Патент ru2716420

Авторы патента:


Настоящее изобретение относится к биотехнологии. Предложена композиция, содержащая систему CRISPR/Cas, для применения в лечении заболевания или расстройства печени. Указанная система за счет наличия по меньшей мере одного сигнала ядерной локализации (NLS) позволяет осуществлять эффективное редактирование генома эукариотической клетки, в связи с чем она может быть использована для редактирования у млекопитающих генов, ассоциированных с заболеваниями печени. 19 з.п. ф-лы, 98 ил., 3 табл., 41 пр.

 

Родственные заявки и включение при помощи ссылки

Заявляется приоритет по предварительным заявкам на патенты США 61/836123, поданной 17 июня 2013 г., 61/847537, поданной 17 июля 2013 г., 61/862355, поданной 5 августа 2013 г., 61/871301, поданной 28 августа 2013 г., 61/915325, поданной 12 декабря 2013 г., 61/979733, поданной 15 апреля 2014 г., и PCT/US2013/074667, поданной 12 декабря 2013 г., относительно которых применительно к США настоящая заявка также является частично продолжающей; и, как может быть разрешено согласно законодательству США, ее эквивалент в США или на национальной фазе может дополнительно заявлять и заявляет приоритет по PCT/US2013/074667 и заявкам, по которым PCT/US2013/074667 заявляет приоритет.

Вышеприведенные заявки, и все документы, цитируемые в них или во время их рассмотрения ("документы, цитируемые в заявке"), и все документы, цитируемые или упомянутые в документах, цитируемых в заявке, и все документы, цитируемые или упомянутые в данном документе ("документы, цитируемые в данном документе"), и все документы, цитируемые или упомянутые в документах, цитируемых в данном документе, вместе с любыми инструкциями изготовителя, описаниями, характеристиками продукта и технологическими картами для любых продуктов, упомянутыми в данном документе или в любом документе, включенном с помощью ссылки в данный документ, настоящим включены в данный документ с помощью ссылки и могут быть использованы в практическом осуществлении настоящего изобретения. Более конкретно, все упомянутые документы включены при помощи ссылки в такой же мере, как если бы конкретно и отдельно было указано, что каждый отдельный документ включен при помощи ссылки.

Область изобретения

Настоящее изобретение в целом относится к доставке, конструированию, оптимизации и применениям в терапии систем, способов и композиций, используемых для контроля экспрессии генов, включающего целенаправленное воздействие на последовательность, такое как внесение изменений в геном или редактирование гена, связанное с короткими палиндромными повторами, регулярно расположенными группами (CRISPR), и их компонентами. В частности, настоящее изобретение относится к аспектам, связанным с доставкой в печень для генной терапии состояний печени, пониманием функций генов в печени или ткани печени и созданием моделей печени. Печень или ткань печени включает паренхимные клетки, которые обычно называют гепатоцитами. Печень или ткань печени также может представлять собой клетки печени, являющиеся непаренхимными клетками, тем более, что такие клетки составляют 40% от общего количества клеток печени, пусть даже и всего 6,5% от ее объема; и примеры таких непаренхимных клеток из клеток или ткани печени включают синусоидальные эндотелиальные клетки печени, клетки Купфера и звездчатые клетки печени. Клетки печени экспрессируют один или несколько продуктов генов печени. Настоящее изобретение преимущественно осуществляется на практике в отношении гепатоцитов или печени или ткани печени, содержащей гепатоциты.

Заявление в отношении финансируемого из федерального бюджета исследования

Настоящее изобретение было разработано при правительственной поддержке в рамках NIH Pioneer Award (1DP1MH100706), выданного Национальными институтами здравоохранения. Правительство обладает определенными правами на настоящее изобретение.

Предпосылки изобретения

Недавние достижения в технологиях секвенирования генома и способах анализа значительно ускорили возможность каталогизации и картирования генетических факторов, ассоциированных с широким разнообразием биологических функций и заболеваний. Точные технологии целенаправленного воздействия на геном необходимы для обеспечения систематичного обратного конструирования казуальных генетических изменений путем обеспечения возможности селективного внесения изменений в отдельные генетические элементы, а также для продвижения применений в области синтетической биологии, биотехнологии и медицины. Несмотря на то, что технологии редактирования генома, такие как использование "дизайнерских" ферментов с "цинковыми пальцами", эффекторов, подобных активаторам транскрипции (TALE), или хоминг-мегануклеаз, доступны для осуществления внесения изменений в целевой геном, все еще существует необходимость в новых технологиях геномной инженерии, которые являются доступными, простыми в осуществлении, масштабируемыми и пригодными для целенаправленного воздействия на несколько положений в эукариотическом геноме.

Краткое описание изобретения

Система CRISPR-Cas не требует создания индивидуализированных белков для целенаправленного воздействия на конкретные последовательности, а скорее один фермент Cas может быть запрограммирован короткой молекулой РНК для узнавания конкретной ДНК-мишени. Добавление системы CRISPR-Cas к спектру технологий секвенирования генома и способам анализа может значительно упростить методику и ускорить возможность каталогизации и картирования генетических факторов, ассоциированных с широким спектром биологических функций и заболеваний. Для того, чтобы использовать систему CRISPR-Cas эффективно для редактирования генома без вредных воздействий, важно понимать аспекты конструирования, оптимизации и специфичной относительно типа клетки/ткани/органа доставки этих инструментов для геномной инженерии, которые являются аспектами заявленного изобретения.

Существует актуальная необходимость в альтернативных и функциональных системах и технологиях для целенаправленного воздействия на последовательность нуклеиновой кислоты с широким спектром применений. Аспекты настоящего изобретения удовлетворяют эту необходимость и предусматривают связанные с этим преимущества. Иллюстративный комплекс CRISPR содержит фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в целевом полинуклеотиде. Направляющая последовательность связана с парной tracr-последовательностью, которая, в свою очередь, гибридизируется с tracr-последовательностью.

В одном аспекте настоящее изобретение предусматривает способы применения одного или нескольких элементов системы CRISPR-Cas. Комплекс CRISPR по настоящему изобретению обеспечивает эффективное средство модификации целевого полинуклеотида. Комплекс CRISPR по настоящему изобретению характеризуется большим разнообразием полезных свойств, включающих модификацию (например, делецию, вставку, транслокацию, инактивацию, активацию) целевого полинуклеотида во множестве типов клеток в различных тканях и органах. В силу этого комплекс CRISPR по настоящему изобретению имеет широкий спектр применений в, например, редактировании генов или генома, генной терапии, изыскании новых лекарственных средств, скрининге лекарственных средств, диагностике и прогнозировании заболеваний. Предусматриваются применения in vivo, in vitro и ex vivo.

Аспекты настоящего изобретения относятся к ферментам Cas9, обладающим улучшенной специфичностью целенаправленного воздействия в печени в системе CRISPR-Cas9, имеющей направляющие РНК, характеризующиеся оптимальной активностью, имеющим меньшую длину, чем ферменты Cas9 дикого типа, и к кодирующим их молекулам нуклеиновых кислот, и к химерным ферментам Cas9, а также к способам улучшения специфичности целенаправленного воздействия фермента Cas9, или разработки системы CRISPR-Cas9, включающим разработку или получение направляющих РНК, характеризующихся оптимальной активностью, и/или выбора или получения фермента Cas9, имеющего меньшие размер или длину, чем Cas9 дикого типа, при этом упаковка кодирующей его нуклеиновой кислоты в вектор доставки является более совершенной, поскольку в векторе доставки кодирующая его часть является меньшей, чем в случае Cas9 дикого типа, и/или создания химерных ферментов Cas9.

Также представлены применения последовательностей, векторов, ферментов или систем по настоящему изобретению в медицине. Также представлены их применения в редактировании генов или генома. Это относится к тканям или клеткам печени как in, так и ex vivo.

В дополнительном аспекте настоящего изобретения фермент Cas9 может содержать одну или несколько мутаций и может применяться в качестве стандартного ДНК-связывающего белка, слитого или не слитого с функциональным доменом. Мутации могут быть мутациями, введенными искусственным образом, или мутациями приобретения или потери функции. Мутации могут включать, без ограничения, мутации в одном из каталитических доменов (D10 и Н840) среди каталитических доменов RuvC и HNH, соответственно. Дополнительные мутации были охарактеризованы и могут применяться в одной или нескольких композициях по настоящему изобретению. В одном аспекте настоящего изобретения мутантный фермент Cas9 может быть слит с белковым доменом, например, таким как домен активации транскрипции. В одном аспекте настоящего изобретения домен активации транскрипции может представлять собой VP64. В других аспектах настоящего изобретения домен репрессии транскрипции может представлять собой KRAB или SID4X. Другие аспекты настоящего изобретения относятся к мутантному ферменту Cas9, слитому с доменами, которые включают, без ограничения, активатор транскрипции, репрессор транскрипции, рекомбиназу, транспозазу, фактор ремоделирования гистонов, деметилазу, ДНК-метилтрансферазу, криптохром, домен, индуцируемый/регулируемый светом, или домен, индуцируемый/регулируемый химическими веществами.

В дополнительном варианте осуществления настоящее изобретение предусматривает способы создания мутантной tracrRNA и последовательностей прямых повторов или мутантных химерных направляющих последовательностей, обеспечивающих повышение производительности этих РНК в клетках. Аспекты настоящего изобретения также предусматривают отбор указанных последовательностей.

Аспекты настоящего изобретения также предусматривают способы упрощения клонирования и доставки компонентов комплекса CRISPR. В предпочтительном варианте осуществления настоящего изобретения подходящий промотор, такой как промотор U6, амплифицируют с ДНК-олигонуклеотидом и добавляют к направляющей РНК. Полученным в результате продуктом ПЦР можно затем трансфицировать клетки для управления экспрессией направляющей РНК. Аспекты настоящего изобретения также относятся к направляющей РНК, транскрибированной in vitro или полученной от компании, проводящей синтез, и трансфицируемой напрямую.

В одном аспекте настоящее изобретение предусматривает способы улучшения активности путем применения более активной полимеразы. В предпочтительном варианте осуществления экспрессия направляющих РНК под контролем промотора Т7 управляется экспрессией полимеразы Т7 в клетке. В преимущественном варианте осуществления клетка является эукариотической клеткой. В преимущественном варианте осуществления эукариотическая клетка является клеткой человека. В более предпочтительном варианте осуществления клетка человека является индивидуальной клеткой.

