Фармацевтическая композиция, содержащая плазминоген, и ее применение

Группа изобретений относится к области медицины, а именно к жидкой фармацевтической композиции, содержащей Glu-плазминоген или биологически активный мутантный полипептид Glu-плазминогена, обладающий по меньшей мере 80% идентичностью аминокислотной последовательности с нативным полипептидом Glu-плазминогена в концентрации от 0,01 мг/мл до 80 мг/мл; модификатор тоничности, который представляет собой хлорид натрия, в концентрации от 30 мМ до 100 мМ, позволяющей достичь осмоляльности композиции от 180 мОсм до 350 мОсм; и стабилизатор, который представляет собой аргинин или глицин, в концентрации от 10 мМ до 100 мМ; и при этом значение pH композиции составляет от 5,0 до 8,0, также относится к применению фармацевтической композиции. Группа изобретений обеспечивает получение фармацевтической композиции Glu-плазминогена с улучшенной стабильностью. 2 н. и 19 з.п. ф-лы, 22 ил., 17 табл., 13 пр.

 

ОБЛАСТЬ ТЕХНИКИ

[001] Данное изобретение относится к области медицины. Более конкретно, изобретение относится к фармацевтической композиции, содержащей плазминоген, и ее терапевтическому применению.

УРОВЕНЬ ТЕХНИКИ

[002] Плазминоген представляет собой зимоген плазмина, как проиллюстрировано на Фиг. 1А. Аминокислотная последовательность прекурсора плазминогена человека изображена на Фиг. 1B. Плазминоген человека содержит 791 аминокислоту (прекурсор = 810 аминокислот) с молекулярной массой около 90 кДа и pI около 7,0, хотя дифференциальное гликозилирование и/или удаление N-концевого активационного пептида может давать диапазон pI от 6,2 до 8,0. Он представляет собой одноцепочечный белок с 24 внутрицепочечными дисульфидными мостиками, 5 крингл-доменами (вовлеченными в связывание с фибрином и ингибитором альфа 2-антиплазмина), домен серинпротеазы (P) и активационный пептид (АР), состоящий из первых 77 аминокислот. Присутствует один N-связанный сайт гликозилирования и один O-связанный сайт, хотя второй О-связанный сайт уже идентифицирован (Goldberg 2006). Приблизительно 70 % плазминогена в кровотоке содержит только O-связанное гликозилирование, тогда как остальные содержат N- и O-связанные сахара.

[003] Нативный плазминоген получен в двух основных формах, Glu-плазминоген (Glu-Pg) и Lys-плазминоген (Lys-Pg), названных по N-концевой аминокислоте, которая представляет собой глутаминовую кислоту или лизин. Glu-Pg содержит полную аминокислотную последовательность, обозначенную как генная

последовательность (за исключением активационного пептида), тогда как Lys-Pg является результатом расщепления Glu-Pg между Lys-77 и Lys78 (подчеркнуты на Фиг. 1B). Период полувыведения Lys-Pg значительно короче, чем Glu-Pg (2-2,5 дня для Glu-Pg, 0,8 дней для Lys-Pg). Glu-Pg является доминантной формой Pg, присутствующей в плазме, с очень небольшим количеством Lys-Pg, обнаруженного в кровотоке (Violand, B.N., Byrne, R., Castellino F.J. (1978) The effect of α-,ω-Amino Acids on Human Plasminogen Structure and Activation. J Biol Chem. 253 (15): 5395-5401; Collen D, Ong EB, Johnson AJ. (1975) Human Plasminogen: In Vitro and In Vivo Evidence for the Biological Integrity of NH2-Terminal Glutamic Acid Plasminogen. Thrombosis Research. 7 (4):515-529)).

[004] Плазминоген синтезируется в печени и секретируется в плазму. Плазминоген распределяется по всему организму, и, если присутствуют условия для активации, профермент плазминогена превращается в активный фермент, плазмин, под действием активатора плазминогена тканевого типа (t-РА) или урокиназного активатора плазминогена (u-РА). Далее плазмин расщепляет фибрин и превращает латентные матричные металлопротеиназы (pro-MMP) в активные ММР, которые, в свою очередь, разрушают внеклеточный матрикс (ВКМ), что является частью процесса ремоделирования/заживления ткани. Активация плазминогена, опосредованная t-РА, в первую очередь вовлечена в гомеостаз фибрина, тогда как генерация плазмина с помощью u-РА, в ходе которой образуется комплекс с его рецептором u-PAR, принимает участие в ремоделировании ткани.

[005] Плазмин исследуют или исследовали на предмет его потенциального применения с целью клиренса тромботических окклюзий в искусственных устройствах и трансплантатах для гемодиализа и для лечения заднего отслоения стекловидного тела (PVD) (US 6969515; US 2010/0104551).

[006] Плазминоген исследуется для применения при таких терапевтических показаниях, как заживление ран, заживление перфорации барабанной перепонки, заживление раны периодонта, инфекционное заболевание, оздоровление полости

рта, диабетические язвы, показания для тромболиза, такие как коронарный тромбоз, реперфузионное поражение ткани, ишемия, инфаркт, отек мозга, улучшение микроциркуляции и модуляция пути активации комплемента (US 8637010; US 8679482; US 8318661; WO 95/12407; EP 0631786). До этого времени плазминоген еще не был выведен на рынок как фармацевтический препарат.

[007] Исторически, Lys-Pg присутствовал на фармацевтическом рынке для гематологических целей на протяжении определенного периода времени, но не применялся в научной или медицинской области, с 2000 года. Состав Lys-Pg описан в Schott et al., 1998, The New England Journal of Medicine, Vol. 339, No. 23, pp. 1679-1686. Хотя доступный Lys-Pg исследовали в клинике для лечения деревянистых конъюнктивитов, клинического проявления базового состояния гипоплазминогенемии (дефицит плазминогена типа I). Следовательно, Kraft et al испытывали системное введение концентратов Lys-Pg (Kraft, J, Lieb W, Zeitler P, Schuster V (2000)) при деревянистом конъюнктивите у девочки с тяжелым дефицитом плазминогена типа I. В Graefes Arch Clin Exp Ophthalmol. 238(9): 797-800 сообщалось, что ежедневная инфузия Lys-Pg ребенку с тяжелой гипоплазминогенемией приводила к частичному лизису конъюнктивальной псевдомембраны. Schott et al. (1998) сообщали, что у ребенка 6-месячного возраста лечение препаратом Lys-Pg в виде непрерывной инфузии и позже в виде ежедневной инъекции болюса приводило к полной регрессии деревянистого конъюнктивита в пределах 4 недель и нормализации гипервязкого секрета дыхательных путей, а также заживлению кожной раны. Schuster et al (Schuster V, Hugle B, Tefs K (2007) Plasminogen deficiency. J Thromb Haemost 5(12):2315-2322) сообщали, что уровни плазминогена у пациентов с гомозиготной или гетерозиготной (наличие двух разных мутантных аллелей в определенном генном локусе, по одной на каждой из пары хромосом) гипоплазминогенемией составляли от < 1 до 9 мг/дл для уровней в плазме антигена плазминогена и от < 1 % до 51 % для функциональной активности плазминогена Важно отметить, что у большинства таких пациентов присутствуют определенные остаточные уровни активности плазминогена. Таким образом, ожидается, что замещение плазминогена будет эффективным,

поскольку он является эндогенным белком и не будет вызывать проблем с иммуногенностью или фибринолитической активностью. Хотя концентраты плазминогена для системного или местного применения были явно описаны как эффективная терапия, которая приводит к устранению и предупреждает повторное поражение (Watts P, Suresh P, Mezer E, Ells A, Albisetti M, Bajzar L, Marzinotto V, Andrew M, Massicotle P, Rootman D (2002) Effective treatment of ligneous conjunctivitis with topical plasminogen. Am J Ophthalmol 133(4):451-455, Heidemann DG, Williams GA, Hartzer M, Ohanian A, Citron ME (2003) Treatment of ligneous conjunctivitis with topical plasmin and topical plasminogen. Cornea 22(8):760-762; and Schott, 1998), на рынке отсутствует очищенный продукт плазминогена для местной или системной терапии.

[008] Только совсем недавно были проведены клинические испытания применения Glu-Pg для лечения дефицита плазминогена типа I (идентификатор Clinical Trials.gov: NCT02312180) и одного из его клинических проявлений - деревянистого конъюнктивита - с применением местных глазных капель Glu-Pg (идентификатор ClinicalTrials.gov: NCT01554956).

[009] Белки могут быть стабилизированы путем изменения их структурных характеристик (внутренне) и/или путем управления компонентами, которые находятся в контакте с ними (извне). Хранение некоторых белков в фармацевтических препаратах является проблематичным из-за их физико-химических характеристик, что, к сожалению, часто приводит к структурной нестабильности. Они, например, могут подвергаться различным видам деградации, примерами которых являются следующие: 1) химические процессы, приводящие к образованию родственных примесей, которые могут включать реакции гидролиза, окисления, дезамидирования или структурные перестройки, такие как изо-asp или внутримолекулярные укорачивания, либо 2) физический процесс, приводящий к агрегации/полимеризации, создавая структурные изменения, которые могут повлиять на биологическую активность и потенциально усилить иммуногенность.

[0010] Разработка рецептуры обычно предусматривает процесс, в ходе которого активный фармацевтический ингредиент (АФИ) характеризуют в достаточной степени для того, чтобы он мог быть преобразован в фармацевтически приемлемую субстанцию лекарственного средства. Необходимо исследование биофизических характеристик лекарственных веществ для подтверждения наличия правильно свернутой и биологически активной структуры. Для изучения третичной структуры белков в растворе и для оценки стабильности и влияния различных условий составления на структуру белка может быть применено несколько спектроскопических способов (флуоресценция, КД, ДСК, ДРС и т.д.) (Volkin, D.B. et al. “Preformulation studies as an essential guide to formulation development and manufacture of protein pharmaceutical.” Development and manufacture of protein pharmaceuticals. Edited by Steve L. Nail and Michael J. Akers, Kluwer Academic 2002 Chapter 1, page 1-39; Cheng, W. et al. “Comparison of High-Throughput Biophysical Methods to Identify Stabilizing Excipients for a Model IgG2 Monoclonal Antibody: Conformational Stability and Kinetic Aggregation Measurements” Journal of Pharmaceutical Sciences, Vol. 101, No 5, page 1701-1720, 2012). Кроме того, в фармацевтической промышленности структурная целостность АФИ часто подтверждается путем проведения биологического анализа высвобождения лекарственного вещества. Взятые вместе, они подтверждают, что предпочтительный состав не был неумышленно модифицирован в процессе составления. Плазминоген представляет собой белок, который главным образом применяется для получения плазмина при показаниях для тромболиза, таких как коронарный тромбоз, клиренс тромботических окклюзий в искусственных устройствах и трансплантатах для гемодиализа, при реперфузионном поражении ткани, для лечения ишемии, инфаркта, отека мозга или для улучшения микроциркуляции (WO 95/12407; US 6969515; EP 0631786).

[0011] Введение плазминогена также может быть полезным при многих терапевтических показаниях, таких как показания для тромболиза, такие как коронарный тромбоз, лечение реперфузийного поражения ткани, лечение ишемии, инфаркта, отека мозга или для улучшения микроциркуляции, заживления ран, заживления перфорации барабанной перепонки, заживления

раны периодонта, инфекционные заболевания, оздоровление полости рта, диабетические язвы, лечение субъектов с дефицитом плазминогена и модуляция пути активации комплемента (WO 95/12407; EP 0631786; US 8637010; US 8679482; US 8318661).

[0012] Существует несколько проблем, которые встречаются при введении плазминогена в составы. Некоторые проблемы являются результатом загрязнения состава плазминогена плазмином, который расщепляет плазминоген. Для предотвращения деградации плазминогена применялись различные подходы, в том числе добавление апротинина, лизина, фенилметансульфонилфторида, соевого ингибитора трипсина или ингибитора серинпротеазы (US 4177262; US 4361653, US 5304383).

[0013] Другие трудности представлены мутностью или присутствием нитчатых веществ при солюбилизации плазминогена в водном растворителе. Для преодоления этого недостатка было предложено комбинировать плазминоген, например, с неионным поверхностно-активным веществом или смесью сахарозы, аминокислот и альбумина (WO 94/15631).

[0014] Не существует известного промышленного состава Glu-Pg для терапевтического применения у человека. Единственными известными составами Glu-Pg являются составы для исследований.

[0015] Таким образом, технический результат заявленного изобретения заключается в разработке фармацевтической композиции Glu-плазминогена с улучшенной стабильностью.

[0016] В данном документе присутствуют ссылки на несколько других документов, содержание которых включено в настоящий документ путем ссылки в полном объеме.

КОРОТКОЕ ОПИСАНИЕ СУТИ ИЗОБРЕТЕНИЯ

[0017] Настоящее изобретение касается фармацевтической композиции, содержащей плазминоген, и ее применения.

[0018] Настоящее изобретение касается следующих пунктов 1-61:

[0019] 1. Фармацевтическая композиция, содержащая:

[0020] - плазминоген или его биологически активный вариант;

[0021] - модификатор осмотического давления; и

[0022] - стабилизатор;

[0023] причем рН композиции составляет от около 3,0 до около 10,0.

