животных. Лекарство включает янтарную кислоту бутафосфан и воду, причем компоненты берут в определенном соотношении.

Изобретение относится к области биотехнологии, иммунологии и медицины. Предложен препарат противораковой вакцины в форме ленты для применения в индукции клеточного иммунитета против рака со сверхэкспрессией гена WT1.

Предложенная группа изобретений относится к области медицины. Предложен аденовирусный вектор для стимулирования пептидоспецифичного иммунного ответа у субъекта, содержащий полипептиды, присоединенные к вирусному капсиду, выбранные из группы, состоящей из полипептидов, специфичных в отношении главного комплекса гистосовместимости класса I (MHC-I), или полипептидов, специфичных в отношении главного комплекса гистосовместимости класса II (MHC-II), которые являются опухолеспецифичными.

Группа изобретений относится к медицине и касается пептида, подходящего для индукции интерферона, содержащего аминокислотную последовательность согласно общей формуле (I) X1EKKRRETVEREX2X3 (SEQ ID No: 5), причем каждый из X1, X2 и X3 представляет собой остаток неполярной аминокислоты.

Предложенная группа изобретений относится к фармацевтической промышленности, а именно к иммуностимулирующему средству. Иммуностимулирующая композиция содержит препарат β-глюкана, экстракт женьшеня и экстракт грибов, где препарат β-глюкана получен из дрожжевого экстракта и присутствует в диапазоне от 60% до 80% от общей массы в сухом состоянии препарата β-глюкана, экстракта женьшеня и экстракта грибов в композиции, где экстракт женьшеня получен из женьшеня китайского и присутствует в диапазоне от 10% до 30% от общей массы в сухом состоянии препарата β-глюкана, экстракта женьшеня и экстракта грибов в композиции и где экстракт грибов получен из гриба рейши и присутствует в диапазоне от 1% до 20% от общей массы в сухом состоянии препарата β-глюкана, экстракта женьшеня и экстракта грибов в композиции.

Изобретение относится к полученному из HSP70 иммуногенному пептиду, который является индуктором иммунитета и может быть использован в фармацевтических композициях для лечения рака, где указанная композиция может находиться в виде вакцины.

Группа изобретений относится к медицине и может быть использована для модуляции иммунной системы. Для этого вводят иммуногенную композицию, содержащую туберкулин Коха, очищенный белковый продукт (PPD) бациллы Коха, инактивированный лизат стафилококков, инактивированный лизат стрептококков, стрептокиназу и дорназу из бета-гемолитического стрептококка, инактивированный лизат Candida, инактивированный лизат дерматофитов, инактивированный лизат энтеропатогенной Escherichia coli, инактивированный лизат сальмонеллы.

Изобретение относится к области медицины и биологии и представляет собой новое средство, обладающее апоптоз-ингибирующей (антиапоптотической) активностью. Средство может быть использовано для коррекции состояний, связанных с повышением уровня апоптоза клеток (окислительный стресс, ишемические повреждения), а также в качестве ингибитора апоптоза в культурах клеток in vitro.

Изобретение относится к фармацевтической промышленности и представляет собой композицию для применения в качестве поддерживающей терапии при противоопухолевых химиотерапевтических лечениях, где указанная композиция содержит эффективное количество бактериального штамма Lactobacillus pentosus LPS01 с номером депонирования DSM 21980, депонированного Probiotical SpA 14.11.2008.

Изобретение относится к области биотехнологии и молекулярной биологии. Предложен аденовирусный геном для защиты аденовируса от нейтрализующих антител, отличающийся тем, что он содержит последовательность, кодирующую альбумин-связывающий участок, вставленную в кодирующую область гипервариабельного участка 1 (HVR1) гексонного белка, что приводит к экспрессии слитого белка, содержащего гексонный белок и альбумин-связывающий участок, и где альбумин-связывающий участок располагается на наружной поверхности гексонного белка, когда сборка гексонного белка имеет место в аденовирусном капсиде.
Изобретение относится к медицине, а именно к онкологии, и может быть использовано для паллиативного лечения рецидивов плоскоклеточного рака головы и шеи. Для этого предварительно выделяют целевой сосуд, кровоснабжающий опухоль, и определяют объемную скорость кровотока в нём.