В одном аспекте настоящее изобретение предусматривает способы снижения токсичности ферментов Cas. В определенных аспектах фермент Cas представляет собой любой Cas9, описанный в данном документе, например, любой встречающийся в природе бактериальный Cas9, а также любые химерные формы, мутантные формы, гомологи или ортологи. В предпочтительном варианте осуществления Cas9 доставляют в клетку в форме мРНК. Это обеспечивает транзиентную экспрессию фермента со снижением, таким образом, токсичности. В другом предпочтительном варианте осуществления настоящее изобретение также предусматривает способы экспрессии Cas9 под контролем индуцируемого промотора и конструкции, применяемые в них.

В другом аспекте настоящее изобретение предусматривает способы улучшения применений системы CRISPR-Cas in vivo. В предпочтительном варианте осуществления фермент Cas представляет собой Cas9 дикого типа или любой из модифицированных вариантов, описанных в данном документе, в том числе любой встречающийся в природе бактериальный Cas9, а также любые химерные формы, мутантные формы, гомологи или ортологи. Преимущественный аспект настоящего изобретения предусматривает отбор гомологов Cas9, которые легко упаковываются в вирусные векторы для доставки. Ортологи Cas9, как правило, имеют общую структуру, включающую 3-4 домена RuvC и домен HNH. Наиболее близкий к 5'-концу домен RuvC расщепляет некомплементарную нить, а домен HNH расщепляет комплементарную нить. Все обозначения приведены в отношении направляющей последовательности.

Каталитический остаток в 5'-концевом домене RuvC идентифицируют посредством сравнения с целью поиска гомологии представляющего интерес Cas9 и других ортологов Cas9 (из локуса CRISPR типа II S. pyogenes, локуса 1 CRISPR S. thermophilus, локуса 3 CRISPR S. thermophilus и локуса CRISPR типа II Franciscilla novicida), и консервативный остаток Asp (D10) подвергают мутации по типу замены на аланин с превращением Cas9 в фермент, вносящий однонитевой разрыв в комплементарную нить. Аналогично, консервативные остатки His и Asn в доменах HNH подвергают мутации по типу замены на аланин с превращением Cas9 в фермент, вносящий однонитевой разрыв в некомплементарную нить. В некоторых вариантах осуществления можно осуществлять мутации из обеих групп для превращения Cas9 в неразрезающий фермент.

В некоторых вариантах осуществления фермент CRISPR представляет собой фермент CRISPR типа I или III, предпочтительно фермент CRISPR типа II. Этот фермент CRISPR типа II может быть любым ферментом Cas. Предпочтительный фермент Cas может быть идентифицирован как Cas9, поскольку он может относиться к общему классу ферментов, обладающих гомологией с самой большой нуклеазой с несколькими нуклеазными доменами системы CRISPR типа II. В наиболее предпочтительном случае фермент Cas9 получен или происходит из spCas9 или saCas9. Под происходящим заявители подразумевают, что в основе происходящего фермента главным образом лежит фермент дикого типа в том смысле, что он характеризуется высокой степенью гомологии последовательности с этим ферментом, но он был некоторым образом подвергнут мутации (модифицирован), как описано в данном документе.

Следует иметь в виду, что выражения Cas и фермент CRISPR обычно используются в данном документе взаимозаменяемо, если не очевидно иное. Как упоминается выше, многие из порядков нумерации остатков, используемых в данном документе, относятся к ферменту Cas9 из локуса CRISPR типа II Streptococcus pyogenes. Однако следует иметь в виду, что настоящее изобретение включает многие другие Cas9 из других видов микроорганизмов, такие как SpCas9, SaCas9, St1Cas9 и т.д. Дополнительные примеры представлены в данном документе. Специалист в данной области будет способен определить надлежащие соответствующие остатки в ферментах Cas9, отличных от SpCas9, путем сравнения необходимых аминокислотных последовательностей. Таким образом, если конкретное аминокислотное замещение обозначается с помощью нумерации SpCas9, то, если из контекста не очевидно, что это не предназначено для применения в отношении других ферментов Cas9, подразумевается, что настоящее раскрытие охватывает соответствующие модификации в других ферментах Cas9. Особенно предпочтительным является SaCas9.

Пример кодон-оптимизированной последовательности, в данном случае оптимизированной для человека (т.е. оптимизированной для экспрессии у человека), представлен в данном документе, см., например, кодон-оптимизированную последовательность SaCas9 для человека. Хотя это является предпочтительным, следует иметь в виду, что возможны другие примеры и что известна оптимизация кодонов для вида-хозяина, отличного от человека, или оптимизация кодонов для конкретных органов, таких как головной мозг.

В дополнительных вариантах осуществления настоящее изобретение предусматривает способы усиления функционирования Cas9 посредством образования химерных белков Cas9. Химерные белки Cas9 - химерные Cas9 - могут быть новыми Cas9, содержащими фрагменты из более чем одного встречающегося в природе Cas9. Эти способы могут включать слияние N-концевых фрагментов одного гомолога Cas9 с C-концевыми фрагментами другого гомолога Cas9. Эти способы также обеспечивают отбор новых свойств, проявляемых химерными белками Cas9.

Следует иметь в виду, что в способах по настоящему изобретению, где организм представляет собой животное или растение, модификация может иметь место ex vivo или in vitro, например, в клеточной культуре, и в ряде случаев не in vivo. В других вариантах осуществления она может иметь место in vivo.

В одном аспекте настоящее изобретение предусматривает способ модификации организма или отличного от человеческого организма путем манипуляции с целевой последовательностью в представляющем интерес локусе генома, включающий

доставку не встречающейся в природе или сконструированной композиции, содержащей:

А) - I. полинуклеотидную последовательность химерной РНК (chiRNA) системы CRISPR-Cas, где полинуклеотидная последовательность содержит:

(a) направляющую последовательность, способную гибридизироваться с целевой последовательностью в эукариотической клетке,

(b) парную tracr-последовательность и

(c) tracr-последовательность, и

II. полинуклеотидную последовательность, кодирующую фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации,

где (а), (b) и (с) расположены в 5'-3' ориентации,

где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и

где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, и полинуклеотидная последовательность, кодирующая фермент CRISPR, представляет собой ДНК или РНК,

или

(В) I. полинуклеотиды, содержащие:

(a) направляющую последовательность, способную гибридизироваться с целевой последовательностью в эукариотической клетке, и

(b) по меньшей мере одну или несколько парных tracr-последовательностей,

II. полинуклеотидную последовательность, кодирующую фермент CRISPR, и

III. полинуклеотидную последовательность, содержащую tracr-последовательность,

где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и

где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, и полинуклеотидная последовательность, кодирующая фермент CRISPR, представляет собой ДНК или РНК.

В некоторых вариантах осуществления предпочтительной является вторая вышеуказанная альтернатива. В большинстве, но не во всех аспектах настоящего раскрытия, однако, особенно предпочтительной является первая альтернатива.

Следует иметь в виду, что настоящая заявка направлена на печень, вне зависимости от того, является ли она органом как таковым, или тканью в нем, или просто одной или несколькими клетками печени, например, гепатоцитами. Предпочтительными являются первичные гепатоциты. Клетки печени могут содержаться в позвоночном животном, являющимся пациентом (в том смысле, что животное нуждается в генной терапии под управлением CRISPR) или модельным организмом, или могут находиться в клеточной культуре, органоиде или другой ткани ex vivo, такой как "печень на чипе", например, где гепатоциты высевают и выращивают на подложке. Гепатоциты, взятые из нетрансплантированных органов, также являются применимой мишенью. С учетом развития методик 3D-печати, применяемых в биологии, печатные ткани находятся в пределах доступности, и целенаправленное воздействие вполне возможно осуществить также и в клетках или тканях печени, напечатанных таким образом для создания органоида или находящихся на чипе.

Таким образом, представлен модельный организм, содержащий клетки печени, такие как гепатоциты, в которые была доставлена система CRISPR-Cas по настоящему изобретению. Аналогично, также представлено скопление ex vivo двух или более клеток печени, таких как гепатоциты, в которые была доставлена система CRISPR-Cas по настоящему изобретению. Такие скопления могут включать органы печени, органоиды печени, клетки печени, заселяющие подложку (например, такие как ‘печень на чипе’). Также представлены способы создания таких моделей или скоплений.

В частности, такие клетки печени могут экспрессировать или могут содержать полинуклеотиды, способные к экспрессии фермента Cas. Как обсуждается в данном документе, преимуществом этого является обеспечение готовой модели для исследования функций генов посредством внесения изменений в гены, в том числе нокдауна. Это является особенно применимым при изучении состояний печени, таких как амилоидоз и другие, перечисленные в данном документе, а также более обширных состояний, таких как ожирение, при которых печень является только одним из затрагиваемых компонентов организма.

В данном документе также представлены способы исследования функций генов в печени. Они обычно включают доставку в клетки печени in или ex vivo системы CRISPR-Cas. Однако если клетки уже содержат Cas, экспрессируемый в виде белка или кодируемый полинуклеотидами, уже содержащимися в клетках, тогда необходимо доставить только полинуклеотид CRISPR. Способ может включать извлечение из печени и необязательно повторное введение обратно в нее. Под доставкой в действительности подразумевают физическую доставку полинуклеотидов в ядро клетки, а также трансфекцию. Следовательно, доставку также следует понимать как включающую трансфекцию, если не очевидно иное.

Также представлен способ индукции внесения изменений в гены в одной или нескольких клетках печени, включающий трансдукцию первой популяции клеток системой CRISPR-Cas согласно настоящему изобретению с изменением, таким образом, генома первой популяции клеток и получением второй популяции клеток. Способ можно осуществлять ex vivo или in vitro, например, в клеточной культуре или в модели ex vivo или in vitro (такой как органоид или ‘печень на чипе’). В альтернативном случае способ можно осуществлять in vivo, и в этом случае он может также включать выделение первой популяции клеток из субъекта и трансплантацию второй популяции клеток (обратно) субъекту. Внесение изменений в гены может производиться в отношении одного или нескольких, или двух или более, или трех или более, или четырех или более генов. Внесение изменений в гены может представлять собой ослабление функционирования гена (т.е. активности кодируемого продукта гена). Его можно индуцировать, например, путем изменения генома первой популяции клеток с получением второй популяции клеток, где вторая популяция клеток имеет дефектный генотип, как, например, при моногенном состоянии, которое отсутствует у первой популяции клеток. Для него может требоваться соответствующая матрица для репарации, обсуждаемая в данном документе, для получения дефектной последовательности, или его можно осуществлять посредством индукции DSB. В частности, внесение изменений в гены представляет собой нокдаун генов.