[0024] 2. Фармацевтическая композиция по п. 1, отличающаяся тем, что ее значение рН составляет от 5,0 до 8,0; или от 6,0 до 8,0; или от 6,5 до 7,5.

[0025] 3. Фармацевтическая композиция по п. 1, отличающаяся тем, что концентрация плазминогена или его биологически активного варианта составляет от около 0,01 мг/мл до около 80 мг/мл или от около 5 мг/мл до около 60 мг/мл.

[0026] 4. Фармацевтическая композиция по п. 3, отличающаяся тем, что концентрация плазминогена или его биологически активного варианта составляет около 40, 30, 20, 10 или 5 мг/мл.

[0027] 5. Фармацевтическая композиция в соответствии с любым из пп. 1-4, отличающаяся тем, что плазминоген или его биологически активный вариант составляет, по меньшей мере, 80 % от общего содержания белка в композиции или более 90 % от общего содержания белка в композиции.

[0028] 6. Фармацевтическая композиция по п. 5, отличающаяся тем, что содержание плазминогена или его биологически активного варианта составляет более чем 95 или 98 % от общего содержания белка в композиции.

[0029] 7. Фармацевтическая композиция по любому из пп. 1-6, отличающаяся тем, что стабилизатор содержит (i) аминокислоту, (ii) соль аминокислоты, (iii) аналог аминокислоты или (iv) любую смесь (i), (ii) и/или (iii).

[0030] 8. Фармацевтическая композиция по п. 7, отличающаяся тем, что аминокислота, соль аминокислоты или аналог аминокислоты представляет собой аргинин, пролин, глутаминовую кислоту, аспарагиновую кислоту, глицин, аланин, цистеин, лизин, аналог лизина или эпсилон-аминокапроновую кислоту.

[0031] 9. Фармацевтическая композиция по п. 8, отличающаяся тем, что стабилизатор является аргинином.

[0032] 10. Фармацевтическая композиция по любому из пп. 1-9, отличающаяся тем, что стабилизатор присутствует в концентрации от около 20 мМ до около 200 мМ.

[0033] 11. Фармацевтическая композиция по п. 10, отличающаяся тем, что стабилизатор присутствует в концентрации от около 25 мМ до около 75 мМ.

[0034] 12. Фармацевтическая композиция по любому из пп. 1-11, отличающаяся тем, что модификатор осмотического давления представляет собой хлорид натрия, хлорид кальция, хлорид магния, сахарозу, трегалозу, сорбит, маннит, глицерин, лактозу, сорбит, декстрозу, циклодекстрин, раффинозу, полиэтиленгликоль, гидроксиэтилкрахмал, глицин, глутаминовую кислоту, аланин, декстран, ПВП (поливинилпирролидон) или любую их комбинацию.

[0035] 13. Фармацевтическая композиция по п. 12, отличающаяся тем, что модификатор осмотического давления является хлоридом натрия.

[0036] 14. Фармацевтическая композиция по любому из пп. 1-13, отличающаяся тем, что модификатор осмотического давления присутствует в концентрации от около 30 мМ до около 250 мМ.

[0037] 15. Фармацевтическая композиция по п. 14, отличающаяся тем, что модификатор осмотического давления присутствует в концентрации от около 25 мМ до около 50 мМ или в концентрации около 35 мМ.

[0038] 16. Фармацевтическая композиция по любому из пп. 1-15, дополнительно содержащая наполнитель.

[0039] 17. Фармацевтическая композиция по п. 16, отличающаяся тем, что наполнитель представляет собой глицин, глутаминовую кислоту, аланин, маннит, сорбит, гидроксиэтилкрахмал, декстран, ПВП (поливинилпирролидон), маннит, полиэтиленгликоль, сорбит, мальтит, лактит, мальтотриитол, ксилит или любую их комбинацию.

[0040] 18. Фармацевтическая композиция по п. 17, отличающаяся тем, что наполнитель является маннитом или сорбитом.

[0041] 19. Фармацевтическая композиция по любому из пп. 16-18, отличающаяся тем, что наполнитель присутствует в концентрации от около 50 мМ до около 300 мМ.

[0042] 20. Фармацевтическая композиция по п. 19, отличающаяся тем, что наполнитель присутствует в концентрации от около 50 до около 125 мМ.

[0043] 21. Фармацевтическая композиция по любому из пп. 1-20, дополнительно содержащая восстанавливающий сахар.

[0044] 22. Фармацевтическая композиция по п. 21, отличающаяся тем, что восстанавливающий сахар представляет собой фруктозу, маннозу, мальтозу, лактозу, арабинозу, ксилозу, рибозу, рамнозу, галактозу, глюкозу, сахарозу или любую их комбинацию.

[0045] 23. Фармацевтическая композиция по любому из пп. 1-22, дополнительно содержащая невосстанавливающий сахар.

[0046] 24. Фармацевтическая композиция по п. 23, отличающаяся тем, что невосстанавливающий сахар представляет собой сахарозу, трегалозу, сорбозу, мелецитозу, раффинозу или любую их комбинацию.

[0047] 25. Фармацевтическая композиция по любому из пп. 1-24, отличающаяся тем, что осмоляльность фармацевтической композиции составляет от около 180 мОсм до около 350 мОсм.

[0048] 26. Фармацевтическая композиция по любому из пп. 1-25, дополнительно содержащая консервант.

[0049] 27. Фармацевтическая композиция по п. 26, отличающаяся тем, что консервант представляет собой м-крезол, бензиловый спирт, метанол, этанол, изопропанол, бутилпарабен, этилпарабен, метилпарабен, фенол, глицерин, ксилит, резорцин, катехол, 2,6-диметилциклогексанол, 2-метил-2,4-пентадиол, декстран, поливинилпирролидон, 2-хлорфенол, бензэтония хлорид, мертиолят (тимеросал), бензойную кислоту (пропилпарабен) М.м. 180,2, бензойную кислоту М.м. 122,12, бензалкония хлорид, хлорбутанол, бензоат натрия, пропионат натрия, цетилпиридиния хлорид или любую их комбинацию.

[0050] 28. Фармацевтическая композиция по п. 26 или п. 27, отличающаяся тем, что концентрация консерванта составляет от около 0,005 до около 10 % масс./об.

[0051] 29. Фармацевтическая композиция по любому из пп. 1-28, отличающаяся тем, что указанный плазминоген или его биологически активный вариант является плазминогеном человека.

[0052] 30. Фармацевтическая композиция по любому из пп. 1-29, отличающаяся тем, что указанный плазминоген или его биологически активный вариант более чем на около 80 % состоит из Glu-плазминогена.

[0053] 31. Фармацевтическая композиция по любому из пп. 1-29, отличающаяся тем, что указанный плазминоген или его биологически активный вариант является Glu-плазминогеном.

[0054] 32. Фармацевтическая композиция по любому из пп. 1-31, отличающаяся тем, что в композиции количество частиц размером 10 мкм или более составляет менее чем 6000 частиц на 100 мл.

[0055] 33. Фармацевтическая композиция по п. 32, отличающаяся тем, что количество частиц составляет менее чем 2000 или 1000 частиц на 100 мл.

[0056] 34. Фармацевтическая композиция по любому из пп. 1-33, пригодная для внутривенного, подкожного, местного, внутрикожного, офтальмологического и/или внутримышечного введения.

[0057] 35. Фармацевтическая композиция по любому из пп. 1-34, которая представляет собой жидкую композицию, пригодную для лиофилизации жидкую композицию, пригодную для замораживания жидкую композицию, лиофилизированную композицию, замороженную композицию или разведенную композицию.

[0058] 36. Фармацевтическая композиция по любому из пп. 1-34, которая представляет собой жидкость, гель, крем или мазь.

[0059] 37. Фармацевтическая композиция по любому из пп. 1-36 для применения в качестве лекарственного средства.

[0060] 38. Фармацевтическая композиция, содержащая плазминоген или его биологически активный вариант, в которой количество частиц размером 10 мкм или более составляет менее чем 6000 частиц на 100 мл.

[0061] 39. Фармацевтическая композиция по п. 38, отличающаяся тем, что количество частиц составляет менее чем 2000 или 1000 частиц на 100 мл.

[0062] 40. Фармацевтическая композиция по п. 38 или п. 39, дополнительно содержащая стабилизатор.

[0063] 41. Фармацевтическая композиция по п. 40, отличающаяся тем, что стабилизатор содержит (i) аминокислоту, (ii) соль аминокислоты, (iii) аналог аминокислоты или (iv) любую смесь (i), (ii) и/или (iii).

[0064] 42. Фармацевтическая композиция по п. 41, отличающаяся тем, что аминокислота, соль аминокислоты или аналог аминокислоты представляет собой аргинин, пролин, глутаминовую кислоту, аспарагиновую кислоту, глицин, аланин, цистеин, лизин, аналог лизина или эпсилон-аминокапроновую кислоту.

[0065] 43. Фармацевтическая композиция по п. 42, отличающаяся тем, что стабилизатор является аргинином.

[0066] 44. Фармацевтическая композиция по любому из пп. 40-43, отличающаяся тем, что стабилизатор присутствует в концентрации от около 25 мМ до около 75 мМ.

[0067] 45. Фармацевтическая композиция по любому из пп. 38-44, отличающаяся тем, что концентрация плазминогена или его биологически активного варианта составляет от около 0,01 мг/мл до около 80 мг/мл.

[0068] 46. Фармацевтическая композиция по п. 45, отличающаяся тем, что концентрация плазминогена или его биологически активного варианта составляет от около 5 мг/мл до около 60 мг/мл.

[0069] 47. Фармацевтическая композиция по любому из пп. 38-46, отличающаяся тем, что содержание плазминогена или его биологически активного варианта составляет более чем около 95 % от общего содержания белка в композиции или более чем 98 % от общего содержания белка в композиции.

[0070] 48. Фармацевтическая композиция по любому из пп. 38-47, которая дополнительно содержит модификатор осмотического давления.

[0071] 49. Фармацевтическая композиция по п. 48, отличающаяся тем, что модификатор осмотического давления представляет собой хлорид натрия, хлорид кальция, хлорид магния, сахарозу, трегалозу, сорбит, маннит, глицерин,

лактозу, сорбит, декстрозу, раффинозу, полиэтиленгликоль, гидроксиэтилкрахмал, глицин, глутаминовую кислоту, аланин, декстран, ПВП (поливинилпирролидон) или любую их комбинацию.

[0072] 50. Фармацевтическая композиция по п. 49, отличающаяся тем, что модификатор осмотического давления является хлоридом натрия.

[0073] 51. Фармацевтическая композиция по п. 48, п. 49 или п. 50, отличающаяся тем, что модификатор осмотического давления присутствует в концентрации от около 30 мМ до около 250 мМ.

[0074] 52. Фармацевтическая композиция по любому из пп. 38-51, которая дополнительно содержит наполнитель.

[0075] 53. Фармацевтическая композиция по п. 52, отличающаяся тем, что наполнитель представляет собой глицин, глутаминовую кислоту, аланин, маннит, сорбит, гидроксиэтилкрахмал, декстран, ПВП (поливинилпирролидон), маннит, полиэтиленгликоль, сорбит, мальтит, лактит, мальтотриитол, ксилит или любую их комбинацию.

[0076] 54. Фармацевтическая композиция по п. 53, отличающаяся тем, что наполнитель является маннитом или сорбитом.

[0077] 55. Фармацевтическая композиция по п. 52, п. 53 или п. 54, отличающаяся тем, что наполнитель присутствует в концентрации от около 50 мМ до около 300 мМ.

[0078] 56. Фармацевтическая композиция по любому из пп. 38-55, отличающаяся тем, что осмоляльность фармацевтической композиции составляет от около 180 мОсм до около 350 мОсм.

[0079] 57. Фармацевтическая композиция по любому из пп. 38-61, отличающаяся тем, что значение рН фармацевтической композиции составляет от около 6,5 до около 8,0.

[0080] 58. Фармацевтическая композиция по любому из пп. 38-57, отличающаяся тем, что указанный плазминоген или его биологически активный вариант является плазминогеном человека.

[0081] 59. Фармацевтическая композиция по любому из пп. 38-58, отличающаяся тем, что указанный плазминоген или его биологически активный вариант более чем на 80 % состоит из Glu-плазминогена.

[0082] 60. Фармацевтическая композиция по любому из пп. 38-58, отличающаяся тем, что указанный плазминоген или его биологически активный вариант является Glu-плазминогеном.

[0083] 61. Фармацевтическая композиция по любому из пп. 38-60 для применения в качестве лекарственного средства.

[0084] Другие аспекты изобретения будут очевидными для специалиста в данной области техники из следующего описания, формулы изобретения и обобщения в настоящем документе.

КРАТКОЕ ОПИСАНИЕ ФИГУР

[0085] Фиг. 1А представляет собой схематическое изображение первичной структуры плазминогена, на котором проиллюстрированы его крингл-домены, сайт расщепления плазмином и сайт связывания со стрептокиназой.