Изобретение относится к области биотехнологии, конкретно к химерным антигенным рецепторам, нацеленным на CD123 (CD123CAR), и может быть использовано в медицине для лечения острого миелоидного лейкоза (AML).

Изобретение относится к органической химии и касается новой кристаллической модификации 1-[(3R)-3-[4-амино-3-(4-феноксифенил)-1Н-пиразоло[3,4-d]пиримидин-1-ил]-1-пиперидил]-2-пропенил-1-она (ибрутиниб - международное непатентованное название).

Изобретение относится к области биотехнологии, конкретно к рекомбинантным полипептидам для нацеливания на выделяющийся фосфатидилсерин. Описан полипептид для нацеливания на выделяющийся фосфатидилсерин, который включает: (a) домен гамма-карбоксиглутаминовой кислоты белка S, содержащий последовательность, представленную в SEQ ID NO: 1, или последовательность по меньшей мере на 95% гомологичную ей, и не содержащий домен протеазы или гормонсвязывающий домен; и (b) белок S домена EGF, где указанный полипептид конъюгирован с полезным грузом, выбранным из детектируемой метки, белковой последовательности, полиэтиленгликоля, целлюлозы, белка альбумина и терапевтического агента.

Изобретение относится к области биотехнологии, конкретно к противораковым пептидным агентам на основе фрагмента эндостатина, и может быть использовано в медицине в терапии рака предстательной железы.

Изобретение относится к новым солевым формам соединения формулы 2 или его гидрату или сольвату. Соединения обладают свойствами селективного ингибирования по меньшей мере одного мутанта рецептора эпидермального фактора роста (EGFR) по сравнению с EGFR дикого типа (EGFR ДТ).

Изобретение относится к средству, обладающему цитотоксической активностью, общей формулы (1), в которой R выбран из следующей группы 1-бензилпирролидин-3-ил; 2-метоксикарбонил-5-фенилпирролидин-4-ил; 2-метоксикарбонил-5-(2-(трифторметил)фенил)пирролидин-4-ил; 2-метоксикарбонил-5-(2-бромфенил)пирролидин-4-ил; 1-акрилоил-2-метоксикарбонил-5-фенилпирролидин-4-ил; 1-(5-(метоксикарбонил)-2-фенилпирролидин-3-карбонил)-2-метоксикарбонил-5-фенилпирролидин-4-ил; 1-(1-акрилоил-5-(метоксикарбонил)-2-фенилпирролидин-3-карбонил)-2-метоксикарбонил-5-фенилпирролидин-4-ил; винил.

Изобретение относится к новому соединению формулы (2) и его вариантам, которые являются антагонистами рецептора FLT3 и могут быть использованы для лечения болевых расстройств.

Изобретение относится к области биохимии, в частности к моноклональному антителу, которое специфически связывается с вспомогательным белком рецептора человеческого интерлейкина-1 (IL1RAP).

Изобретение относится к электроспиннинговым волокнам, содержащим: i) первый и второй гидрофильные волокнообразующие полимеры, который является растворимым в гидрофильном растворителе, ii) биоадгезивное вещество, которое является малорастворимым в указанном гидрофильном растворителе, iv) лекарственное вещество, в которых первый гидрофильный полимер имеет растворимость в воде при 37°С, что, по меньшей мере, в 10 раз превышает растворимость в воде при 37°С второго гидрофильного волокнообразующего полимера, и в которых биоадгезивное вещество присутствует в твердой форме.

Группа изобретений относится к области иммуноонкологии, в частности к способам лечения рака, усиления иммунного ответа у субъекта, страдающего раком, а также лечения, замедления или предотвращения метастазирования опухоли у субъекта, страдающего раком. Для этого вводят эффективное количество талабостата или его фармацевтически приемлемой соли в комбинации с антителом против PD-1. Также раскрыты способы лечения рака, усиления иммунного ответа у субъекта, страдающего раком, а также лечения, замедления или предотвращения метастазирования опухоли у субъекта, страдающего раком. Для этого вводят эффективное количество талабостата или его фармацевтически приемлемой соли в комбинации с антителом против CTLA4. Группа изобретений обеспечивает синергетический эффект при комбинировании талабостата с антителом против PD-1. 10 н. и 185 з.п. ф-лы, 9 ил., 8 табл., 1 пр.

Наверх