В альтернативном случае внесение изменений в гены может представлять собой усиление функционирования гена (т.е. активности кодируемого продукта гена). Его можно индуцировать, например, путем изменения генома первой популяции клеток с получением второй популяции клеток, где первая популяция клеток имеет дефектный генотип, как, например, при моногенном состоянии, которое отсутствует (т.е. подвергнуто коррекции) у второй популяции клеток. Для него может требоваться соответствующая матрица для репарации, обсуждаемая в данном документе, для получения скорректированной последовательности.

Если применяется мультиплексирование, то предусматривается комбинация ослабления функционирования одного или нескольких генов и усиление функционирования одного или нескольких генов. Этого можно достичь путем обеспечения одной или нескольких направляющих последовательностей (в мультиплексе) и соответствующих матриц для репарации, которые можно применять для ослабления функционирования, и в то же время одну или несколько направляющих последовательностей и соответствующих им матриц для репарации можно применять для усиления функций.

Также представлен способ исследования функций одного или нескольких генов в одной или нескольких клетках печени, включающий определение изменений в экспрессии одного или нескольких генов в первой популяции клеток печени, индукцию указанного внесения изменений в гены в указанной первой популяции с получением указанной второй популяции с измененным геномом (или генотипом) и определение изменений в экспрессии одного или нескольких генов во второй популяции клеток печени с исследованием, таким образом, функций одного или нескольких генов.

Также представлена модель и способ создания такой модели. Модель может являться животным, имеющим печень (модель in vivo), или она может являться моделью ex vivo или in vitro, такой как органоид печени, или ‘печень на чипе’, или скопление клеток печени, как, например, на подложке, как описано в данном документе. Клетки печени в любой модели предпочтительно трансфицируют с помощью Cas9. Соответственно, определенным образом представлена модель, содержащая одну или несколько клеток печени, содержащих фермент CRISPR, предпочтительно Cas9, такой как Sa или SpCas9. Модельные клетки могут быть трансфицированы или трансдуцированы вторым регуляторным элементом, представленным в данном документе, который является вторым регуляторным элементом, функционально связанным с кодирующей фермент последовательностью, кодирующей фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации (NLS). Модель может являться, как описано выше, моделью in vivo, или она может являться моделью ex vivo или in vitro. Такая модель позволяет проводить быстрое исследование функций одного или нескольких генов, поскольку для изменения функций указанного гена необходима доставка только полинуклеотидной последовательности из системы CRISPR-Cas (содержащей одну или несколько направляющих последовательностей, осуществляющих нацеливание на указанные один или несколько генов). Другими словами, способы исследования функций генов в таких моделях могут включать только доставку полинуклеотидной последовательности из системы CRISPR-Cas (содержащей одну или несколько направляющих последовательностей), при этом наличие Cas (фермента CRISPR) в клетке(клетках) модели уже было обеспечено. Также представлены способы создания таких моделей, включающие трансдукцию или трансфекцию одной или нескольких клеток печени в первой популяции клеток печени вторым регуляторным элементом, функционально связанным с кодирующей фермент последовательностью, кодирующей фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации (NLS), как описано в данном документе, с получением, таким образом, одной или нескольких клеток печени второй популяции, содержащих или экспрессирующих фермент CRISPR.

Также представлены способы создания моделей с внесенными изменениями в генах, в частности, моделей с нокдауном генов. Эти способы обычно могут включать индукцию внесения изменений в гены в одном или нескольких генах, как описано в данном документе, в первой популяции клеток с получением, таким образом, второй популяции клеток с измененным геномом (или генотипом). Вторую популяцию клеток можно затем высеять на подложку или на чип, например, с получением, таким образом, модели ex vivo или in vitro. В альтернативном случае вторая популяция может содержаться в животном in vivo.

Также предусмотрены способы генной терапии. Например, коррекцию одного или нескольких дефектных генотипов (например, одиночных точечных мутаций) можно осуществить посредством применения системы CRISPR-Cas по настоящему изобретению в клетках печени, обсуждаемых в данном документе (в том числе в моделях). Моногенные состояния, связанные с печенью, являются особенно предпочтительными и проиллюстрированы на примере в данном документе, см. пример 38, в котором мишенью системы CRISPR-Cas9, для которой она была эффективной в индукции фенотипического изменения in vivo, являлся АроВ, ген, участвующий в метаболизме липидов. Также представлены композиции для применения в генной терапии.

Хотя предусмотрены различные ферменты Cas, Cas9 является особенно предпочтительным, и авторами настоящего изобретения была продемонстрирована особенная эффективность SaCa9 в печени. Tracr-последовательность из Sa также является предпочтительной, если фермент Cas является ферментом Cas Sa. Подходящим РАМ в данном случае является NNGRR. Для Cas9 S. pyogenes или происходящих из него ферментов подходящим РАМ является 5'-NRG.

Хотя можно применять одну направляющую последовательность, так называемое мультиплексирование с двумя, тремя, четырьмя или более направляющими последовательностями является особенно применимым в исследовании функций генов и создании моделей (с получением нокдауна нескольких генов), а также в генной терапии, когда коррекции подлежат несколько дефектных генотипов (несколько ошибок в одном гене либо, с большей долей вероятности, несколько ошибок, распределенных среди нескольких генов). В альтернативном случае мультиплексирование с двумя направляющими последовательностями применимо в подходе с двойной никазой для снижения частоты нецелевых эффектов или попросту для отбора нескольких мишеней в одном гене для обеспечения привлечения Cas. Предпочтительными являются тройные и четверные направляющие последовательности. В данном документе на ген и локус генома ссылаются взаимозаменяемо.

Также применимым в этом отношении является подход с интроном, описанный в данном документе, где направляющая последовательность расположена в интроне Cas.

Предпочтительные средства доставки включают способы, описанные Kanasty ниже, такие как LNP, особенно если доставке подлежит только направляющая последовательность или она подлежит доставке в отдельности. Тем не менее, для печени, как правило, предпочтительными являются вирусные векторы, в том числе лентивирусные и AAV, поскольку до сих пор они были успешными. Среди них предпочтительным является AAV и особенно серотип 8, при этом было показано, что AAV2/8 является эффективным.

Некоторые предпочтительные мишени, при условии, что они присутствуют, или состояния печени означают нарушения метаболизма, такие как любое из следующих: амилоидная невропатия (TTR, PALB); амилоидоз (АРОА1, АРР, AAA, CVAP, AD1, GSN, FGA, LYZ, TTR, PALB); цирроз (KRT18, KRT8, CIRH1A, NAIC, TEX292, KIAA1988); муковисцидоз (CFTR, ABCC7, CF, MRP7); болезни накопления гликогена (SLC2A2, GLUT2, G6PC, G6PT, G6PT1, GAA, LAMP2, LAMPB, AGL, GDE, GBE1, GYS2, PYGL, PFKM); аденома печени, 142330 (TCF1, HNF1A, MODY3), печеночная недостаточность с ранним началом и с неврологическим нарушением (SCOD1, SCO1), недостаточность печеночной липазы (LIPC), гепатобластома, рак и виды эпителиомы (CTNNB1, PDGFRL, PDGRL, PRLTS, AXIN1, AXIN, CTNNB1, ТР53, Р53, LFS1, IGF2R, MPRI, MET, CASP8, МСН5); заболевание по типу медуллярной кистозной нефропатии (UMOD, HNFJ, FJHN, MCKD2, ADMCKD2); фенилкетонурия (РАН, PKU1, QDPR, DHPR, PTS); поликистоз почек и печени (FCYT, PKHD1, ARPKD, PKD1, PKD2, PKD4, PKDTS, PRKCSH, G19P1, PCLD, SEC63). Другие предпочтительные мишени включают любой один или несколько из PCSK9; Hmgcr; SERPINA1; АроВ и/или LDL.

Следует иметь в виду, что способы изменения экспрессии в печени не включают изменение в зародышевой линии, которое может быть исключено по моральным соображениям. В действительности, хотя трансфекция стволовых клеток предусмотрена и является безусловно предпочтительной в некоторых вариантах осуществления, первичные гепатоциты являются особенно предпочтительными, в особенности если они должны демонстрировать некоторую регенерацию или быть стимулированы для ее демонстрации.

CRISPR типа II являются особенно предпочтительными, в частности, для применения у эукариот, как в данном случае, когда при любых обстоятельствах печень обнаруживается только у эукариот, в частности, у позвоночных животных.

Применение систем CRISPR-Cas для того, чтобы вызвать фенотипическое изменение, в частности, in vivo, является особенным преимуществом. Авторы настоящего изобретения продемонстрировали это в настоящей заявке.

Если предусмотрены применения в терапии или другая геномная инженерия в печени, то при необходимости коррекции следует иметь в виду, что после внесения однонитевого разрыва в геномную ДНК-мишень или ее расщепления предпочтительной является последующая коррекция посредством пути HDR. Для нокдауна генов преимущественным является NHEJ, однако, для терапии предпочтительной является коррекция посредством пути HDR. В таких случаях предпочтительной является доставка матрицы для репарации. Она наиболее предпочтительно представляет собой ssDNA, хотя также возможно использование РНК посредством ретровирусного вектора, обеспечивающего наличие соответствующей ДНК-матрицы. Специалист в данной области может без труда осуществлять настоящее изобретение на практике на основании изложенных в данном документе идей, вносящих вклад в уровень техники; и в этом отношении упоминается, что специалист в данной области на основании изложенных в данном документе идей, вносящих вклад в уровень техники, может без труда понимать и внедрять соображения, касающиеся длины гомологичных плеч. Упоминаются патентные заявки и публикации изобретателя Zhang, включенные в данный документ, в том числе цитируемые в данном документе. Матрицу для репарации предпочтительно доставляют совместно с одним или несколькими элементами системы CRISPR-Cas.