[0086] На Фиг. 1В проиллюстрированна аминокислотная последовательность прекурсора плазминогена человека. Последовательность зрелой формы приведена полужирным начертанием шрифта, а два остатка лизина, между которыми происходит расщепление с образованием Lys-Pg, подчеркнуты.

[0087] Фиг. 2 представляет собой изображение флакона, содержащего плацебо (без Pg) Состава 1 после лиофилизации.

[0088] Фиг. 3 представляет собой изображение флакона, содержащего Состав 1 (описанный в Табл. 1А) после лиофилизации.

[0089] Фиг. 4 представляет собой изображение флакона, содержащего плацебо (без Pg) Состава 2 после лиофилизации.

[0090] Фиг. 5 представляет собой изображение флакона, содержащего Состав 2 (описанный в Табл. 1А) после лиофилизации.

[0091] Фиг. 6 представляет собой изображение флакона, содержащего плацебо (без Pg) Состава 3 после лиофилизации.

[0092] Фиг. 7 представляет собой изображение флакона, содержащего Состав 3 (описанный в Табл. 1А) после лиофилизации.

[0093] Фиг. 8 представляет собой изображение флакона, содержащего плацебо (без Pg) Состава 4 после лиофилизации.

[0094] Фиг. 9 представляет собой изображение флакона, содержащего Состав 4 (описанный в Табл. 1А) после лиофилизации.

[0095] Фиг. 10 представляет собой изображение флакона, содержащего плацебо (без Pg) Состава 5 после лиофилизации.

[0096] Фиг. 11 представляет собой изображение флакона, содержащего Состав 5 (описанный в Табл. 1А) после лиофилизации.

[0097] Фиг. 12 представляет собой изображение флаконов с лиофилизированной композицией № F0498, содержащей 20 мг/мл плазминогена в 10 мМ Трис-HCl, 35 мМ NaCl, pH 8,0, и 28,5 мМ аргинина (0,5 %).

[0098] Фиг. 13 представляет собой изображение флаконов с лиофилизированной композицией № F0449, содержащей 10 мг/мл плазминогена в 10 мМ растворе Na фосфата, 35 мМ NaCl, pH 7,2, 28,5 мМ аргинина (0,5 %) и 54 мМ маннита (1 %).

[0099] Фиг. 14 представляет собой изображение флаконов лиофилизированной композицией № F0459, содержащей 20 мг/мл плазминогена в 10 мМ растворе Na фосфата, 35 мМ NaCl, pH 7,2, 28,5 мМ аргинина (0,5 %) и 54 мМ маннита (1 %).

[00100] Фиг. 15 представляет собой изображение флаконов, которые содержат раствор 5 мг/мл плазминогена в воде (Образец 0), в 10 мМ натрий-цитратного буфера, рН 6,5 (Образец 1), 10 мМ натрий-фосфатного буфера, pH 7,2 (Образец 2), и 10 мМ Трис-HCl буфера pH 8,0 (Образец 3), кроме стандартов мутности 0,02, 20, 100, 800 нефелометрических единиц мутности (НЕМ), соответственно.

[00101] Фиг. 16 представляет собой изображение тех же флаконов, которые проиллюстрированы на Фиг. 12, за исключением того, что 35 мМ NaCl и 28,5 мМ (0,5 %) Arg были добавлены для Образцов 1, 2 и 3.

[00102] На Фиг. 17, 18 и 19 представлены графики, которые иллюстрируют мутность на протяжении 4 часов для композиций, содержащих 10 мг плазминогена, 35 мМ NaCl, 0,5 % глицина, аргинина, аланина и без аминокислоты, при рН 6,5 в натрий-цитратном буфере (Фиг. 17), при pH 7,2 в натрий-фосфатном буфере (Фиг. 18) и при рН 8,0 в Трис-буфере (Фиг. 19).

[00103] Фиг. 20, 21 и 22 представляют собой графики, которые иллюстрируют мутность на протяжении 4 часов для композиций, содержащих 10 мг плазминогена, 35 мМ NaCl, 0,5 % маннита и 0,5 % глицина, аргинина, аланина и без аминокислоты, при рН 6,5 в натрий-цитратном буфере (Фиг. 20), pH 7,2, в натрий-фосфатном буфере (Фиг. 21 ) и при рН 8,0 в Трис-буфере (Фиг. 22).

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

[00104] В настоящем документе описана фармацевтическая композиция, содержащая плазминоген или его биологически активный вариант.

[00105] В настоящем документе также описана фармацевтическая композиция, содержащая:

- плазминоген или его биологически активный вариант;

- модификатор осмотического давления; и

- стабилизатор;

причем значение рН композиции составляет от около 3,0 до около 10,0; предпочтительно от около 5,0 до около 8,0; более предпочтительно, от около 6,0 до около 8,0; и, еще более предпочтительно, от около 6,5 до около 7,5.

[00106] Настоящее изобретение относится к фармацевтической композиции, содержащей плазминоген или его биологически активный вариант с повышенной робастностью. Настоящее изобретение относится к фармацевтической композиции, содержащей плазминоген или его биологически активный вариант, в которой количество частиц размером 10 мкм или более составляет менее чем 6000 частиц на 100 мл композиции или менее чем 5000 частиц на 100 мл композиции или менее чем 4000 частиц на 100 мл композиции или менее чем 3000 частиц на 100 мл композиции или менее чем 2000 частиц на 100 мл композиции или менее чем 1000 частиц на 100 мл композиции. В одном варианте реализации настоящего изобретения количество частиц остается низким после лиофилизации и разведения. В одном варианте реализации данного изобретения в разведенных препаратах одной и той же композиции вариация количества частиц отсутствует.

[00107] Термин «плазминоген» в данном документе относится к любой форме нативного полипептида плазминогена (например, Glu-плазминогена или Lys-плазминогена) любого животного, например млекопитающего (например, человека). Плазминоген представляет собой профермент, который превращается в активный фермент плазмин под действием активатора плазминогена тканевого типа (t-РА) или урокиназного активатора плазминогена (u-РА). Дальше плазмин расщепляет фибрин и превращает латентные матричные металлопротеиназы (pro-MMP) в активные ММР, которые, в свою очередь, дополнительно разрушают внеклеточный матрикс (ВКМ), что является частью процесса ремоделирования/заживления ткани. Термин «биологически активный вариант» в данном документе относится к мутантному полипептиду плазминогена, сохраняющему биологическую активность нативного плазминогена, то есть возможность превращаться в полипептид плазмина (t-РА и/или u-РА), способный расщеплять фибрин и превращать латентные матричные

металлопротеиназы (pro-MMP) в активные ММР. Вариант может содержать одну или несколько аминокислотных замен, делеций/укорачиваний (N-концевых, C-концевых и/или делеций/укорачиваний внутренних аминокислот), добавлений (N-концевых, C-концевых и/или внутренних аминокислотных добавлений). Биологически активные варианты могут проявлять биологическую активность (например, ферментативную активность результирующего плазмина), которая ниже, выше или аналогична по сравнению с нативным полипептидом плазминогена. В вариантах реализации изобретения вариант обладает по меньшей мере 60, 70, 75, 80, 85, 90 или 95 % идентичностью аминокислотной последовательности с аминокислотной последовательностью нативного полипептида плазминогена. Биологически активные варианты плазминогена описаны, например, в WO2012/093132, WO2013/024074 и Wang et al. (1995, Protein Science 4, 1758-1767) и включают укороченные варианты плазминогена, обычно под названием «мидиплазминоген», «миниплазминоген», «микроплазминоген» и «дельта-плазминоген», которые лишены одного или больше крингл-доменов и/или их частей. В одном варианте реализации изобретения плазминоген является плазминогеном человека. В соответствии с еще одним вариантом реализации изобретения композиция содержит нативный плазминоген человека. Плазминоген может быть получен из нескольких источников. Он может быть получен с помощью рекомбинантного синтеза или экстрагирован из крови, плазмы или полученного из крови раствора и очищен. Плазминоген может быть добыт из крови или плазмы путем фракционирования по Cohn или осаждения. Плазминоген может быть очищен из плазмы или полученного из крови раствора путем связывания в ходе аффинной хроматографии, как в способе, описанном в WO 2006/120423, или получен рекомбинантным путем.

[00108] В одном варианте реализации изобретения плазминоген или его биологически активный вариант присутствует в концентрации от около 0,01 мг/мл до около 80 мг/мл; предпочтительно от около 1 мг/мл до около 60 мг/мл, предпочтительно от около 5 мг/мл до около 60 мг/мл; предпочтительно от около 5 мг/мл до около 40 мг/мл; предпочтительно от около 2 мг/мл до около 30 мг/мл,

более предпочтительно, от около 2 мг/мл до около 20 мг/мл, и, более предпочтительно, около 80, 70, 60, 50, 40, 30, 25, 20, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0,5, 0,1, 0,05 или 0,01 мг/мл.

[00109] В одном варианте реализации настоящего изобретения чистота плазминогена или его биологически активного варианта, содержащегося в фармацевтической композиции, составляет более чем около 80 % или более чем около 90 % или более чем около 95 % или более чем 98 %. Термин «около» обозначает вариацию значения в пределах 10 %.

[00110] рН композиции может составлять от около 3,0 до около 10,0; от около 5,0 до около 8,0; от около 6,0 до около 8,0; или от около 6,5 до около 7,5. В вариантах реализации настоящего изобретения рН композиции составляет около 3,0, 3,5, 4,0, 4,5, 5,0, 5,5, 6,0, 6,1, 6,2, 6,3, 6,4, 6,5, 6,6, 6,7, 6,8, 6,9, 7,0, 7,1, 7,2, 7,3, 7,4, 7,5, 8,0, 8,5, 9,0 или 10.0. Для поддержания такого рН композиции данная композиция предпочтительно содержит буферное вещество. Многочисленные буферные вещества могут применяться в пределах объема настоящего изобретения, включая следующие буферные вещества, в зависимости от желаемого значения рН.

[00111] В одном варианте реализации изобретения буфер содержит комбинацию двух буферных веществ; такую как цитрат/фосфат, цитрат/гистидин, ацетат/гистидин или сукцинат/гистидин. В одном варианте реализации настоящего изобретения буфер не содержит цитратного буферного вещества. В другом варианте реализации изобретения буфер является цитратным, фосфатным (K2HPO4/NaHPO4), гистидиновым или сукцинатным. В другом варианте реализации изобретения буфер является фосфатным (K2HPO4/NaHPO4), гистидиновым или сукцинатным.

[00112] В варианте реализации изобретения концентрация буфера составляет от около 10 мМ до около 50 мМ или от около 10 мМ до около 30 мМ, например, от около 2 мМ до около 10 мМ.

[00113] В данном документе термин «модификатор осмотического давления» относится к соединению, которое применяется для коррекции осмотического

давления фармацевтической композиции. В одном варианте реализации изобретения модификатор осмотического давления присутствует в количестве, которое делает композицию изотонической. В другом варианте реализации изобретения модификатор осмотического давления присутствует в количестве, которое делает композицию гипертонической или гипотонической. В одном варианте реализации изобретения модификатор осмотического давления является хлоридом натрия, хлоридом кальция, хлоридом магния, хлоридом калия, Na2SO4, ZnCl2, боратом, фармацевтически приемлемой одноосновной солью, фармацевтически приемлемой двухосновной солью, фармацевтически приемлемой трехосновной солью, фармацевтически приемлемой четырехосновной солью, сахарозой, трегалозой, сорбитом, маннитом, глицерином, лактозой, сорбитом, декстрозой, циклодекстрином, рафинозой, сахарным спиртом, полиэтиленгликолем, гидроксиэтилкрахмалом, глицином, глутаминовой кислотой, аланином, ПВП (поливинилпиролидон)декстраном или любой их комбинацией. Термин «изотонический» означает, что композиция по настоящему изобретению имеет по существу такое же осмотическое давление, как осмотическое давление крови человека. Осмотическое давление изотонических композиций обычно составляет от около 250 до около 330 мОсм. Осмотическое давление можно измерить с применением, например, осмометра, измеряющего давление пара или температуру замерзания. В одном варианте реализации изобретения фармацевтическая композиция содержит смесь двух модификаторов осмотического давления. В другом варианте реализации изобретения фармацевтическая композиция содержит смесь трех модификаторов осмотического давления. В одном варианте реализации изобретения модификатор осмотического давления является сахаром или содержит сахар или смесь сахаров. В одном варианте реализации изобретения модификатор осмотического давления является хлоридом натрия. В одном из вариантов реализации изобретения концентрация модификатора осмотического давления составляет от около 30 мМ до около 250 мМ или от около 20 мМ до около 150 мМ или от около 30 мМ до около 100 мМ. В одном варианте реализации изобретения концентрация модификатора осмотического давления составляет

около 34 мМ или около 35 мМ или около 68 мМ или около 75 мМ. В варианте реализации изобретения концентрацию модификатора осмотического давления регулируют таким образом, чтобы результирующее осмотическое давление композиции находилось в пределах необходимого диапазона.