Также представлен способ изменения экспрессии по меньшей мере одного продукта гена в печени, включающий введение в эукариотическую клетку печени, например, гепатоцит, содержащую и экспрессирующую молекулу ДНК, имеющую целевую последовательность и кодирующую продукт гена, сконструированной не встречающейся в природе системы коротких палиндромных повторов, регулярно расположенных группами (CRISPR), и CRISPR-ассоциированных генов (Cas) (CRISPR-Cas), содержащей один или несколько векторов, содержащих:

a) первый регуляторный элемент, функционирующий в эукариотической клетке, функционально связанный по меньшей мере с одной нуклеотидной последовательностью, кодирующей направляющую РНК системы CRISPR-Cas, которая гибридизируется с целевой последовательностью, и

b) второй регуляторный элемент, функционирующий в эукариотической клетке, функционально связанный с нуклеотидной последовательностью, кодирующей белок Cas9 типа II,

где компоненты (а) и (b) находятся в одном и том же или в разных векторах системы, в результате чего направляющая РНК осуществляет нацеливание на целевую последовательность, а белок Cas9 расщепляет молекулу ДНК, в результате чего экспрессия по меньшей мере одного продукта гена в печени изменяется; и где белок Cas9 и направляющая РНК не встречаются вместе в естественных условиях.

Мишени, на которые ссылаются ниже, понимают как мишени в печени или другие гены, экспрессируемые в печени, если не очевидно иное.

Любая или все из полинуклеотидной последовательности, кодирующей фермент CRISPR, направляющей последовательности, парной tracr-последовательности или tracr-последовательности могут представлять собой РНК. Полинуклеотиды, содержащие последовательность, кодирующую фермент CRISPR, направляющую последовательность, парную tracr-последовательность или tracr-последовательность, могут представлять собой РНК, и их могут доставлять посредством липосом, наночастиц, экзосом, микропузырьков или генной пушки.

Следует иметь в виду, что если ссылаются на полинуклеотид, который представляет собой РНК и, как говорят, ‘содержит’ признак, такой как парная tracr-последовательность, то последовательность РНК содержит данный признак. Если полинуклеотид представляет собой ДНК и, как говорят, содержит признак, такой как парная tracr-последовательность, то последовательность ДНК транскрибируется или может быть транскрибирована в РНК, содержащую признак, о котором идет речь. Если признак представляет собой белок, такой как фермент CRISPR, то упоминаемая последовательность ДНК или РНК транслируется или может быть транслирована (а в случае ДНК сначала транскрибируется).

Соответственно, в определенных вариантах осуществления настоящее изобретение предусматривает способ модификации печени организма, например, млекопитающего, в том числе человека, или отличного от человека млекопитающего или организма путем манипуляции с целевой последовательностью в представляющем интерес локусе генома, включающий доставку не встречающейся в природе или сконструированной композиции, содержащей вирусную или плазмидную векторную систему, содержащую один или несколько вирусных или плазмидных векторов, функционально кодирующих композицию для ее экспрессии, где композиция содержит: (А) не встречающуюся в природе или сконструированную композицию, содержащую векторную систему, содержащую один или несколько векторов, содержащих I. первый регуляторный элемент, функционально связанный с полинуклеотидной последовательностью химерной РНК (chiRNA) системы CRISPR-Cas, где полинуклеотидная последовательность содержит (а) направляющую последовательность, способную гибридизироваться с целевой последовательностью в эукариотической клетке, (b) парную tracr-последовательность и (с) tracr-последовательность, и II. второй регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации (или необязательно по меньшей мере одну или несколько последовательностей ядерной локализации, поскольку некоторые варианты осуществления могут не включать NLS), где (а), (b) и (с) расположены в 5'-3' ориентации, где компоненты I и II находятся в одном и том же или разных векторах системы, где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, или (В) не встречающуюся в природе или сконструированную композицию, содержащую векторную систему, содержащую один или несколько векторов, содержащих I. первый регуляторный элемент, функционально связанный с (а) направляющей последовательностью, способной гибридизироваться с целевой последовательностью в эукариотической клетке, и (b) по меньшей мере одной или несколькими парными tracr-последовательностями, И. второй регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, и III. третий регуляторный элемент, функционально связанный с tracr-последовательностью, где компоненты I, II и III находятся в одном и том же или разных векторах системы, где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью. В некоторых вариантах осуществления компоненты I, II и III находятся в одном и том же векторе. В других вариантах осуществления компоненты I и II находятся в одном и том же векторе, тогда как компонент III находится в другом векторе. В других вариантах осуществления компоненты I и III находятся в одном и том же векторе, тогда как компонент II находится в другом векторе. В других вариантах осуществления компоненты II и III находятся в одном и том же векторе, тогда как компонент I находится в другом векторе. В других вариантах осуществления каждый из компонентов I, II и III находится в отдельном векторе. Настоящее изобретение также предусматривает вирусную или плазмидную векторную систему, описанную в данном документе.

Вектор предпочтительно представляет собой вирусный вектор, как, например, векторы на основе лентивируса, или бакуловируса, или, предпочтительно, аденовируса/аденоассоциированного вируса, но известны и предусмотрены другие средства доставки (такие как дрожжевые системы, микропузырьки, генные пушки/средства прикрепления векторов к наночастицам золота). В некоторых вариантах осуществления один или несколько вирусных или плазмидных векторов можно доставлять посредством липосом, наночастиц, экзосом, микропузырьков или генной пушки.

Под манипуляцией с целевой последовательностью заявители также подразумевают эпигенетическую манипуляцию с целевой последовательностью. Она может осуществляться в отношении состояния хроматина целевой последовательности, как, например, путем модификации состояния метилирования целевой последовательности (т.е. добавление или устранение метилирования, или паттернов метилирования, или CpG-островков), модификации гистонов, повышения или снижения доступности целевой последовательности, или путем активации укладки в 3D-структуру.

Следует иметь в виду, что если ссылаются на способ модификации организма или млекопитающего, в том числе человека, или отличного от человека млекопитающего или организма путем манипуляции с целевой последовательностью в представляющем интерес локусе генома, тогда его можно использовать в отношении организма (или млекопитающего) в целом или всего лишь одной клетки или популяции клеток из этого организма (если организм является многоклеточным). В случае человека, например, заявители предусматривают, помимо прочего, одну клетку или популяцию клеток, и их можно предпочтительно модифицировать ex vivo и затем вводить обратно. В этом случае может быть необходим биоптат или другой образец ткани или биологической жидкости. Стволовые клетки также являются особенно предпочтительными в этом отношении. Но, разумеется, также предусматриваются варианты осуществления in vivo.

В определенных вариантах осуществления настоящее изобретение предусматривает способ лечения или подавления состояния, вызванного дефектом в целевой последовательности в представляющем интерес локусе генома у субъекта (например, млекопитающего или человека) или отличного от человека субъекта (например, млекопитающего), нуждающегося 'в этом, включающий модификацию субъекта или отличного от человека субъекта путем манипуляции с целевой последовательностью, и где состояние является чувствительным к лечению или подавлению путем манипуляции с целевой последовательностью, включающий обеспечение лечения, предусматривающего: доставку не встречающейся в природе или сконструированной композиции, содержащей векторную систему на основе AAV или лентивируса, содержащую один или несколько векторов на основе AAV или лентивируса, функционально кодирующих композицию для ее экспрессии, где манипуляцию с целевой последовательностью осуществляют с помощью композиции при ее экспрессии, где композиция содержит: (А) не встречающуюся в природе или сконструированную композицию, содержащую векторную систему, содержащую один или несколько векторов, содержащих I. первый регуляторный элемент, функционально связанный с полинуклеотидной последовательностью химерной РНК (chiRNA) системы CRISPR-Cas, где полинуклеотидная последовательность содержит (а) направляющую последовательность, способную гибридизироваться с целевой последовательностью в эукариотической клетке, (b) парную tracr-последовательность и (с) tracr-последовательность, и II. второй регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации (или необязательно по меньшей мере одну или несколько последовательностей ядерной локализации, поскольку некоторые варианты осуществления могут не включать NLS), где (а), (b) и (с) расположены в 5'-3' ориентации, где компоненты I и II находятся в одном и том же или разных векторах системы, где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, или (В) не встречающуюся в природе или сконструированную композицию, содержащую векторную систему, содержащую один или несколько векторов, содержащих I. первый регуляторный элемент, функционально связанный с (а) направляющей последовательностью, способной гибридизироваться с целевой последовательностью в эукариотической клетке, и (b) по меньшей мере одной или несколькими парными tracr-последовательностями, II. второй регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, и III. третий регуляторный элемент, функционально связанный с tracr-последовательностью, где компоненты I, II и III находятся в одном и том же или разных векторах системы, где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью. В некоторых вариантах осуществления компоненты I, II и III находятся в одном и том же векторе. В других вариантах осуществления компоненты I и II находятся в одном и том же векторе, тогда как компонент III находится в другом векторе. В других вариантах осуществления компоненты I и III находятся в одном и том же векторе, тогда как компонент II находится в другом векторе. В других вариантах осуществления компоненты II и III находятся в одном и том же векторе, тогда как компонент I находится в другом векторе. В других вариантах осуществления каждый из компонентов I, II и III находится в отдельном векторе. Настоящее изобретение также предусматривает вирусную (например, на основе AAV или лентивируса) векторную систему, описанную в данном документе, и она может быть частью векторной системы, описанной в данном документе.

Некоторые способы по настоящему изобретению могут включать индукцию экспрессии. Организм или субъект является эукариотом (в том числе млекопитающим, в том числе человеком), или отличным от человека эукариотом, или отличным от человека животным, или отличным от человека млекопитающим, при условии, что у него есть печень или функция печени. В некоторых вариантах осуществления организм или субъект является отличным от человека животным и может быть членистоногим, например, насекомым, или может быть нематодой. В некоторых способах по настоящему изобретению организм или субъект является млекопитающим или отличным от человека млекопитающим. Отличное от человека млекопитающее может быть, например, грызуном (предпочтительно мышью или крысой), копытным или приматом. В некоторых способах по настоящему изобретению вирусный вектор представляет собой AAV или лентивирус и может быть частью векторной системы, описанной в данном документе. В некоторых способах по настоящему изобретению фермент CRISPR представляет собой Cas9. В некоторых способах по настоящему изобретению экспрессия направляющей последовательности находится под контролем промотора Т7 и управляется экспрессией полимеразы Т7.

Настоящее изобретение в некоторых вариантах осуществления охватывает способ доставки фермента CRISPR, включающий доставку в клетку мРНК, кодирующей фермент CRISPR. В некоторых из данных способов фермент CRISPR представляет собой Cas9.