[00114] В одном варианте реализации изобретения композиция дополнительно содержит наполнитель. В данном документе термин «наполнитель» относится к соединению/агенту, которое увеличивает объемную массу композиции. Примеры наполнителей включают, но не ограничиваясь этим, глицин, глутаминовую кислоту, аланин, маннит, гидроэтилкрахмал, декстран, ПВП (поливинилпиролидон), маннит, сорбит, полученный из олигосахарида сахарный спирт, мальтит, лактит, мальтотриитол, ксилит, полиэтиленгликоль, сахарозу, глюкозу, мальтозу, Xorbitol, NaCl или любую их комбинацию. Дополнительно, указанные агенты могут служить модификаторами осмотического давления. В вариантах реализации изобретения концентрация наполнителя составляет от около 50 мМ до около 300 мМ или от около 100 мМ до около 200 мМ или около 150 мМ или от около 50 мМ до около 150 мМ или около 108 мМ или около 54 мМ.

[00115] В одном варианте реализации настоящего изобретения модификатор осмотического давления и наполнитель присутствуют в таких концентрациях, что соотношение модификатора осмотического давления/наполнителя составляет от около 1,0 до около 15,0 (масс./масс.); от около 1,0 до около 10,0, от около 3,0 до около 10,0, от около 5,0 до около 10,0, например, около 5,0, около 8,0 или 10,0. В одном варианте реализации изобретения концентрация наполнителя регулируется на базе концентрации модификатора осмотического давления таким образом, что соотношение модификатора осмотического давления/наполнителя находится в желаемом диапазоне.

[00116] В вариантах реализации изобретения композиция дополнительно содержит один или больше дополнительных фармацевтически приемлемых

ингредиентов, таких как носители, вспомогательные вещества, разбавители, стабилизаторы, буферы и т.п.

[00117] В одном варианте реализации изобретения фармацевтическая композиция дополнительно содержит сахар, например, восстанавливающий и/или невосстанавливающий сахар. В данном документе «восстанавливающий сахар» обозначает такой, который содержит гемиацетальную группу, способную восстанавливать ионы металлов или ковалентно реагировать с лизином и другими аминогруппами в белках, а «невосстанавливающий сахар» обозначает подсластитель, не обладающий такими свойствами восстанавливающего сахара. В одном из вариантов реализации изобретения восстанавливающий сахар представляет собой фруктозу, маннозу, мальтозу, лактозу, арабинозу, ксилозу, рибозу, рамнозу, галактозу, глюкозу или любую их комбинацию. В одном варианте реализации изобретения невосстанавливающий сахар представляет собой сахарозу, трегалозу, сорбозу, мелецитозу, рафинозу или любую их комбинацию. В одном варианте реализации изобретения фармацевтическую композицию по настоящему изобретению лиофилизируют в присутствии восстанавливающего сахара. В одном варианте реализации изобретения фармацевтическую композицию по настоящему изобретению лиофилизируют в присутствии невосстанавливающего сахара.

[00118] В некоторых вариантах реализации изобретения осмотическое давление фармацевтической композиции по настоящему изобретению составляет от около 180 мОсм до около 350 мОсм или от около 250 мОсм до около 350 мОсм или от около 200 мОсм до около 300 мОсм. В некоторых вариантах реализации, например, в процессе приготовления указанной композиции для лиофилизации ее осмотическое давление может составлять более чем 350 мОсм. В таком случае раствор после разведения может иметь объем, превышающий объем композиции, для того, чтобы разбавить компоненты и снизить осмотическое давление. Кроме того, в случае, если композиция предназначена для введения небольшого объема, то осмотическое давление композиции может быть выше 350 мОсм.

[00119] В данном документе термин «стабилизатор» относится к агенту, который стабилизирует плазминоген в растворе. В одном варианте реализации изобретения стабилизатор содержит аминокислоту, соль аминокислоты, аналог аминокислоты или любую их смесь. В дополнительном варианте реализации изобретения аминокислота, соль аминокислоты, аналог аминокислоты или их смесь представляет собой аргинин, пролин, глутаминовую кислоту, аспарагиновую кислоту, глицин, аланин, цистеин, лизин, аналог лизина, такой как эпсилон-аминокапроновая кислота или любую их комбинацию В подавляющем варианте реализации изобретения указанная аминокислота может присутствовать в форме основания аминокислоты, такой как лизина гидрохлорид и аргинина гидрохлорид. В одном варианте реализации изобретения фармацевтическая композиция содержит две аминокислоты, соли аминокислот и/или аналоги аминокислот. В другом варианте реализации изобретения фармацевтическая композиция содержит три аминокислоты, соли аминокислот и/или аналоги аминокислот. В некоторых вариантах реализации изобретения концентрация аминокислоты составляет от около 10 мМ до 300 мМ, от около 20 мМ до около 200 мМ или от около 10 мМ до около 100 мМ или от около 25 мМ до около 75 мМ или около 10 мМ или около 25 мМ или около 50 мМ или около 75 мМ или около 100 мМ, около 150 мМ, около 200 мМ, около 250 мМ или около 300 мМ.

[00120] В другом варианте реализации изобретения фармацевтическая композиция по настоящему изобретению дополнительно содержит антиоксидант. В одном из вариантов реализации изобретения антиоксидант представляет собой метионин, окисленный глутатион (Glu-Cys-Gly)2 (613 кДа), аскорбиновую кислоту, N-ацетил-L-цистеин/гомоцистеин, глутатион, 6-гидрокси-2,5,7,8-тетраметилхроман-2-карбоновую кислоту (Trolox®), липоевую кислоту, натрия тиосульфат, платину, глицин-глицин-гистидин (трипептид), бутилированный гидрокситолуол (БГТ) или любую их комбинацию. В некоторых вариантах реализации изобретения концентрация антиоксиданта составляет от около 10 мМ до около 200 мМ, например, около 10 мМ, около 50 мМ, около 100 мМ, около 150 мМ или около 200 мМ.

[00121] В другом варианте реализации изобретения фармацевтическая композиция по настоящему изобретению дополнительно содержит поверхностно-активное вещество. В данном документе термин «поверхностно-активное вещество» относится к соединению/агенту, которое снижает поверхностное натяжение между жидкостью и твердым веществом при растворении в растворе. В одном варианте реализации изобретения поверхностно-активное вещество представляет собой Полисорбат® 80, Полисорбат® 20, Pluronic® F-68 или Brij® 35; полоксамеры (например, полоксамер 188 или Pluronic® F-68); Triton®; натрия додецилсульфат (НДС); натрия лаурилсульфат; натрия октилгликозид; лаурил-, миристил-, линолеил- или стеарилсульфобетаин; лаурил-, миристил-, линолеил- или стеарилсаркозин; линолеил-, миристил- или цетилбетаин; лауроамидопропил-, кокамидопропил-, линолеамидопропил-миристамидопропил, пальмидопропил- или изостеарамидопропил-бетаин (например, лауроамидопропил); миристамидопропил-, пальмидопропил- или изостеарамидопропил-диметиламин; -метил-кокоил-натрий, олеилтаурат или динатрийметил; и серия MONAQUAT™ (Mona Industries, Inc. Патерсон, Нью-Джерси), полиэтилгликоль, полипропилгликоль или сополимеры этилена и пропиленгликоля или любую их комбинацию. В варианте реализации изобретения концентрация поверхностно-активного вещества регулируется для уменьшения агрегации плазминогена, его биологически активного варианта или фрагмента и/или минимизации образования частиц в композиции и/или уменьшения адсорбции. В одном варианте реализации изобретения поверхностно-активное вещество присутствует в композиции в концентрации от около 0,001 до 1 % (масс./об.), от около 0,002 % до около 0,02 % (масс./об.) или от около 0,002 % до около 0,006 % (масс./об.). В некоторых вариантах реализации изобретения композиция содержит поверхностно-активное вещество, которое является полоксамером. В некоторых вариантах реализации изобретения композиция содержит Pluronic® F68. В конкретных вариантах реализации изобретения композиция содержит от около 0,01 % (масс./об.) до около 1 % (масс./об.) Pluronic® F68, например, около 0,1 % (масс./об.) Pluronic ® F68. В одном из вариантов реализации изобретения

композиция по существу не содержит или вообще не содержит неионного поверхностно-активного вещества, например, композиция содержит менее чем около 0,02 %, 0,01 %, 0,006 % или 0,004 % (масс./об.) неионного поверхностно-активного вещества.

[00122] В другом варианте реализации изобретения фармацевтическая композиция по настоящему изобретению дополнительно содержит полимерный стабилизатор. В одном варианте реализации изобретения полимерный стабилизатор представляет собой гепарин (от 6 до 30 кДа); полиаминокислоту (от 2 до 100 кДа), такую как поли(Glu), поли(Asp) и поли(Glu, Phe); карбоксиметилцелюллозу (10-800 сП); циклодекстрин; сульфат декстрана или любую их комбинацию. В некоторых вариантах реализации изобретения концентрация полимерного стабилизатора составляет от около 0,001 % до около 0,50 % или от около 0,001 % до около 0,25 %.

[00123] В другом варианте реализации фармацевтическая композиция по настоящему изобретению дополнительно содержит полиэтиленгликоль, например, ПЭГ 200, ПЭГ 400, ПЭГ 1000, ПЭГ 4000, ПЭГ 8000, ПЭГ 10000 или любую их комбинацию. В одном из вариантов реализации изобретения концентрация полиетиленгликоля составляет от около 0,5 % до около 10 % (масс./масс.).

[00124] В одном варианте реализации изобретения фармацевтическая композиция по настоящему изобретению дополнительно содержит консервант. В данном документе «консервант» относится к соединению/агенту, которое может быть добавлено к фармацевтической композиции для существенного уменьшения активности бактерий в ней, и, таким образом, упрощается получение, например, многодозовой фармацевтической композиции. Примеры консервантов включают м-крезол, бензиловый спирт, метанол, этанол, изопропанол, бутилпарабен, этилпарабен, метилпарабен, фенол, глицерол, ксилит, резорцин, катехол, 2,6-диметилциклогексанол, 2-метил-2,4-пентадиол, декстран, поливинилпиролидон, 2-хлорфенол, бензэтоний хлорид, мертиолят (тимерсосал), бензойную кислоту (пропилпарабен) М.м. 180,2, бензойную кислоту М.м. 122,12, бензалконий хлорид, хлорбутанол, бензоат натрия, пропионат натрия или цетилпиридиния хлорид. Консервант выбирают для совместимости с буфером и другими компонентами фармацевтической композиции (т.е., раствор является прозрачным). Например, если буфер является ацетатом натрия или фосфатом натрия, совместимые консерванты включают метанол, этанол, изопропанол, глицерин, резорцин, 2-метил-2,4-пентадиол, мертиолят

(тимерсосал), бензалкония хлорид, бензоат натрия или цетилпиридиния хлорид. Концентрация консерванта для применения в композиции по настоящему изобретению может быть определена в соответствии с решением специалистов в данной отрасли техники. В некоторых вариантах реализации изобретения концентрация консерванта составляет от около 0,005 до около 10 % (масс./об.), от около 0,1 до около 1,0 % (масс./об.) или от около 0,3 до около 0,7 % (масс./об.). В некоторых вариантах реализации изобретения концентрация консерванта составляет около 0,005, 0,1, 0,3, 0,5, 0,7 или 1,0 % (масс./об.).

[00125] В другом варианте реализации фармацевтическая композиция по настоящему изобретению не содержит консерванта.

[00126] Один или более дополнительных фармацевтически приемлемых носителей, вспомогательных веществ или стабилизаторов, таких как описаны в Remington's Pharmaceutical Sciences, 19th edition, Genarro, A. Ed. (1995), могут быть введены в данную композицию при условии, что они не оказывают значительного негативного влияния на желаемые характеристики фармацевтической композиции по изобретению. Дополнительные составляющие элементы композиции по настоящему изобретению могут включать воду, например, воду для инъекций, растительное масло, загуститель, такой как метилцеллюлоза, анти-адсорбент, увлажняющий агент, антиоксиданты, в том числе аскорбиновую кислоту и метионин, хелатирующие агенты, такие как ЭДТА; комплексы металлов (например, комплексы Zn-белок), биорасщепляемые полимеры, такие как полиэстеры, и/или солеобразующие противоионы, такие

как натрий и т.д. Приемлемые носители, наполнители или стабилизаторы присутствуют в таком количестве, что они являются нетоксичными для субъектов в применяемых дозах и концентрациях.

[00127] В одном варианте реализации изобретения общая масса твердого вещества в фармацевтической композиции по настоящему изобретению составляет от около 3,5 % до около 8 % при лиофилизации, предпочтительно от около 3,5 % до около 6 %, и, более предпочтительно, от около 3,8 % до 5,5 %. Увеличение концентрации компонентов в фармацевтической композиции по изобретению приводит к увеличению общего % твердого вещества в лиофилизированной композиции и улучшению внешнего вида осадка лиофилизированной композиции.

[00128] В одном из вариантов реализации изобретения плазминоген или его вариант представляет собой Lys- или Glu-плазминоген. В другом варианте реализации изобретения плазминоген или его вариант представляет собой Glu-плазминоген. В одном из вариантов реализации изобретения плазминоген или его вариант состоит из разных видов и/или вариантов плазминогена. Преимущественно, содержание Glu-плазминогена составляет более чем 50 % от общего содержания плазминогена или его вариантов или более чем 60 % или более чем 70 % или более чем 80 % или более чем 90 %.