Настоящее изобретение также предусматривает способы получения векторных систем по настоящему изобретению, в частности, вирусных векторных систем, описанных в данном документе. Настоящее изобретение в некоторых вариантах осуществления охватывает способ получения AAV по настоящему изобретению, включающий трансфекцию плазмиды(плазмид), содержащих молекулу(молекулы) нуклеиновой кислоты, кодирующие AAV, или по сути состоящих из них, в клетки, инфицированные AAV, и обеспечение rep и/или cap AAV, обязательных для репликации и упаковки AAV. В некоторых вариантах осуществления rep и/или cap AAV, обязательные для репликации и упаковки AAV, обеспечивают путем трансфекции клеток плазмидой-помощником(плазмидами-помощниками) или вирусом-помощником(вирусами-помощниками). В некоторых вариантах осуществления вирусом-помощником является поксвирус, аденовирус, герпесвирус или бакуловирус. В некоторых вариантах осуществления поксвирус представляет собой вирус осповакцины. В некоторых вариантах осуществления клетки являются клетками млекопитающих. А в некоторых вариантах осуществления клетки являются клетками насекомых, а вирус-помощник представляет собой бакуловирус. В других вариантах осуществления вирус представляет собой лентивирус.

Настоящее изобретение дополнительно охватывает композицию по настоящему изобретению или ее фермент CRISPR (в том числе, или в альтернативном случае, мРНК, кодирующую фермент CRISPR) для применения в медицине или в терапии. В некоторых вариантах осуществления настоящее изобретение охватывает композицию согласно настоящему изобретению или ее фермент CRISPR (в том числе, или в альтернативном случае, мРНК, кодирующую фермент CRISPR) для применения в способе согласно настоящему изобретению. В некоторых вариантах осуществления настоящее изобретение предусматривает применение композиции по настоящему изобретению или ее фермента CRISPR (в том числе, или в альтернативном случае, мРНК, кодирующей фермент CRISPR) в редактировании генов или генома ex vivo. В определенных вариантах осуществления настоящее изобретение охватывает применение композиции по настоящему изобретению или ее фермента CRISPR (в том числе, или в альтернативном случае, мРНК, кодирующей фермент CRISPR) в производстве лекарственного препарата для редактирования генов или генома ex vivo или для применения в способе согласно настоящему изобретению. Настоящее изобретение в некоторых вариантах осуществления охватывает композицию по настоящему изобретению или ее фермент CRISPR (в том числе, или в альтернативном случае, мРНК, кодирующую фермент CRISPR), где целевая последовательность фланкирована на своем 3'-конце РАМ-последовательностью (мотивом, прилегающим к протоспейсеру), содержащей 5'-концевой мотив, особенно если Cas9 получен из (или происходит из) Cas9 S. pyogenes или S. aureus. Например, подходящий РАМ представляет собой 5'-NRG или 5'-NNGRR (где N представляет собой любой нуклеотид) для ферментов SpCas9 или SaCas9 (или происходящих из них ферментов), соответственно, как отмечено ниже.

Следует иметь в виду, что SpCas9 или SaCas9 получены или происходят из Cas9 S. pyogenes или S. aureus. Они, разумеется, могут быть подвергнуты мутации или иным образом изменены по сравнению с диким типом для соответствия предполагаемому применению, описанному в данном документе. Предпочтительными являются мутантная форма или вариант двойной никазы D10A, особенно в комбинации с двумя перекрывающимися направляющими последовательностями, ориентированными как противоположные сайты в различных нитях одной и той же хромосомы.

Аспекты настоящего изобретения охватывают улучшение специфичности фермента CRISPR, например, Cas9, опосредующей целенаправленное воздействие на гены, и снижение вероятности нецелевой модификации ферментом CRISPR, например, Cas9. Настоящее изобретение в некоторых вариантах осуществления охватывает способ модификации организма или отличного от человеческого организма посредством сведения к минимуму нецелевых модификаций путем манипуляции с первой и второй целевыми последовательностями на противоположных нитях ДНК-дуплекса в представляющем интерес локусе генома в клетке, включающий доставку не встречающейся в природе или сконструированной композиции, содержащей:

I. первую полинуклеотидную последовательность химерной РНК (chiRNA) системы CRISPR-Cas, где первая полинуклеотидная последовательность содержит:

(a) первую направляющую последовательность, способную гибридизироваться с первой целевой последовательностью,

(b) первую парную tracr-последовательность и

(c) первую tracr-последовательность,

II. вторую полинуклеотидную последовательность chiRNA системы CRISPR-Cas, где вторая полинуклеотидная последовательность содержит:

(a) вторую направляющую последовательность, способную гибридизироваться со второй целевой последовательностью,

(b) вторую парную tracr-последовательность и

(c) вторую tracr-последовательность, и

III. полинуклеотидную последовательность, кодирующую фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации и содержащий одну или несколько мутаций, где (а), (b) и (с) расположены в 5'-3' ориентации, где при транскрипции первая и вторая парные tracr-последовательности гибридизируются с первой и второй tracr-последовательностями, соответственно, а первая и вторая направляющие последовательности управляют специфичным к последовательности связыванием первого и второго комплексов CRISPR с первой и второй целевыми последовательностями, соответственно, где первый комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) первой направляющей последовательностью, которая гибридизируется или способна к гибридизации с первой целевой последовательностью, и (2) первой парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с первой tracr-последовательностью, где второй комплекс CRISPR содержит фермент CRISPR, образующий комплекс со (1) второй направляющей последовательностью, которая гибридизируется или способна к гибридизации со второй целевой последовательностью, и (2) второй парной tracr-последовательностью, которая гибридизируется или способна к гибридизации со второй tracr-последовательностью, где полинуклеотидная последовательность, кодирующая фермент CRISPR, представляет собой ДНК или РНК, и где первая направляющая последовательность управляет расщеплением одной нити ДНК-дуплекса возле первой целевой последовательности, а вторая направляющая последовательность управляет расщеплением другой нити возле второй целевой последовательности, индуцируя двухнитевой разрыв, с модификацией, таким образом, организма или отличного от человеческого организма посредством сведения к минимуму нецелевых модификаций.

В некоторых способах по настоящему изобретению любая или все из полинуклеотидной последовательности, кодирующей фермент CRISPR, первой и второй направляющих последовательностей, первой и второй парных tracr-последовательностей или первой и второй tracr-последовательностей представляет собой/представляют собой РНК. В дополнительных вариантах осуществления настоящего изобретения полинуклеотиды, содержащие последовательность, кодирующую фермент CRISPR, первую и вторую направляющие последовательности, первую и вторую парные tracr-последовательности или первую и вторую tracr-последовательности, представляют собой РНК, и их доставляют посредством липосом, наночастиц, экзосом, микропузырьков или генной пушки. В определенных вариантах осуществления настоящего изобретения первая и вторая парные tracr-последовательности обладают 100% идентичностью, и/или первая и вторая tracr-последовательности обладают 100% идентичностью. В некоторых вариантах осуществления полинуклеотиды могут содержаться в векторной системе, содержащей один или несколько векторов. В предпочтительных вариантах осуществления настоящего изобретения фермент CRISPR представляет собой фермент Cas9, например, SpCas9. В аспекте настоящего изобретения фермент CRISPR содержит одну или несколько мутаций в каталитическом домене, где одна или несколько мутаций выбраны из группы, состоящей из D10A, Е762А, Н840А, N854A, N863A и D986A. В особенно предпочтительном варианте осуществления фермент CRISPR имеет мутацию D10A. В предпочтительных вариантах осуществления первый фермент CRISPR имеет одну или несколько мутаций, вследствие которых фермент является ферментом, вносящим однонитевой разрыв в комплементарную нить, а второй фермент CRISPR имеет одну или несколько мутаций, вследствие которых фермент является ферментом, вносящим однонитевой разрыв в некомплементарную нить. В альтернативном случае первый фермент может являться ферментом, вносящим однонитевой разрыв в некомплементарную нить, а второй фермент может являться ферментом, вносящим однонитевой разрыв в комплементарную нить.

В предпочтительных способах по настоящему изобретению первая направляющая последовательность, управляющая расщеплением одной нити ДНК-дуплекса возле первой целевой последовательности, и вторая направляющая последовательность, управляющая расщеплением другой нити возле второй целевой последовательности, обуславливают возникновение "липкого" 5'-конца. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит не более 200 пар оснований, предпочтительно не более 100 пар оснований или более предпочтительно не более 50 пар оснований. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит по меньшей мере 26 пар оснований, предпочтительно по меньшей мере 30 пар оснований или более предпочтительно 34-50 пар оснований. Перекрывание наиболее предпочтительно охватывает от 5 до -1 пары оснований.

Настоящее изобретение в некоторых вариантах осуществления охватывает способ модификации организма или отличного от человеческого организма посредством сведения к минимуму нецелевых модификаций путем манипуляции с первой и второй целевыми последовательностями на противоположных нитях ДНК-дуплекса в представляющем интерес локусе генома в клетке, включающий доставку не встречающейся в природе или сконструированной композиции, содержащей векторную систему, содержащую один или несколько векторов, содержащих:

I. первый регуляторный элемент, функционально связанный с

(a) первой направляющей последовательностью, способной гибридизироваться с первой целевой последовательностью, и

(b) по меньшей мере одной или несколькими парными tracr-последовательностями,

II. второй регуляторный элемент, функционально связанный со

(а) второй направляющей последовательностью, способной гибридизироваться со второй целевой последовательностью, и

(b) по меньшей мере одной или несколькими парными tracr-последовательностями,

III. третий регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, и

IV. четвертый регуляторный элемент, функционально связанный с tracr-последовательностью,

где компоненты I, II, III и IV находятся в одном и том же или разных векторах системы, где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а первая и вторая направляющие последовательности управляют специфичным к последовательности связыванием первого и второго комплексов CRISPR с первой и второй целевыми последовательностями, соответственно, где первый комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) первой направляющей последовательностью, которая гибридизируется или способна к гибридизации с первой целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, где второй комплекс CRISPR содержит фермент CRISPR, образующий комплекс со (1) второй направляющей последовательностью, которая гибридизируется или способна к гибридизации со второй целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, где полинуклеотидная последовательность, кодирующая фермент CRISPR, представляет собой ДНК или РНК, и где первая направляющая последовательность управляет расщеплением одной нити ДНК-дуплекса возле первой целевой последовательности, а вторая направляющая последовательность управляет расщеплением другой нити возле второй целевой последовательности, индуцируя двухнитевой разрыв, с модификацией, таким образом, организма или отличного от человеческого организма посредством сведения к минимуму нецелевых модификаций.