[00129] Вариантом реализации настоящего изобретения является фармацевтическая композиция, содержащая плазминоген или его вариант, причем в композиции общее количество белка, не являющегося плазминогеном или его вариантом, составляет менее чем около 10 %, менее чем около 5 % или менее чем около 2 %. Вариантом реализации настоящего изобретения является фармацевтическая композиция, содержащая плазминоген или его вариант, причем композиция не содержит или практически не содержит дополнительного белка (то есть, в дополнение к плазминогену или его варианту). В одном варианте реализации настоящего изобретения композиция не содержит или практически не содержит альбумина. В одном варианте реализации настоящего

изобретения композиция не содержит или практически не содержит апротинина. В одном варианте реализации настоящего изобретения композиция не содержит или по существу не содержит ингибитора трипсина. В одном варианте реализации настоящего изобретения композиция не содержит или по существу не содержит ингибитора серинпротеазы. В одном варианте реализации настоящего изобретения композиция не содержит или практически не содержит плазмина. В одном варианте реализации настоящего изобретения композиция по существу не содержит или вообще не содержит поверхностно-активного вещества, то есть концентрация поверхностно-активного вещества составляет менее чем 0,01 мМ.

[00130] В одном варианте реализации изобретения фармацевтическая композиция, содержащая плазминоген по настоящему изобретению, является стабильной при комнатной температуре на протяжении по меньшей мере 2 часов, 24 часов, недели или месяца.

[00131] В одном варианте реализации изобретения фармацевтическая композиция, содержащая плазминоген по настоящему изобретению, является стабильной при температуре ниже 0°C на протяжении по меньшей мере 3 месяцев, на протяжении по меньшей мере 6 месяцев, на протяжении по меньшей мере 12 месяцев или на протяжении по меньшей мере 24 месяцев. Указанная температура ниже 0°C составляет около -20°C, около -30°C, около -60°C, около -70°C или около -80°C.

[00132] В некоторых вариантах реализации изобретения фармацевтическая композиция, содержащая плазминоген, является жидкой композицией, пригодной для лиофилизации жидкой композицией, пригодной для замораживания жидкой композицией, лиофилизированной композицией, замороженной композицией или разведенной композицией.

[00133] Термин «фармацевтическая композиция» обозначает композицию для фармацевтических, медицинских или терапевтических целей.

[00134] Все комбинации компонентов, описанных в настоящем документе (рН, буфер, модификатор осмотического давления, наполнитель, стабилизатор и т.д.) и их соответствующие концентрации для фармацевтической композиции по настоящему изобретению конкретно включены в настоящее изобретение. Характерные примеры фармацевтических композиций плазминогена (Pg) в соответствии с настоящим изобретением представлены в Табл. 1А.

Таблица 1А

[00135] Другие характерные примеры фармацевтических композиций в соответствии с настоящим изобретением представлены в Табл. 1В ниже для композиций, содержащих от около 0,01 мг/мл до около 80 мг/мл и предпочтительно от 5 до 60 мг/мл плазминогена или его варианта, значение рН которых составляет от 6,5 до 8,0. Во всех приведенных примерах подавляющая часть плазминогена в основном состоит из Glu-плазминогена, а общее содержание плазминогена или его варианта находится в диапазоне от 5 мг/мл до 60 мг/мл.

Таблица 1В

[00136] В одном варианте реализации изобретения фармацевтическая композиция, содержащая плазминоген по настоящему изобретению, пригодна для внутривенного, подкожного, местного, внутрикожного, офтальмологического и/или внутримышечного введения.

[00137] В соответствии с одним из вариантов реализации изобретения фармацевтическая композиция по настоящему изобретению предназначена для введения человеку. Предпочтительно фармацевтическая композиция по настоящему изобретению предназначена для внутривенного, подкожного, местного, внутримышечного или офтальмологического введения. В одном варианте реализации изобретения композиция по настоящему изобретению находится в форме жидкости, геля, крема или мази.

[00138] Плазминоген, введенный в композицию по настоящему изобретению, может быть получен из нескольких источников. Он может быть получен с помощью рекомбинантного синтеза или экстрагирован и очищен из крови, плазмы или полученного из крови раствора. Плазминоген может быть добыт из крови или плазмы путем фракционирования по Cohn или осаждения. Плазминоген может быть очищен из плазмы или полученного из крови раствора путем связывания в ходе аффинной хроматографии, например, способом, описанным в WO 2006/120423. Вариант плазминогена включает, но не

ограничиваясь этим, любые модификации аминокислотной последовательности или любое добавление к нему химической группы или любое добавление к нему аминокислоты или аминокислотной последовательности. Фрагмент плазминогена включает, но не ограничиваясь этим, любые делеции аминокислот или аминокислотной последовательности в указанном фрагменте.

[00139] В данном документе термин «около» предполагает охват + или -10 % от соответствующей величины.

[00140] Термин «субъект» включает живые организмы, которые могут получить пользу от введения плазминогена, его варианта или фрагмента. Термин «субъект» включает животных, таких как млекопитающие или птицы. Предпочтительно субъектом является млекопитающее. Более предпочтительно, субъектом является человек. Наиболее предпочтительно, субъектом является человек, который нуждается в лечении.

[00141] В данном документе «профилактика» или «предупреждение» обозначают по меньшей мере снижения вероятности риска (или восприимчивости к) приобретения заболевания или расстройства (то есть, то, что препятствует по меньшей мере развитию одного из клинических симптомов заболевания у пациента, который может быть склонным или является склонным к заболеванию, но который еще не испытывает или у которого не проявляются симптомы заболевания). Биологические и физиологические параметры для идентификации таких пациентов приведены в данном описании, а также хорошо известны врачам.

[00142] Термины «лечение» или «лечить» пациента включают применение или введение композиции по изобретению субъекту (либо нанесение или введение композиции по изобретению в ткань или орган субъекта) с целью замедления, стабилизации, излечения, исцеления, облегчения, ослабления, модификации, устранения, уменьшения тяжести ухудшения, облегчения, улучшения или влияния на заболевание или состояние, симптом заболевания или состояния либо риск (или восприимчивость к) заболевания или состояния.

Термин «лечение» относится к любому обозначению успеха лечения или облегчения повреждения, патологии или состояния, в частности, какого-либо объективного или субъективного параметра, такого как облегчение; ремиссия; уменьшение скорости ухудшения; уменьшение тяжести заболевания; стабилизация, уменьшение симптомов или образования поражения, патологии или состояния, более приемлемого для субъекта, замедление скорости дегенерации или снижения функции; уменьшение инвалидизации в конечной точке дегенерации; или улучшение физического или психического состояния субъекта. В некоторых вариантах реализации изобретения термин «лечение» может включать увеличение продолжительности жизни субъекта и/или отодвигание во времени необходимости в дополнительном лечении.

[00143] В данном документе термин «терапевтически эффективное количество» обозначает количество соединения, которое, при введении субъекту с целью лечения или профилактики конкретного расстройства, заболевания или состояния, является достаточным для проведения такого лечения или профилактики указанного расстройства, заболевания или состояния. В данном документе термин «терапевтически эффективное количество» дополнительно обозначает количество плазминогена, его варианта или его фрагмента, которое является эффективным с точки зрения заживления ран, заживления перфорации барабанной перепонки, заживления раны периодонта, лечения инфекционного заболевания, оздоровления или поддержания здорового состояния ротовой полости, лечения заднего отслоения стекловидного тела (ЗСТ), диабетической язвы и показаний для тромболиза у субъектов с дефицитом плазминогена, таких как коронарный тромбоз, лечения реперфузийного поражения ткани, лечения ишемии, инфаркта, отека мозга, для улучшения микроциркуляции, лечения субъектов с дефицитом плазминогена и модуляции пути активации комплемента у субъектов. Дозы и терапевтически эффективные количества могут варьировать, например, в зависимости от разных факторов, включая возрастную активность, массу тела, общее состояние здоровья, пол и рацион субъекта, время введения, способ введения, скорость выведения и любую комбинацию лекарственных средств, если это уместно, воздействие на субъекта, которого

врач желает достичь, и конкретное(ые) расстройство(а), которым страдает субъект. Кроме того, терапевтически эффективное количество может зависеть от параметров крови субъекта (например, липидный профиль, уровни инсулина, гликемии), тяжести патологического состояния, функции органа или базового заболевания или осложнений. Такие подходящие дозы могут быть определены с помощью любых доступных анализов, включая анализы, описанные в данном документе. Если фармацевтическую композицию по изобретению следует вводить людям, например, врач может сначала назначать относительно низкую дозу, в дальнейшем повышая дозу до достижения надлежащего ответа. В конечном счете, доза для введения будет зависеть от решения врача.

Наборы

[00144] Соединение(я) по изобретению может быть упаковано как часть набора, который может включать емкость (например, упаковку, коробку, ампулу и т.п.). Набор может коммерчески применяться в соответствии со способами, описанными в данном документе, и может включать инструкции для применения в способе по изобретению.

[00145] Композиция по изобретению может быть введена или не введена пациенту одновременно с другим активным ингредиентом, перед или после него, а также тем же способом введения или с помощью другого способа введения. Таким образом, в настоящее изобретение дополнительно включены наборы, которые, при применении лечащим врачом, могут упростить введение пациенту соответствующих количеств композиции по настоящему изобретению, отдельно или в сочетании с другим активным ингредиентом.

[00146] Наборы по изобретению могут дополнительно содержать фармацевтически приемлемую жидкость для разведения лиофилизированной композиции. Например, если активный ингредиент поставляется в твердом виде и должен быть разведен для парентерального введения, набор может включать герметически закупоренный контейнер с подходящей фармацевтически приемлемой жидкостью, в которой активный ингредиент может быть растворен

для образования стерильного раствора без механических включений, пригодного для парентерального введения.

[00147] В некоторых вариантах реализации изобретения композиция по настоящему изобретению содержится в ампуле, флаконе, пробирке, шприце или другой емкости для однократного или многократного введения. Такие емкости могут быть изготовлены из стекла или полимерного материала, например, такого как полипропилен, полиэтилен, поливинилхлорид или полиолефин. В некоторых вариантах реализации изобретения емкости могут содержать уплотнение или другую систему укупорки, такую как резиновая пробка, сквозь которую может проникать игла для отбора единичной дозы и повторной герметизации после извлечения иглы. Все такие емкости для инъекционных жидкостей, лиофилизированных композиций, разведенных лиофилизированных композиций или порошков для разведения и инъекций, известные в данной области техники, рассматриваются для применения в описанных в данном документе композициях и способах. В конкретном варианте реализации изобретения емкость представляет собой устройство для введения по типу шприц-ручки, содержащей одну дозу или несколько доз. Такое устройство для введения по типу ручки может быть многоразовым, например, многоразовая шприц-ручка, которая вмещает одноразовый картридж, содержащий одну дозу или несколько доз, либо все устройство может быть одноразовым, например, одноразовой шприц-ручкой, содержащей одну дозу или несколько доз. В некоторых вариантах реализации изобретения, в которых устройство для введения по типу шприц-ручки содержит несколько доз, доза может быть предварительно установленной, т.е., фиксированной. В других вариантах реализации данного изобретения доза может быть варьирующей, т.е., отбирается пользователем. В некоторых вариантах реализации изобретения устройство для доставки по типу шприц-ручки оборудовано люеровским наконечником, люеровским конусом или другим соединительным наконечником для иглы, который облегчает присоединение одноразовой иглы. В других вариантах реализации изобретения устройство по типу шприц-ручки оборудовано закрепленной, т.е. несъемной иглой. В другом конкретном варианте реализации изобретения емкость является

шприцем. В некоторых вариантах реализации изобретения шприц оборудован люеровским наконечником, люеровским конусом или другим соединительным наконечником для иглы, который облегчает присоединение одноразовой иглы. В других вариантах реализации изобретения шприц обрудован закрепленной, т.е. несъемной иглой.

В некоторых вариантах реализации изобретения шприц предварительно заполнен одной дозой или несколькими дозами.

Анализы стабильности

[00148] «Стабильные» композиции включают композиции, в которых белок (плазминоген или его вариант) в композиции по существу сохраняет свою физическую стабильность и/или химическую стабильность и/или биологическую активность в процессе хранения. Разные аналитические методы для определения стабильности белка доступны в данной отрасли техники и рассмотрены, например, в Lee, V, 1991, Peptide and Protein Drug Delivery, 247-301 (Marcel Dekker, Inc., New York, NY) и Jones, 1993, Adv. Drug Delivery Rev. 10: 29-90. Стабильность может быть измерена при выбранной температуре на протяжении выбранного периода времени. В одном варианте реализации изобретения композиция является стабильной при комнатной температуре (около 25°C) или при 40°C на протяжении по меньшей мере 1, 2, 3, 4, 5 или 6 месяцев и/или является стабильной при 2-8°C на протяжении по меньшей мере 1, 2, 3, 4, 5 или 6 месяцев. Кроме того, в некоторых вариантах реализации изобретения композиция является стабильной после замораживания (например, -30°C). В некоторых вариантах реализации изобретения критерии стабильности являются следующими: (1) композиция остается прозрачной при визуальной инспекции; (2) вариации концентрации, рН и осмотического давления композиции составляют не более чем около ± 10 %; (3) образуется не более чем около 10 %, не более чем около 5 % или не более чем около 1 % агрегатов, по данным ЭК-ВЕРХ; и (4) разрушается не более чем 10 % масс., не более чем около 5 % или не

более чем 3 % плазминогена, по данным известных в данной области техники и хорошо валидированных аналитических методов.

[00149] Термическая денатурация: Могут быть проведены эксперименты с термической денатурацией в формате высокопродуктивного скрининга (ВСП) состава для плазминогена или его варианта или фрагмента с применением Optim 2™ производства Pall; или другой(их) альтернативной(ых) биофизической(их) методик(и) для контроля деградации белка (стандартная ПЦР (с использованием нагревательного блока)), флуориметр или КД-спектрофотометр (с контролем температуры). В качестве примера, система Optim 2 одновременно измеряет диапазон показателей стабильности белка, в том числе температуру перехода разворачивания (Tm) температуру начала агрегации (Tagg) и скорость агрегации.

[00150] Влияние вспомогательных веществ на термостабильность: Узкий диапазон рН определяют при оптимальном диапазоне рН и более высокой температуре плавления (Tm) и температуре начала агрегации (Tagg). Если более высокая Tm получена в физиологичном диапазоне 6,5-7,5; проводят следующее(ие) испытание(я), по меньшей мере с 3 буферными системами.

[00151] Кроме того, ИЭФ (изоэлектрофокусирование) или кИЭФ (капиллярное изоэлектрофокусирование) может быть проведено для оценки физической конформации плазминогена в растворе.

[00152] Процент стабилизации базируется на измерениях ферментативной активности плазминогена для каждого буфера/вспомогательного вещества и для контрольного раствора, содержащего только плазминоген, через 1-8 часов инкубации при 60°C. В другом испытании стабилизация может быть оценена при 37°C на протяжении 1-8 часов. Процент стабилизации вычисляется следующим образом:

Процент Стабилизации = 100 х [S-T]/[T]

[00153] где S представляет собой остаточную ферментативную активность ферментного раствора со вспомогательным веществом, которая должно быть

протестирована через 10 дней при 35°C; а T обозначает активность контроля без вспомогательного вещества, хранящегося в тех же условиях.

[00154] Агрегация и подсчет частиц (ПЧ): ПЧ осуществляют с помощью теста подсчета частиц с затенением света. Специалисты по анализу должны использовать соответствующий прибор, действие которого основано на принципе затенения света, и который обеспечивает возможность автоматического определения размера и количества частиц. Выбранный датчик должен быть пригодным для предполагаемого диапазона размера частиц и ожидаемого количества частиц. Стандартный диапазон размера частиц обычно варьирует от 2 до 100 мм Специалисты по анализу должны проверять характеристики устройства, используя USP Подсчет частиц RS, диспергированных в соответствующем объеме свободной от механических включений воды. Необходимо соблюдать осторожность, во избежание агломерации частиц во время диспергирования в процессе калибровки.

[00155] Методы: образцы продукта испытывают таким способом, который наиболее адекватным образом отображает введение (например, вытесняется содержимое шприца). Для парентеральных препаратов достаточного объема (то есть достаточно большого объема для упрощения тестирования), тестирование отдельных блоков часто является диагностическим. Для парентеральных продуктов недостаточного объема осторожно, но тщательно смешивают каждый блок, потом объединяют содержание соответствующего количества блоков в отдельной емкости, чтобы получить объем, необходимый для одного испытания (обычно 0,2-5,0 мл). Если осуществляется разведение, следует удостовериться, что объем холостого контейнера является достаточным для продукта и разбавителей, и что в анализ введено небольшое количество механических включений, если введено вообще. Осторожно открывают каждый блок, удаляют герметическую пробку, избегая загрязнения содержимого перед отбором проб, разведением или, при необходимости, объединением. Если указан растворитель продукта, например, для лиофилизированных твердых веществ или порошков для парентерального введения, разведение или разбавление необходимо

осуществлять соответствующим количеством указанного растворителя. В таком случае собственно растворитель может быть протестирован, чтобы гарантировать, что он не является существенным источником частиц. Вычитание количества частиц растворителя из общего количества не разрешается. Устранение пузырьков газа является ключевой стадией, в частности, для белковых продуктов, которые легко захватывают газы. Рекомендуется два способа: оставить жидкий продукт отстаиваться при давлении окружающей среды или под слабым (например, 75 мм рт. ст) вакуумом. Могут быть применены другие способы, которые продемонстрировали свою пригодность. Следует избегать ультразвука. После дегазации образцов их следует осторожно взболтать для суспендирования всех частиц путем осторожного, но тщательного перемешивания содержания образца с помощью соответствующих средств, например, медленно вращая емкость в руках. В любом случае не рекомендуется перемешивать жидкий продукт, переворачивая емкость. Немедленно после перемешивания отбирают не меньше четырех аликвот, объем каждой из которых отвечает пропускной способности прибора (обычно 0,2-5,0 мл). Подсчитывают количество частиц с размером в выбранном диапазоне, в частности, частиц с размером 10 и 25 мм или более. Отбрасывают результат, полученный для первой аликвоты, и вычисляют среднее количество частиц в каждом диапазоне размера для других аликвот испытуемого препарата. Для контроля отбора образцов используют объем тары, который должен быть характерным для датчика динамического диапазона и объема иглы.

[00156] Оценка: Требования регуляторных органов, таких как Управление санитарного надзора за качеством пищевых продуктов и лекарственных средств (FDA) и USP/EP/JP (Объединенная Государственная Фармакопея), Разделы (787, 788 и 789), Европейская Фармакопея (EP 2.9.20 Механические включения) и Японская Фармакопея (JP 16: 6.06, 6.07 Испытание на нерастворимые механические включения), относительно механических включений следующим образом определяют приемлемый уровень частиц в жидком препарате для применения у человека. Для парентеральных продуктов, которые представляют собой растворы терапевтического белка для инфузий или инъекций, которые

поставляются в контейнерах с номинальным содержанием 100 мл или менее: среднее количество частиц, присутствующих в испытуемых блоках, не должно превышать 6000 на емкость для частиц размером 10 мкм или более, и не должно превышать 600 на емкость для частиц размером 25 мкм или более. Для инъекционных растворов терапевтического белка, которые поставляются в контейнерах с номинальным содержанием более чем 100 мл, и препаратов для парентеральной инфузии или инъекций с номинальным содержанием более 100 мл: среднее количество частиц, присутствующих в испытуемых блоках, не должно превышать 25 на мл для частиц размером 10 мкм или больше и не должно превышать 3 на мл для частиц размером 25 мкм или больше. Кроме того, общее количество частиц размером 10 мкм или более не должно превышать 6000 на емкость и частиц размером 25 мкм или более не должно превышать 600 на емкость. Продукты, которые используются с конечным фильтром во время введения (в линии), освобождены от этих требований, при условии, что доступны научные данные для оправдания освобождения от требований. Однако, ожидается, что фильтраты будут отвечать требованиям. Для продуктов, которые поставляются или сначала разводятся в объеме <100 мл и затем разводятся для инфузии в объеме >100 мл, содержание частиц следует оценивать как до, так и после разведения, причем его оценивают на базе их конечного объема. Следовательно, способ USP/EP/JP таким образом включен в настоящий документ. В настоящем документе термин «частица» относится к «механическому включению» и наоборот; указанные термины могут употребляться взаимозаменяемым образом.

[00157] Исследование кинетики с измерением по методу рассеивания света при 476 нм/600 нм с использованием Optim-2™ или стандартного УФ-спектрофотометра в УФ-диапазоне на длине волны 350 нм: для более быстрого скрининга разных стабилизирующих вспомогательных веществ выбирают условия ускоренного старения, такие как повышенная температура (65°C) и кислый раствор (рН 4,5) или основный раствор (pH 9,5). Компоненты композиции для повышения Tagg оценивают как функцию времени при постоянной температуре (55-60°C) на протяжении по меньшей мере 1-4 часов.

Кинетическое поведение агрегации плазминогена в растворе измеряют при температуре 55-60°C с контролем температуры (определяется начальная Tm) на протяжении до 4 часов. Осуществляют скрининг вспомогательных веществ относительно их влияния на ингибирование агрегации плазминогена, по данным измерения методом рассеивания света при 267 нм, 467 нм и 350 нм (Cheng, W. et al. «Comparison of High-Throughput Biophysical Methods to Identify Stabilizing Excipients for а Model IgG2 Monoclonal Antibody: Conformational Stability and Kinetic Aggregation Measurements» Journal of Pharmaceutical Sciences, Vol. 101, No 5, page 1701-1720, 2012).

[00158] Влияние концентрации белка на термическую стабильность: одним из преимуществ Optim-2™ или Флуориметра с двойным сканированием (ФДС с красителем Sypro) является возможность проводить измерения Tm и Tagg в высококонцентрированных белковых растворах. Независимо от того, проводится ли исследование потенциальных кандидатов с точки зрения относительной стабильности или скрининг разных условий для стабилизации белков в составе, может быть важным идентифицировать свойства белкового раствора при высоких концентрациях, когда количество доступных методов определения является ограниченным.

[00159] Влияние состава композиции на конечное осмотическое давление: в конечной фармацевтической композиции концентрация буферного вещества, вспомогательного вещества и соли предпочтительно не должна быть очень высокой из-за практических ограничений парентеральной инъекции. Вместо этого, более умеренные концентрации, такие как в большей степени физиологические, являются предпочтительными для обеспечения осмотического давления в диапазоне от 240 до 400 мОсм. Таким образом, осмотическое давление вычисляют с целью начального определения этого диапазона; однако в случае в/в инъекции дополнительно могут быть применены концентрации с более высоким осмотическим давлением в ходе разработки способа лиофилизации, если после разведения плазминоген или его вариант или фрагмент будет разбавлен раствором для разведения.

[00160] Следует отметить, что термины «состав» и «композиция» могут употребляться в настоящем документе альтернативно и предназначены для обозначения одного и того же.

[00161] Заголовки включены в настоящий документу для целей ссылки и помощи в нахождении конкретных разделов. Указанные заголовки не предназначены для ограничения объема концепций, описанных в данном документе, и указанные концепции могут находить применение в других разделах по всему описанию. Таким образом, настоящее изобретение не следует интерпретировать как ограниченное вариантами его реализации, проиллюстрированными в настоящем документе, но следует интерпретировать в самом широком объеме, что согласовывается с раскрытыми в настоящем документе принципами и новыми признаками.

[00162] Формы единственного числа включают соответствующие ссылки на множественное число, если контекст явно не диктует иного.

[00163] Если не указано иное, все числа, которые выражают количества ингредиентов, условия реакции, концентрации, свойства и т.п., использованные в описании и формуле изобретения, следует понимать как модифицированные во всех случаях термином «около». По меньшей мере, каждый численный параметр следует понимать по крайней мере в свете количества приведенных значимых цифр, и с применением обычных методов округления. Соответственно, если не указано обратное, количественные параметры, приведенные в настоящем документе и приложенной формуле изобретения, представляют собой приближения и могут варьировать в зависимости от необходимых свойств, которые должны быть получены. Невзирая на то, что численные диапазоны и параметры, которые устанавливают широкий объем изобретения, являются приближениями, численные значения, приведенные в конкретных примерах, указаны настолько точно, насколько это возможно. Однако, любое численное значение по своей природе содержит определенные погрешности, которые

возникают в результате вариаций в условиях экспериментов, тестовых измерениях, статистических анализах и т.п.

[00164] Необходимо понимать, что примеры и варианты реализации изобретения, описанные в настоящем документе, служат только целям иллюстрации, и что в их свете разнообразные модификации или вариации будут предложены специалистам в данной области техники и должны быть включены в объем настоящего изобретения и объем приложенной формулы изобретения.

ПРИМЕРЫ

[00165] Следующие примеры дополнительно иллюстрируют настоящее изобретение, но не предназначены для его ограничения.

Пример 1: Стабильность плазминогена в замороженном составе

[00166] Результаты испытания стабильности фармацевтической композиции, содержащей 5 мг/мл плазминогена человека, добытого из плазмы в соответствии со способом аффинности связывания, описанным в WO 2006/120423, 10 мМ цитрата, 150 мМ NaCl, рН 6,5 (серия: 2002.pc02 Pg140210.01) хранят при -20°C, -30°C и -80°C на протяжении периода до 6 месяцев. Данные стабильности показывают, что плазминоген является стабильным в указанных условиях замораживания. Плазминоген серии: 2002.pc02 Pg140210.01 испытывали при -20°C, -30°C и -80°C. Уровень агрегации исследовали с помощью ЭК-ВЭЖХ, уровень чистоты - с помощью ДНС-ПААГ в восстанавливающих и невосстанавливающих условиях, уровень активности - по активности BCS, и концентрацию белка - по оптической плотности при длине волны 280 нм (ABS280). Результаты данных стабильности через 6 месяцев показали, что все анализы индикации продемонстрировали стабильность необходимых параметров спецификации.