Настоящее изобретение также предусматривает векторную систему, описанную в данном документе. Система может содержать один, два, три или четыре различных вектора. Компоненты I, II, III и IV могут, таким образом, находиться в одном, двух, трех или четырех различных векторах, и в данном документе предусмотрены все комбинации возможных местоположений компонентов, например: компоненты I, II, III и IV могут находиться в одном и том же векторе; каждый из компонентов I, II, III и IV может находиться в отдельном векторе; компоненты I, II, III и IV могут находиться в общей сложности в двух или трех различных векторах, при этом предусмотрены все комбинации местоположений, и т.п.

В некоторых способах по настоящему изобретению любая или все из полинуклеотидной последовательности, кодирующей фермент CRISPR, первой и второй направляющих последовательностей, первой и второй парных tracr-последовательностей или первой и второй tracr-последовательностей представляет собой/представляют собой РНК. В дополнительных вариантах осуществления настоящего изобретения первая и вторая парные tracr-последовательности обладают 100% идентичностью, и/или первая и вторая tracr-последовательности обладают 100% идентичностью. В предпочтительных вариантах осуществления настоящего изобретения фермент CRISPR представляет собой фермент Cas9, например, SpCas9. В аспекте настоящего изобретения фермент CRISPR содержит одну или несколько мутаций в каталитическом домене, где одна или несколько мутаций выбраны из группы, состоящей из D10A, Е762А, Н840А, N854A, N863A и D986A. В особенно предпочтительном варианте осуществления фермент CRISPR имеет мутацию D10A. В предпочтительных вариантах осуществления первый фермент CRISPR имеет одну или несколько мутаций, вследствие которых фермент является ферментом, вносящим однонитевой разрыв в комплементарную нить, а второй фермент CRISPR имеет одну или несколько мутаций, вследствие которых фермент является ферментом, вносящим однонитевой разрыв в некомплементарную нить. В альтернативном случае первый фермент может являться ферментом, вносящим однонитевой разрыв в некомплементарную нить, а второй фермент может являться ферментом, вносящим однонитевой разрыв в комплементарную нить. В дополнительном варианте осуществления настоящего изобретения один или несколько вирусных векторов доставляют посредством липосом, наночастиц, экзосом, микропузырьков или генной пушки.

В предпочтительных способах по настоящему изобретению первая направляющая последовательность, управляющая расщеплением одной нити ДНК-дуплекса возле первой целевой последовательности, и вторая направляющая последовательность, управляющая расщеплением другой нити возле второй целевой последовательности, обуславливают возникновение "липкого" 5'-конца. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит не более 200 пар оснований, предпочтительно не более 100 пар оснований или более предпочтительно не более 50 пар оснований. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит по меньшей мере 26 пар оснований, предпочтительно по меньшей мере 30 пар оснований или более предпочтительно 34-50 пар оснований.

Настоящее изобретение в некоторых вариантах осуществления охватывает способ модификации представляющего интерес локуса генома посредством сведения к минимуму нецелевых модификаций путем введения в клетку, содержащую и экспрессирующую двухнитевую молекулу ДНК, кодирующую представляющий интерес продукт гена, сконструированной не встречающейся в природе системы CRISPR-Cas, содержащей белок Cas, имеющий одну или несколько мутаций, и две направляющие РНК, которые осуществляют нацеливание на первую нить и вторую нить молекулы ДНК, соответственно, при этом направляющие РНК осуществляют нацеливание на молекулу ДНК, кодирующую продукт гена, а белок Cas вносит однонитевой разрыв в каждую из первой нити и второй нити молекулы ДНК, кодирующей продукт гена, в результате чего экспрессия продукта гена изменяется; и где белок Cas и две направляющие РНК не встречаются вместе в естественных условиях.

В предпочтительных способах по настоящему изобретению белок Cas вносит однонитевой разрыв в каждую из первой нити и второй нити молекулы ДНК, кодирующей продукт гена, что обуславливает возникновение "липкого" 5'-конца. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит не более 200 пар оснований, предпочтительно не более 100 пар оснований или более предпочтительно не более 50 пар оснований. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит по меньшей мере 26 пар оснований, предпочтительно по меньшей мере 30 пар оснований или более предпочтительно 34-50 пар оснований.

Варианты осуществления настоящего изобретения также охватывают направляющие РНК, содержащие направляющую последовательность, слитую с парной tracr-последовательностью и tracr-последовательностью. В аспекте настоящего изобретения белок Cas является кодон-оптимизированным для экспрессии в эукариотической клетке, предпочтительно в клетке млекопитающего или клетке человека. В дополнительных вариантах осуществления настоящего изобретения белок Cas представляет собой белок системы CRISPR-Cas типа II, например, белок Cas9. В особенно предпочтительном варианте осуществления белок Cas представляет собой белок Cas9, например, SpCas9. В аспектах настоящего изобретения белок Cas имеет одну или несколько мутаций, выбранных из группы, состоящей из D10A, Е762А, Н840А, N854A, N863A и D986A. В особенно предпочтительном варианте осуществления белок Cas имеет мутацию D10A.

Аспекты настоящего изобретения относятся к снижению экспрессии продукта гена, или к дополнительному введению матричного полинуклеотида в молекулу ДНК, кодирующую продукт гена, или к точному вырезанию вставочной последовательности путем обеспечения повторного отжига и лигирования двух "липких" 5'-концов, или к изменению активности или функционирования продукта гена, или к повышению экспрессии продукта гена. В варианте осуществления настоящего изобретения продукт гена представляет собой белок.

Настоящее изобретение также охватывает сконструированную не встречающуюся в природе систему CRISPR-Cas, содержащую белок Cas с одной или несколькими мутациями, и две направляющие РНК, которые осуществляют нацеливание на первую нить и вторую нить, соответственно, двухнитевой молекулы ДНК, кодирующей продукт гена в клетке, при этом направляющие РНК осуществляют нацеливание на молекулу ДНК, кодирующую продукт гена, а белок Cas вносит однонитевой разрыв в каждую из первой нити и второй нити молекулы ДНК, кодирующей продукт гена, в результате чего экспрессия продукта гена изменяется; и где белок Cas и две направляющие РНК не встречаются вместе в естественных условиях.

В аспектах настоящего изобретения направляющие РНК могут содержать направляющую последовательность, слитую с парной tracr-последовательностью и tracr-последовательностью. В варианте осуществления настоящего изобретения белок Cas представляет собой белок системы CRISPR-Cas типа II. В аспекте настоящего изобретения белок Cas является кодон-оптимизированным для экспрессии в эукариотической клетке, предпочтительно в клетке млекопитающего или клетке человека. В дополнительных вариантах осуществления настоящего изобретения белок Cas представляет собой белок системы CRISPR-Cas типа II, например, белок Cas9. В особенно предпочтительном варианте осуществления белок Cas представляет собой белок Cas9, например, SpCas9. В аспектах настоящего изобретения белок Cas имеет одну или несколько мутаций, выбранных из группы, состоящей из D10A, Е762А, Н840А, N854A, N863A и D986A. В особенно предпочтительном варианте осуществления белок Cas имеет мутацию D10A.

Аспекты настоящего изобретения относятся к снижению экспрессии продукта гена, или к дополнительному введению матричного полинуклеотида в молекулу ДНК, кодирующую продукт гена, или к точному вырезанию вставочной последовательности путем обеспечения повторного отжига и лигирования двух "липких" 5'-концов, или к изменению активности или функционирования продукта гена, или к повышению экспрессии продукта гена. В варианте осуществления настоящего изобретения продукт гена представляет собой белок.

Настоящее изобретение также охватывает сконструированную не встречающуюся в природе векторную систему, содержащую один или несколько векторов, содержащих:

а) первый регуляторный элемент, функционально связанный с каждой из двух направляющих РНК системы CRISPR-Cas, которые осуществляют нацеливание на первую нить и вторую нить, соответственно, двухнитевой молекулы ДНК, кодирующей продукт гена,

b) второй регуляторный элемент, функционально связанный с белком Cas,

где компоненты (а) и (b) находятся в одном и том же или разных векторах системы, при этом направляющие РНК осуществляют нацеливание на молекулу ДНК, кодирующую продукт гена, а белок Cas вносит однонитевой разрыв в каждую из первой нити и второй нити молекулы ДНК, кодирующей продукт гена, в результате чего экспрессия продукта гена изменяется; и где белок Cas и две направляющие РНК не встречаются вместе в естественных условиях.

В аспектах настоящего изобретения направляющие РНК могут содержать направляющую последовательность, слитую с парной tracr-последовательностью и tracr-последовательностью. В варианте осуществления настоящего изобретения белок Cas представляет собой белок системы CRISPR-Cas типа II. В аспекте настоящего изобретения белок Cas является кодон-оптимизированным для экспрессии в эукариотической клетке, предпочтительно в клетке млекопитающего или клетке человека. В дополнительных вариантах осуществления настоящего изобретения белок Cas представляет собой белок системы CRISPR-Cas типа II, например, белок Cas9. В особенно предпочтительном варианте осуществления белок Cas представляет собой белок Cas9, например, SpCas9. В аспектах настоящего изобретения белок Cas имеет одну или несколько мутаций, выбранных из группы, состоящей из D10A, Е762А, Н840А, N854A, N863A и D986A. В особенно предпочтительном варианте осуществления белок Cas имеет мутацию D10A.

Аспекты настоящего изобретения относятся к снижению экспрессии продукта гена, или к дополнительному введению матричного полинуклеотида в молекулу ДНК, кодирующую продукт гена, или к точному вырезанию вставочной последовательности путем обеспечения повторного отжига и лигирования двух "липких" 5'-концов, или к изменению активности или функционирования продукта гена, или к повышению экспрессии продукта гена. В варианте осуществления настоящего изобретения продукт гена представляет собой белок. В предпочтительных вариантах осуществления настоящего изобретения векторы системы являются вирусными векторами. В дополнительном варианте осуществления векторы системы доставляют посредством липосом, наночастиц, экзосом, микропузырьков или генной пушки.