Пример 2: Анализ осмотического давления и анализы общего процентного содержания твердых веществ

[00167] Осмотическое давление составов 1-6 и общий процент твердых веществ после лиофилизации для составов 1-9 представлены в Табл. 2. Содержание составов 1-9 определено в Табл. 1A.

Таблица 2

[00168] Осмотическое давление находится в физиологическом диапазоне 240-400 мОсм. Полученное осмотическое давление испытуемых композиций преимущественно находится в границах или очень близко к физиологическому диапазону осмотического давления. Общий % твердого осадка (г твердой композиции после лиофилизации на 100 мл жидкой композиции до лиофилизации) составляет около 4% для всех композиций и плацебо, что находится в предпочтительном диапазоне от 3,5 до 8%.

Пример 3: Молекулярная масса плазминогена

[00169] Молекулярная масса очищенного и введенного в фармацевтическую композицию по настоящему изобретению плазминогена составляет 87000 (М.м.), что определено путем вычисления первичной аминокислотной последовательности плазминогена и подтверждено с помощью масс-спектрометрии.

Пример 4: Исследование внешнего вида остатка после лиофилизации

[00170] Составы 1-5 были лиофилизированы в соответствии с циклическим способом, подробно описанным в Табл. 5. Содержание Составов 1-5 определено в Табл. 1А.

Таблица 5

[00171] Фиг. 2-11 представляют собой изображение флаконов, содержащих по 12,5 мл Составов 1-5, соответственно, или соответствующего плацебо (без плазминогена). Таким образом, было исследовано влияние присутствия плазминогена на стабильность композиции. Органолептическая инспекция внешнего вида осадка, который был образован с помощью способа лиофилизации. Все обезвоженные брикеты сохранили равномерную плотность,

без какого-либо изменения цвета. Оплавление присутствовало менее чем в 10% исследованных флаконов для плацебо Составов 2, 3 и 5. Спекание присутствовало менее чем в 10% исследованных флаконов для плацебо Состава 1. Менее 10% испытуемых флаконов для Составов 1-5 и плацебо Композиции 4 продемонстрировали базальную ретракцию. В целом, внешний вид брикета является удовлетворительным.

[00172] Содержание композиции диктует температуру спекания. Каждое чистое аморфное вспомогательное вещество имеет характерную температуру Tg' и температуру спекания; температура спекания для состава представляет собой усредненную по массе температуру всех композиций в аморфной фазе. Важной является разработка состава с максимальной температурой спекания, поскольку скорость сушки является прямо пропорциональной температуре образца во время лиофилизации.

[00173] Наконец, температура спекания будет снижаться, если соли (NaCl) и вспомогательные вещества не являются максимально кристаллическими. Например, Tg' глицина составляет -45°С, и его вклад в аморфную фазу может снижать температуру спекания до неприемлемо низких значений.

Пример 5: Влияние аминокислоты на агрегацию плазминогена в растворе

[00174]. Плазминоген сам по себе образует в воде ряд агрегатов плазминогена, которые являются неприемлемыми с точки зрения FDA, то есть в количестве более чем 6000 частиц размером 10 мкм или более на 100 мл композиции (см. образец F0406 в Табл. 4). Различные составы на основе сахарозы были разработаны для введения плазминогена в составы. Хотя большинство из этих составов успешно проходят порог 6000 частиц размером 10 мкм или более на 100 мл, были разработаны составы с меньшим содержанием частиц, и было изучено влияние аминокислоты на стабилизацию плазминогена. Такие дополнительные композиции содержат 10 мг плазминогена и 35 мМ NaCl, причем были испытаны три буферных состава/рН, то есть 10 мМ цитрата натрия (рН 6,5), 10 мМ фосфата натрия (рН 7,2) и 10 мМ Трис-HCl (рН 8,0). Были

сопоставлены присутствие и отсутствие аминокислоты, выбранной из аргинина, аланина и глицина в концентрации 0,5%. Составы исследовались свежеприготовленными, то есть перед лиофилизацией. В Табл. 6 приведен ПЧ для частиц размером 10 мкм или более и размером 25 мкм или более. Присутствие аминокислоты показало, что стабилизирующее влияние способствует снижению уровня агрегации.

Таблица 6

Пример 6: Влияние маннита в сочетании с аминокислотой на агрегацию плазминогена

[00175] Исследовано влияние присутствия наполнителя, 0,5% маннита, на составы, содержащие 10 мг плазминогена, 35 мМ NaCl и 10 мМ цитрата натрия (рН 6,5), 10 мМ фосфата натрия (рН 7,2) или 10 мМ Трис-HCl (рН 8,0)) с аминокислотой (0,5% аргинина гидрохлорида, аланина или глицина) и без нее, и результаты приведены в Табл. 7. В этом исследовании испытывали свежеприготовленные составы (перед лиофилизацией). Как правило, присутствие маннита уменьшало количество частиц. Как правило, комбинация маннита и аминокислоты способствует уменьшению количества частиц, и, в частности, в случае комбинации аргинина с маннитом.

Таблица 7

Пример 7: Влияние консерванта на агрегацию плазминогена

[00176] Исследовано влияние присутствия консерванта, такого как 0,1% фенола, в составах, содержащих 9 или 10 мг плазминогена, 35 мМ NaCl и 10 мМ цитрата натрия (рН 6,5), 10 мМ фосфата натрия (рН 7,2) или 10 мМ Трис-HCl (рН 8,0)) с 0,5% аргинина гидрохлорида или комбинации 0,5% маннита и 0,5% аргинина гидрохлорида. В данном исследовании испытывали свежеприготовленные составы (перед лиофилизацией). Подсчет частиц (ПЧ) приведен в Табл. 8. Преимущественно, присутствие фенола не оказывает значительного влияния на количество частиц.

Таблица 8

[00177] Сравнивали несколько консервантов. В Табл. 9 приведено сравнение 0,5% КМЦ, 0,1% фенола и 0,5% декстрана в вариациях составов, содержащих 10 мг плазминогена, 35 мМ NaCl и 10 мМ цитрата натрия (рН 6,5), 10 мМ фосфата натрия (рН 7,2) или 10 мМ Трис-HCl (рН 8,0) и 0,5% аргинина гидрохлорида. В данном исследовании испытывали свежеприготовленные составы (перед лиофилизацией). Наличие декстрана или фенола не оказывает значительного влияния на агрегацию. Однако, КМЦ значительно увеличивала агрегацию. Это неудивительно, поскольку известно, что КМЦ повышает вязкость раствора и часто применяется при изготовлении глазных капель.

Таблица 9

Пример 8: Влияние аминокислоты и ее концентрации на агрегацию плазминогена

[00178] Аргинин в количестве 0,5% и 1% испытывали в составах, содержащих 10 мг/мл плазминогена, 35 мМ NaCl, 10 мМ фосфата натрия (NaPi), рН 7,2, после лиофилизации и разведения. Подсчет частиц (ПЧ) приведен в Табл. 10, из которой можно увидеть, что обе концентрации аргинина эффективно поддерживают низкое значение ПЧ.

Таблица 10

[00179] Аргинин, глицин и аланин в количестве 1% сравнивали в составах, которые содержат 10 мг/мл плазминогена, 35 мМ NaCl, 10 мМ фосфата натрия, рН 7,2 (NaPi), после лиофилизации и разведения. Подсчет частиц (ПЧ) приведен в Табл. 11, из которой можно увидеть, что аргинин превосходит аланин и глицин с точки зрения поддержания низкого значения ПЧ в условиях исследования, хотя все три указанные аминокислоты обеспечивают приемлемые значения ПЧ, т.е. менее чем 6000 частиц размером 10 мкм или более на 100 мл.

Таблица 11

Пример 9: Общий процент твердого вещества и осмотическое давление

[00180] Осмотическое давление нескольких составов с содержанием 10 мг/мл плазминогена и процент твердых веществ, применяемых для получения указанных препаратов, приведены в Табл. 10. Осмотическое давление нескольких составов с содержанием 20 мг/мл плазминогена и процент твердых веществ, применяемых для получения указанных составов, приведены в Табл. 11. Полученное осмотическое давление испытуемых составов преимущественно находится в границах или очень близко к физиологическому диапазону осмотического давления. Общий процент твердых веществ вычисляется на базе содержания плазминогена, модификатора осмотического давления и наполнителя в составе и является хорошим индикатором размера полученного осадка после лиофилизации.

Таблица 12

Таблица 13

Пример 10: Подсчет частиц (ПЧ)

[00181] Подсчет частиц (ПЧ) для частиц размером 10 мкм или более в составах, описанных в Табл. 12, приведен в Табл. 14; а количество частиц (ПЧ) для частиц размером 10 мкм или более в составах, описанных в Табл. 13, приведено в Табл. 15.

Таблица 14

Таблица 15

[00182] На Фиг. 12, 13 и 14 приведены изображения флаконов, которые содержат составы F0498, F0449 и F0459, соответственно, как характерные примеры внешнего вида лиофилизированных составов, представленных в Табл. 12-15.

Пример 10: Обратимая агрегация плазминогена

[00183] Агрегация плазминогена является обратимой, как продемонстрировано в данном исследовании. Замороженные образцы плазминогена (Pg нерасфасованный) 5 мг/мл поддают диализу в dH2O и интенсивно осаждают, размораживают, фильтруют сквозь шприц-фильтр с размером отверстий 1,2 мкм и используют в качестве исходного материала для контроля (контроль Pg). Аликвоты контроля Pg по 2 мл помещают в стеклянные флаконы, предварительно добавляя запасной буферный раствор 1 М цитрата натрия, рН 6,5 (Образец 1), 0,5 М Na фосфата, рН 7,2 (Образец 2) или 1 М Трис-HCl, рН 8,0 (Образец 3) с получением конечной концентрации 10 мМ буфера при каждом значении рН, соответственно. Образцы 1, 2 и 3 проиллюстрированы на Фиг. 15, где контролем без Pg является Образец 0. Образцы 1, 2 и 3 были дополнительно нагружены запасными растворами 5 М NaCl и 0,8 М аргинина до получения конечной концентрации 35 мМ NaCl и 28,5 мМ (0,5%) Arg в каждом образце и проиллюстрированы на Фиг. 16. Стандарты мутности 0,02, 20, 100, 800 НЕМ, соответственно, были использованы на Фиг. 15 и 16 в качестве эталона. На Фиг. 15 можно увидеть, что при коррекции рН растворяется значительное количество

агрегатов. На Фиг. 16 Образцы 1, 2 и 3 становятся прозрачными при добавлении аргинина и NaCl, т.е. при визуальной инспекции агрегаты отсутствуют.

[00184] Мутность образцов 0, 1, 2 и 3 на Фиг. 16 измеряли путем считывания оптической плотности (OD) на длине волны 550 нм, применяя стандартную калибровку с референтными стандартами мутности, проиллюстрированными на Фиг. 15 и 16. Мутность приведена в нефелометрических единицах мутности (НЕМ) в Табл. 16. Аликвоты по 1 мл каждого образца измеряли до (Т=0) и после нагрузки образцов 1, 2 и 3 буфером, NaCl и аргинином в точках времени 0,1 часа, 17 часов, 21 час и 24 часа. Дезагрегация происходит быстро, ее можно заметить только через 0,1 часа после нагрузки, причем она сохраняется на протяжении 24 часов.

Таблица 16

Пример 11: Влияние аминокислоты на мутность композиции во времени

[00185] Мутность измерена в композициях, содержащих 10 мг плазминогена и 3 5 мМ NaCl с 0,5% глицина, аргинина, аланина и без аминокислоты, при рН 6,5 в натрий-цитратном буфере (Фиг. 17), в натрий-фосфатном буфере при рН 7,2 (Фиг. 18) ив Трис-буфере при рН 8,0 (Фиг. 19).

[00186] Исследуемые композиции на Фиг. 17, 18 и 19 были воспроизведены в присутствии 0,5% маннита в качестве наполнителя и представлены на Фиг. 20, 21 и 22, соответственно.

[00187] Во всех случаях присутствие аминокислоты обеспечивает стабилизирующий эффект и поддерживает или снижает мутность. Если сравнивать виды аминокислот, то аргинин показывает наилучший стабилизирующий эффект и более низкую мутность при всех исследованных значениях рН, в присутствии и в отсутствие наполнителя, т.е. 0,5% маннита.

Пример 12: Композиция с повышенной концентрацией плазминогена

[00188] Исследованы композиции с высокой концентрацией плазминогена. Значения ПЧ для частиц размером 10 мкм или более и 25 мкм или более были представлены в Табл. 17 для композиций с содержанием 20 мг/мл плазминогена в 10 мМ или 100 мМ растворе натрия цитрата, 35 мМ NaCl, рН 6,5, с 1% аргинина и без него, и композиций с содержанием 37 и 56 мг/мл плазминогена в 100 мМ раствора натрия цитрата, 35 мМ NaCl, рН 6,5, содержащем 1% аргинина.

В Табл. 17 проиллюстрировано, что составы по настоящему изобретению обеспечивают получение композиций, которые содержат повышенные концентрации плазминогена (37 и 56 мг/мл) и не содержат неприемлемого уровня частиц.