В одном аспекте настоящее изобретение предусматривает способ модификации целевого полинуклеотида в клетке печени. В некоторых вариантах осуществления способ включает обеспечение связывания комплекса CRISPR с целевым полинуклеотидом для осуществления расщепления указанного целевого полинуклеотида с модификацией, таким образом, целевого полинуклеотида, где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в указанном целевом полинуклеотиде, где указанная направляющая последовательность связана с парной tracr-последовательностью, которая, в свою очередь, гибридизируется с tracr-последовательностью. В некоторых вариантах осуществления указанное расщепление включает расщепление одной или двух нитей в определенной точке целевой последовательности указанным ферментом CRISPR. В некоторых вариантах осуществления указанное расщепление приводит к сниженной транскрипции целевого гена. В некоторых вариантах осуществления способ дополнительно включает репарацию указанного расщепленного целевого полинуклеотида при помощи гомологичной рекомбинации с экзогенным матричным полинуклеотидом, где указанная репарация приводит к мутации, включающей вставку, делецию или замену одного или нескольких нуклеотидов указанного целевого полинуклеотида. В некоторых вариантах осуществления указанная мутация приводит к одной или нескольким аминокислотным заменам в белке, экспрессируемом с гена, содержащего целевую последовательность. В некоторых вариантах осуществления способ дополнительно включает доставку одного или нескольких векторов в указанную эукариотическую клетку, где один или несколько векторов управляют экспрессией одного или нескольких из: фермента CRISPR, направляющей последовательности, связанной с парной tracr-последовательностью, и tracr-последовательности. В некоторых вариантах осуществления указанные векторы доставляют в эукариотическую клетку в субъекте. В некоторых вариантах осуществления указанная модификация имеет место в указанной эукариотической клетке в клеточной культуре. В некоторых вариантах осуществления способ дополнительно включает выделение указанной эукариотической клетки из субъекта перед указанной модификацией. В некоторых вариантах осуществления способ дополнительно включает возвращение указанной эукариотической клетки и/или клеток, полученных из субъекта, указанному субъекту.

В одном аспекте настоящее изобретение предусматривает способ модификации экспрессии полинуклеотида в клетке печени. В некоторых вариантах осуществления способ включает обеспечение связывания комплекса CRISPR с полинуклеотидом так, что указанное связывание приводит к повышенной или пониженной экспрессии указанного полинуклеотида; где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в указанном целевом полинуклеотиде, где указанная направляющая последовательность связана с парной tracr-последовательностью, которая, в свою очередь, гибридизируется с tracr-последовательностью. В некоторых вариантах осуществления способ дополнительно включает доставку одного или нескольких векторов в указанные эукариотические клетки, где один или несколько векторов управляют экспрессией одного или нескольких из: фермента CRISPR, направляющей последовательности, связанной с парной tracr-последовательностью, и tracr-последовательности.

В одном аспекте настоящее изобретение предусматривает способ получения модельной клетки печени, содержащей мутантный ген, ответственный за развитие заболевания. В некоторых вариантах осуществления ген, ответственный за развитие заболевания, является любым геном, ассоциированным с повышением риска наличия или развития заболевания. В некоторых вариантах осуществления способ включает (а) введение одного или нескольких векторов в эукариотическую клетку, где один или несколько векторов управляют экспрессией одного или нескольких из: фермента CRISPR, направляющей последовательности, связанной с парной tracr-последовательностью, и tracr-последовательности; и (b) обеспечение связывания комплекса CRISPR с целевым полинуклеотидом для осуществления расщепления целевого полинуклеотида в указанном гене, ответственном за развитие заболевания, где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в целевом полинуклеотиде, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, с получением, таким образом, модельной эукариотической клетки, содержащей мутантный ген, ответственный за развитие заболевания. В некоторых вариантах осуществления указанное расщепление включает расщепление одной или двух нитей в определенной точке целевой последовательности указанным ферментом CRISPR. В некоторых вариантах осуществления указанное расщепление приводит к сниженной транскрипции целевого гена. В некоторых вариантах осуществления способ дополнительно включает репарацию указанного расщепленного целевого полинуклеотида при помощи гомологичной рекомбинации с экзогенным матричным полинуклеотидом, где указанная репарация приводит к мутации, включающей вставку, делецию или замену одного или нескольких нуклеотидов указанного целевого полинуклеотида. В некоторых вариантах осуществления указанная мутация приводит к одной или нескольким аминокислотным заменам при экспрессии белка с гена, содержащего целевую последовательность.

В одном аспекте настоящее изобретение предусматривает способ отбора одной или нескольких клеток печени путем введения одной или нескольких мутаций в ген в одной или нескольких клетках, при этом способ включает введение одного или нескольких векторов в клетку(клетки), где один или несколько векторов управляют экспрессией одного или нескольких из: фермента CRISPR, направляющей последовательности, связанной с парной tracr-последовательностью, tracr-последовательности и матрицы редактирования; где матрица редактирования содержит одну или несколько мутаций, которые прекращают расщепление ферментом CRISPR; обеспечение гомологичной рекомбинации матрицы редактирования с целевым полинуклеотидом в отбираемой(отбираемых) клетке(клетках); обеспечение связывания комплекса CRISPR с целевым полинуклеотидом для осуществления расщепления целевого полинуклеотида в указанном гене, где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в целевом полинуклеотиде, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, где связывание комплекса CRISPR с целевым полинуклеотидом индуцирует гибель клеток, с обеспечением тем самым отбора одной или нескольких прокариотических клеток, в которые были введены одна или несколько мутаций. В предпочтительном варианте осуществления фермент CRISPR представляет собой Cas9. Аспекты настоящего изобретения обеспечивают возможность отбора конкретных клеток без необходимости наличия маркера отбора или двухстадийного способа, который может включать систему негативного отбора.

В одном аспекте настоящее изобретение предусматривает способы модификации целевого полинуклеотида в клетке печени. В некоторых вариантах осуществления способ включает обеспечение связывания комплекса CRISPR с целевым полинуклеотидом для осуществления расщепления указанного целевого полинуклеотида с модификацией, таким образом, целевого полинуклеотида, где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в указанном целевом полинуклеотиде, где указанная направляющая последовательность связана с парной tracr-последовательностью, которая, в свою очередь, гибридизируется с tracr-последовательностью.

В других вариантах осуществления настоящее изобретение предусматривает способ модификации экспрессии полинуклеотида в клетке печени. Способ включает повышение или снижение экспрессии целевого полинуклеотида при помощи комплекса CRISPR, который связывается с полинуклеотидом.

При желании для осуществления модификации экспрессии в клетке один или несколько векторов, содержащих tracr-последовательность, направляющую последовательность, связанную с парной tracr-последовательностью, последовательность, кодирующую фермент CRISPR, доставляют в клетку. В некоторых способах один или несколько векторов содержат регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей указанный фермент CRISPR, содержащий последовательность ядерной локализации; и регуляторный элемент, функционально связанный с парной tracr-последовательностью и одним или несколькими сайтами встраивания для встраивания направляющей последовательности выше парной tracr-последовательности. При экспрессии направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью в клетке. Как правило, комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью.

В некоторых способах целевой полинуклеотид можно инактивировать для осуществления модификации экспрессии в клетке. Например, при связывании комплекса CRISPR с целевой последовательностью в клетке целевой полинуклеотид инактивируется таким образом, что последовательность не транскрибируется, кодируемый белок не продуцируется или последовательность не функционирует так, как последовательность дикого типа. Например, последовательность, кодирующую белок или микроРНК, можно инактивировать таким образом, что белок не будет продуцироваться.

В определенных вариантах осуществления фермент CRISPR содержит одну или несколько мутаций, выбранных из группы, состоящей из D10A, Е762А, Н840А, N854A, N863A или D986A, и/или одна или несколько мутаций находятся в домене RuvCl или HNH фермента CRISPR или представляют собой другую мутацию, обсуждаемую в данном документе. В некоторых вариантах осуществления фермент CRISPR имеет одну или несколько мутаций в каталитическом домене, где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и где фермент дополнительно содержит функциональный домен. В некоторых вариантах осуществления функциональный домен представляет собой домен активации транскрипции, предпочтительно VP64. В некоторых вариантах осуществления функциональный домен представляет собой домен репрессии транскрипции, предпочтительно KRAB. В некоторых вариантах осуществления домен репрессии транскрипции представляет собой SID или конкатемеры SID (например, SID4X). В некоторых вариантах осуществления функциональный домен представляет собой домен, участвующий в эпигенетической модификации, так что обеспечивается фермент, участвующий в эпигенетической модификации. В некоторых вариантах осуществления функциональный домен представляет собой активаторный домен, который может представлять собой активаторный домен Р65.

В некоторых вариантах осуществления фермент CRISPR представляет собой фермент CRISPR типа I или III, но предпочтительно представляет собой фермент CRISPR типа II. Этот фермент CRISPR типа II может быть любым ферментом Cas. Фермент Cas может быть идентифицирован как Cas9, поскольку он может относиться к общему классу ферментов, обладающих гомологией с самой большой нуклеазой с несколькими нуклеазными доменами системы CRISPR типа II. В наиболее предпочтительном случае фермент Cas9 получен или происходит из SpCas9 или SaCas9. Под происходящим заявители подразумевают, что в основе происходящего фермента главным образом лежит фермент дикого типа в том смысле, что он характеризуется высокой степенью гомологии последовательности с этим ферментом, но он был некоторым образом подвергнут мутации (модифицирован), как описано в данном документе.

Следует иметь в виду, что выражения Cas и фермент CRISPR обычно используются в данном документе взаимозаменяемо, если не очевидно иное. Как упоминается выше, многие из порядков нумерации остатков, используемых в данном документе, относятся к ферменту Cas9 из локуса CRISPR типа II Streptococcus pyogenes. Однако, следует иметь в виду, что настоящее изобретение включает многие другие Cas9 из других видов микроорганизмов, такие как SpCas9, SaCa9, St1Cas9 и т.д.

Пример кодон-оптимизированной последовательности, в данном случае оптимизированной для человека (т.е. оптимизированной для экспрессии у человека), представлен в данном документе, см. кодон-оптимизированную последовательность SaCas9 для человека. Хотя это является предпочтительным, следует иметь в виду, что возможны другие примеры и что для вида-хозяина известна оптимизация кодонов.

Доставку предпочтительно осуществляют в форме вектора, который может представлять собой вирусный вектор, как, например, векторы на основе лентивируса, или бакуловируса, или, предпочтительно, аденовируса/аденоассоциированного вируса, но известны, и предусмотрены другие средства доставки (такие как дрожжевые системы, микропузырьки, генные пушки/средства прикрепления векторов к наночастицам золота). Вектор может означать не только вирусную или дрожжевую систему (например, где нуклеиновые кислоты, представляющие интерес, могут быть функционально связанными с промотором и находиться под его контролем (как, например, для получения в конечном счете процессированной РНК, если говорить об экспрессии)), но также и прямую доставку нуклеиновых кислот в клетку-хозяина. Хотя в способах в данном документе вектор может быть вирусным вектором, и он преимущественно представляет собой AAV, можно использовать другие вирусные векторы, обсуждаемые в данном документе, такие как лентивирусы. Например, бакуловирусы можно использовать для экспрессии в клетках насекомых. Эти клетки насекомых могут, в свою очередь, быть применимыми для получения больших количеств дополнительных векторов, таких как векторы на основе AAV или лентивируса, приспособленных для доставки по настоящему изобретению. Также предусматривается способ доставки фермента CRISPR по настоящему изобретению, включающий доставку в клетку мРНК, кодирующей фермент CRISPR. Следует иметь в виду, что в определенных вариантах осуществления фермент CRISPR является усеченным, и/или содержит менее одной тысячи аминокислот или менее четырех тысяч аминокислот, и/или представляет собой нуклеазу или никазу, и/или является кодон-оптимизированным, и/или содержит одну или несколько мутаций, и/или включает химерный фермент CRISPR, и/или предусматривает другие варианты, обсуждаемые в данном документе. Предпочтительными являются векторы на основе AAV и лентивируса.