Таблица 17

Пример 13: Активность плазминогена

[00189] Активность плазминогена в каждом составе, приведенном в настоящем документе в качестве примера, испытывали и сравнивали с активностью плазминогена в начальном составе препарата или нерасфасованном составе (Pg). Необходимо отметить, что ни один из указанных составов не влияет на активность плазминогена.

1. Жидкая фармацевтическая композиция, содержащая:

– Glu-плазминоген или биологически активный мутантный полипептид Glu-плазминогена, обладающий по меньшей мере 80% идентичностью аминокислотной последовательности с нативным полипептидом Glu-плазминогена в концентрации от 0,01 мг/мл до 80 мг/мл;

– модификатор тоничности, который представляет собой хлорид натрия, в концентрации от 30 мМ до 100 мМ, позволяющей достичь осмоляльности композиции от 180 мОсм до 350 мОсм; и

– стабилизатор, который представляет собой аргинин или глицин, в концентрации от 10 мМ до 100 мМ;

– и при этом значение pH композиции составляет от 5,0 до 8,0.

2. Фармацевтическая композиция по п. 1, отличающаяся тем, что pH составляет от 6,0 до 8,0 или от 6,5 до 7,5.

3. Фармацевтическая композиция по п. 1 или 2, отличающаяся тем, что концентрация Glu-плазминогена или биологически активного мутантного полипептида Glu-плазминогена составляет от 5 мг/мл до 60 мг/мл.

4. Фармацевтическая композиция по п. 3, отличающаяся тем, что концентрация Glu-плазминогена или биологически активного мутантного полипептида Glu-плазминогена составляет 40, 30, 20, 10 или 5 мг/мл.

5. Фармацевтическая композиция по п. 1 или 2, отличающаяся тем, что концентрация Glu-плазминогена или биологически активного мутантного полипептида Glu-плазминогена составляет от 2 мг/мл до 20 мг/мл.

6. Фармацевтическая композиция по любому из пп. 1, 2, 4, 5, отличающаяся тем, что Glu-плазминоген или биологически активный мутантный полипептид Glu-плазминогена составляет по меньшей мере 80% от общего содержания белка в композиции или более чем 90% от общего содержания белка в композиции.

7. Фармацевтическая композиция по п. 6, отличающаяся тем, что Glu-плазминоген или биологически активный мутантный полипептид Glu-плазминогена составляет более чем 95 или 98% от общего содержания белка в композиции.

8. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, отличающаяся тем, что стабилизатор является аргинином.

9. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, отличающаяся тем, что стабилизатор является глицином.

10. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, отличающаяся тем, что стабилизатор присутствует в концентрации от 25 мМ до 75 мМ.

11. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, отличающаяся тем, что модификатор тоничности присутствует в концентрации от 25 мМ до 50 мМ.

12. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, дополнительно содержащая невосстанавливающий сахар, который представляет собой сахарозу.

13. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, отличающаяся тем, что композиция является свободной от апротинина.

14. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, отличающаяся тем, что указанный Glu-плазминоген или биологически активный мутантный полипептид Glu-плазминогена представляет собой Glu-плазминоген человека или биологически активный мутантный полипептид Glu-плазминогена человека.

15. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, отличающаяся тем, что количество частиц Glu-плазминогена размером 10 мкм или более в композиции составляет менее 6000 частиц на контейнер с номинальным содержанием 100 мл или менее.

16. Фармацевтическая композиция по п. 15, отличающаяся тем, что количество частиц Glu-плазминогена составляет менее 2000 или 1000 частиц на контейнер с номинальным содержанием 100 мл или менее.

17. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, 16, пригодная для внутривенного, подкожного, местного, внутрикожного, офтальмологического и/или внутримышечного введения.

18. Фармацевтическая композиция по любому из пп. 1, 2, 4, 7, 16, отличающаяся тем, что указанная жидкая композиция является разведенной композицией.

19. Применение фармацевтической композиции по любому из пп. 1-18 в качестве лекарственного средства.

20. Применение по п. 19, где лекарственное средство предназначено для лечения дефицита плазминогена типа I.

21. Применение по п. 19, где лекарственное средство предназначено для улучшенного заживления ран.



 

Похожие патенты:

Изобретение относится к области биотехнологии, конкретно к рекомбинантным полипептидам для нацеливания на выделяющийся фосфатидилсерин. Описан полипептид для нацеливания на выделяющийся фосфатидилсерин, который включает: (a) домен гамма-карбоксиглутаминовой кислоты белка S, содержащий последовательность, представленную в SEQ ID NO: 1, или последовательность по меньшей мере на 95% гомологичную ей, и не содержащий домен протеазы или гормонсвязывающий домен; и (b) белок S домена EGF, где указанный полипептид конъюгирован с полезным грузом, выбранным из детектируемой метки, белковой последовательности, полиэтиленгликоля, целлюлозы, белка альбумина и терапевтического агента.

Изобретение относится к области биотехнологии, конкретно к противораковым пептидным агентам на основе фрагмента эндостатина, и может быть использовано в медицине в терапии рака предстательной железы.

Изобретение относится к области косметологии и представляет собой фармацевтическую композицию для предотвращения или лечения выпадения волос, причем указанная фармацевтическая композиция содержит белок хемокинового лиганда 1, содержащего C-X-C мотив (CXCL1), и 2% миноксидил в качестве активного ингредиента, причем указанный белок CXCL1 содержит аминокислотную последовательность, представленную SEQ ID NO: 1, и при этом указанные белок CXCL1 и миноксидил содержатся в массовом соотношении 1:10 соответственно.

Группа изобретений относится к медицине и касается способа лечения стафилококковых инфекций, включающего введение субъекту эффективного количества антибактериальной композиции, обладающей широким спектром бактерицидной активности против по меньшей мере одного или нескольких видов Staphylococcus, где антибактериальная композиция включает в себя первый антибактериальный белок, состоящий из аминокислотной последовательности, представленной в SEQ ID NO: 1, и второй антибактериальный белок, состоящий из аминокислотной последовательности, представленной в SEQ ID NO: 2.

Настоящее изобретение относится к области биотехнологии, конкретно к экспрессионным системам терапевтических белков, и может быть использовано в терапии для образования сенсорных клеток во внутреннем ухе человека.

Изобретение относится к области биотехнологии, медицины и молекулярной биофармакологии. Предложено применение полипептида, имеющего аминокислотную последовательность, соответствующую SEQ ID NO:1, для подавления жизнеспособности, миграции и инвазии клеток плоскоклеточного рака полости рта, снижения экспрессии онкогенов ITGAV, BCL2 и ММР7.

Изобретение относится к медицине и касается фармацевтической композиции для лечения грибковых поражений слизистых оболочек, включающей в качестве действующего вещества пептид SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFF, дополнительно содержащей гидроксипропилметилцеллюлозу, полиэтиленгликоль-400 и воду.

Изобретение относится к медицине и касается способа лечения мышечных дистоний у человека, заключающегося во введении пациенту терапевтически эффективных количеств пептида DNWWPKPPHQGPRPPRPRPKP.

Изобретение относится к области биотехнологии, конкретно к получению антибактериальных рекомбинантных белков, и может быть использовано в медицине в качестве антибактериальной композиции, проявляющей активность в отношении грамотрицательных бактерий Pseudomonas aeruginosa.

Настоящее изобретение относится к области биотехнологии, конкретно к получению противомикробных пептидов, и может быть использовано в медицине для антимикробной терапии.

Настоящее изобретение относится к области медицины, а именно к способу лечения эндометриоза на основании экспериментальной модели у крыс, который заключается в том, что на модели эндометриоза, полученного путем хирургического вмешательства, выполняют внутрибрюшинное введение антагониста окситоциновых рецепторов в дозировке 0,35 мг/кг каждые сутки в течение 21 дня.

Настоящее изобретение относится к области биотехнологии, конкретно к получению пептидных антираковых агентов, и может быть использовано в медицине в лечении или уменьшении интенсивности онкологического заболевания.

Изобретение относится к области биотехнологии, конкретно к рекомбинантным полипептидам для нацеливания на выделяющийся фосфатидилсерин. Описан полипептид для нацеливания на выделяющийся фосфатидилсерин, который включает: (a) домен гамма-карбоксиглутаминовой кислоты белка S, содержащий последовательность, представленную в SEQ ID NO: 1, или последовательность по меньшей мере на 95% гомологичную ей, и не содержащий домен протеазы или гормонсвязывающий домен; и (b) белок S домена EGF, где указанный полипептид конъюгирован с полезным грузом, выбранным из детектируемой метки, белковой последовательности, полиэтиленгликоля, целлюлозы, белка альбумина и терапевтического агента.

Изобретение относится к области фармацевтической промышленности, а именно к интраназальной композиции для лечения аллергического ринита. Представлена интраназальная композиция для лечения аллергического ринита, содержащая эффективное количество катионного дендримерного пептида с формулой (Arg)8(Lys)4(Lys)2Lys-Ala-Cys-NH2, находящегося в основной не солевой форме (b-LTP), выступающего в качестве носителя, и смесь молекул миРНК, подавляющих экспрессию гена IL-13 и IL-4, представленных последовательностями GGACCUGCUCUUACAUUUAtt и AAAGAUGUCUGUUACGGUCtt, соответственно, где массовое соотношение b-LTP к смеси молекул миРНК равно 12,5:1, и количество молекул миРНК в смеси является одинаковым.

Настоящее изобретение относится к биотехнологии, в частности к способам применения уровней экспрессии одного или более генов сигнатуры стромы в качестве критериев отбора для определения пациента, больного раком, который является резистентным к химиотерапии, который может получить пользу от конкретной противораковой терапии, такой как нацеленная на строму терапия, антиангиогенная терапия и/или иммунотерапия.
Изобретение относится к медицине и представляет собой способ профилактики и лечения интра- и послеоперационного паренхиматозного кровотечения при комбинированных операциях на легких с частичной или тотальной костальной плеврэктомией у больных с исходными рисками развития венозных тромбоэмболических осложнений, заключающийся в том, что интраоперационно, на этапе ревизии плевральной полости, пациенту до начала выполнения плеврэктомии внутривенно микроструйно вводят терлипрессин в стартовой дозе 1,0 мг в течение 30 минут, после чего внутривенно капельно проводят инфузию свежезамороженной плазмы: при частичной плеврэктомии – 4 мл/кг, при тотальной плеврэктомии – 11 мл/кг, далее с целью назначения ранней тромбопрофилактики больным с исходными рисками развития венозных тромбоэмболических осложнений в течение последующих 48 часов продолжают микроструйное введение терлипрессина в дозе 1 мг каждые 8 часов и назначают тромбопрофилактику фраксипарином 0,4 два раза в сутки под контролем показателей гемостаза.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая фармацевтическую композицию для лечения заболевания или расстройства, поддающегося излечению посредством ингибирования активности GDF8 (варианты), и применение вышеуказанной фармацевтической композиции для получения лекарственного средства для лечения пациента, страдающего заболеванием или расстройством, которое поддается излечению посредством ингибирования активности GDF8, для диагностики такого заболевания или расстройства или для лечения пациента с риском развития такого заболевания или расстройства.
Изобретение относится к медицине, а именно к акушерству, и может быть использовано для уменьшения кровопотери при оперативном родоразрешении у родильниц высоких групп риска.

Изобретение относится к области биохимии и медицины и представляет собой фармацевтическую композицию для лечения нейродегенеративных заболеваний, содержащую эффективное количество пептида HAEE в эквимолярном комплексе HAEE-Zn-HSA с цинком и человеческим сывороточным альбумином в форме раствора для внутривенного введения с фармацевтически приемлемым носителем, выбранным из круга нейтральных носителей и разбавителей.

Изобретение относится к медицине и касается применения пептида Селанк для протективного воздействия при общем охлаждении. Описано применение пептида формулы Thr-Lys-Pro-Arg-Pro-Gly-Pro (селанк) в качестве протекторного средства при профилактике и/или лечении общего охлаждения организма млекопитающего при интраназальном введении.

Изобретение относится к области биохимии, в частности к двухцепочечной рибонуклеиновой кислоте (дцРНК) для ингибирования экспрессии ANGPTL3, а также к ее применению для ингибирования экспрессии ANGPTL3 в клетке и для лечения индивидуума с нарушением, на которое окажет благоприятное действие снижение экспрессии ANGPTL3.

Группа изобретений относится к области медицины, а именно к жидкой фармацевтической композиции, содержащей Glu-плазминоген или биологически активный мутантный полипептид Glu-плазминогена, обладающий по меньшей мере 80 идентичностью аминокислотной последовательности с нативным полипептидом Glu-плазминогена в концентрации от 0,01 мгмл до 80 мгмл; модификатор тоничности, который представляет собой хлорид натрия, в концентрации от 30 мМ до 100 мМ, позволяющей достичь осмоляльности композиции от 180 мОсм до 350 мОсм; и стабилизатор, который представляет собой аргинин или глицин, в концентрации от 10 мМ до 100 мМ; и при этом значение pH композиции составляет от 5,0 до 8,0, также относится к применению фармацевтической композиции. Группа изобретений обеспечивает получение фармацевтической композиции Glu-плазминогена с улучшенной стабильностью. 2 н. и 19 з.п. ф-лы, 22 ил., 17 табл., 13 пр.

Наверх