В определенных вариантах осуществления целевая последовательность на своем 3'-конце фланкирована или расположена перед РАМ, подходящим для фермента CRISPR, обычно Cas и, в частности, Cas9.

Например, подходящий РАМ представляет собой 5'-NRG или 5'-NNGRR для ферментов SpCas9 или SaCas9 (или происходящих из них ферментов), соответственно.

Следует иметь в виду, что SpCas9 или SaCas9 получены или происходят из Cas9 S. pyogenes или S. aureus.

Некоторые вопросы в настоящей заявке обобщены ниже.

AAV2/8

Предпочтительная доставка системы CRISPR-Cas осуществляется посредством вирусного вектора. Этот вектор может представлять собой вектор на основе лентивируса или вектор на основе AAV, как подробно обсуждается в данном документе. В частности, авторы настоящего изобретения продемонстрировали, что AAV является предпочтительным примером вирусного вектора. В рамках этого авторы настоящего изобретения перешли к демонстрации того, что AAV8 и, в частности, AAV2/8 (AAV8, упакованный с помощью ITR AAV2 в качестве упаковочного сигнала) является применимым для доставки в печень, в особенности in vivo.

Фенотипические изменения, наблюдаемые in vivo

Как обсуждается в другом месте в данном документе, авторы настоящего изобретения были способны продемонстрировать in vivo, что фенотипическое изменение можно выявить. Это является значительным шагом вперед, поскольку недостаток, часто сглаживаемый посредством RNAi, заключается в отсутствии наблюдаемого длительного эффекта. В настоящем изобретении впервые можно увидеть фенотипическое изменение в печени. Предпочтительной схемой для его достижения является применяемая в примере 36. Ее важные элементы являются предпочтительными в отдельности или в комбинации, а именно:

SaCas9;

применение направляющей РНК, содержащей направляющую последовательность, tracr-последовательность и парную tracr-последовательность;

что касается tracr-последовательности, tracr Sa является предпочтительной для привлечения SaCas9;

AAV8 или, более предпочтительно, AAV2/8;

для экспериментальных целей Rosa26 является применимым отрицательным контролем;

хотя применение промотора CMV в векторе AAV является целесообразным, особенно эффективным является применение печеночноспецифического промотора, такого как TBG;

мишень или мишени могут находиться в широком диапазоне, поскольку было показано, что CRISPR имеет широкую применимость среди мишеней, так как ее направляющие последовательности успешно доставляются, а ферменты Css9 экспрессируются надлежащим образом. Однако, предпочтительные мишени в печени (для воздействия на которые могут быть предназначены направляющие последовательности), тем не менее, включают один или несколько из: PCSK9; Hmgcr; SERPINA1; АроВ и/или LDL.

Соответственно, в некоторых вариантах осуществления особенно предпочтительно, чтобы фермент Cas представлял собой SaCas9. Полинуклеотидная последовательность CRISPR-Cas предпочтительно является химерной и предпочтительно включает в себя tracr Sa, где Cas9 представляет собой SaCas9. Можно применять вирусный вектор, который предпочтительно представляет собой AAV2/8. Кроме того, наиболее подходящим является печеночноспецифический промотор, и предпочтительным примером является TBG. Все из этого можно применять в комбинации с получением химерной полинуклеотидной последовательности CRISPR-Cas, включающей в себя tracr Sa, где Cas9 представляет собой SaCas9, а вектор представляет собой AAV2/8, и по меньшей мере Cas9 находится под контролем печеночноспецифического промотора, такого как TBG. Данная система может быть направлена на любую из вышеприведенных мишеней, в частности, АроВ ввиду его важной роли в ожирении.

В недавней статье Yin и Anderson в Nature Biotech (NBT 2884, упоминаемой в данном документе) дополнительно подтверждены фенотипические изменения in vivo, уже продемонстрированные авторами настоящего изобретения.

Дополнительные данные, приведенные авторами настоящего изобретения в примере 37, в этом случае дают дополнительное подтверждение посредством демонстрации эффективного редактирования в соматической ткани печени in vivo с помощью Cas9. Более того, доставка с помощью AAV2/8 и применение SaCas9 опять-таки демонстрируют применимость данного конкретного подхода in vivo. На предпочтительный АроВ вновь осуществляли целенаправленное воздействие.

В последующих примерах 38 и 39 показаны превосходные in vivo данные об эффективности индукции фенотипического изменения in vivo: в частности, относительно АроВ, гена, участвующего в метаболизме липидов, при этом в примере 40 показана применимость методики к постмитотическим клеткам, среди которых клетки печени являются важным примером. В примере 41 показано, что для целей выявления предпочтительными являются множественные эпитопные метки.

Хотя предпочтительными являются вирусные векторы, в некоторых вариантах осуществления применение пептидов, проникающих в клетку, является жизнеспособной альтернативой и поэтому также является предпочтительным.

Соответственно, целью настоящего изобретения не является охват в пределах настоящего изобретения любого ранее известного продукта, способа получения продукта или способа применения продукта, так что заявители оставляют за собой право и настоящим раскрывают отказ от прав на любой ранее известный продукт, процесс или способ. Следует дополнительно отметить, что настоящее изобретение не предназначено охватывать в пределах объема настоящего изобретения любой продукт, способ получения продукта или способ применения продукта, который не соответствует письменному описанию и требованиям достаточного раскрытия сути изобретения USPTO (первый пункт 112 статьи 35 USC) или ЕРО (статья 83 ЕРС), так что заявители оставляют за собой право и настоящим раскрывают отказ от прав на любой ранее описанный продукт, способ получения продукта или способ применения продукта.

Следует отметить, что в данном раскрытии и особенно в формуле изобретения и/или абзацах такие выражения, как "содержит", "содержащийся", "содержащий" и т.п., могут иметь значение, приписываемое им в патентном законодательстве США, например, они могут означать "включает", "включенный", "включающий" и т.п., и что такие выражения, как "по сути состоящий из" и "по сути состоит из" имеют значение, приписываемое им в патентном законодательстве США, например, они допускают не указанные прямо элементы, но исключают элементы, которые имеются в известном уровне техники или которые влияют на основные или новые характеристики настоящего изобретения.

Эти и другие варианты осуществления раскрыты или являются очевидными на основании следующего подробного описания и охвачены им.

Краткое описание графических материалов

Новые признаки настоящего изобретения изложены с характерными особенностями в прилагаемой формуле изобретения. Лучшее понимание признаков и преимуществ настоящего изобретения будет доступно благодаря ссылке на следующее подробное описание, в котором изложены показательные варианты осуществления, в которых используют принципы настоящего изобретения, и на сопутствующие графические материалы.

На фигуре 1 изображена схематическая модель системы CRISPR. Нуклеаза Cas9 из Streptococcus pyogenes (желтый) целенаправленно воздействует на геномную ДНК при помощи синтетической направляющей РНК (sgRNA), состоящей из 20-нуклеотидной направляющей последовательности (голубой) и каркаса (красный). Направляющая последовательность образует пары оснований с ДНК-мишенью (голубой) непосредственно выше необходимого мотива 5'-NGG, прилегающего к протоспейсеру (РАМ; пурпурный), и Cas9 опосредует двухнитевой разрыв (DSB) на ~3 п.о. выше РАМ (красный треугольник).

На фигурах 2A-F показана иллюстративная система CRISPR, возможней механизм действия, пример адаптации для экспрессии в эукариотических клетках и результаты тестов, оценивающих ядерную локализацию и активность CRISPR.

На фигуре 3A-D показаны результаты оценки специфичности SpCas9 в отношении мишени-примера.

На фигурах 4A-G показана иллюстративная векторная система и результаты ее применения при управлении гомологичной рекомбинацией в эукариотических клетках.

На фигуре 5 представлена таблица протоспейсерных последовательностей и обобщены результаты определения эффективности модификаций для протоспейсеров-мишеней, сконструированных на основе иллюстративных систем CRISPR S. pyogenes и S. thermophilus с соответствующими РАМ, воздействующих на локусы в геномах человека и мыши. Клетки трансфицировали Cas9 и либо pre-crRNA/tracrRNA, либо химерной РНК и анализировали через 72 часа после трансфекции. Процент вставок/делеций рассчитывали на основе результатов анализа с помощью Surveyor с указанными линиями клеток (N=3 для всех протоспейсеров-мишеней, ошибки представляют собой S.E.M., "N.D." означает "не выявляется посредством анализа с помощью Surveyor", и "N.T." означает "не тестировали в данном исследовании").

На фигурах 6А-С показано сравнение различных транскриптов tracrRNA для опосредованного Cas9 целенаправленного воздействия на ген.

На фигуре 7 показано схематическое изображение анализа с помощью нуклеазы Surveyor для выявления индуцированных двухнитевым разрывом микровставок и микроделеций.

На фигурах 8А-В показаны иллюстративные бицистронные векторы экспрессии для экспрессии элементов системы CRISPR в эукариотических клетках.

На фигурах 9А-С показаны гистогораммы расстояний между смежными РАМ (NGG) для локуса 1 S. pyogenes SF370 (фигура 9А) и РАМ (NNAGAAW) для локуса 2 LMD9 S. thermophilus (фигура 9В) в геноме человека и расстояния для каждого РАМ в хромосомах (Chr) (фигура 9С).

На фигурах 10A-D показана иллюстративная система CRISPR как пример адаптации для экспрессии в эукариотических клетках и результаты тестов, оценивающих активность CRISPR.

На фигурах 11А-С показаны иллюстративные манипуляции с системой CRISPR для целенаправленного воздействия на геномные локусы в клетках млекопитающего.

На фигурах 12А-В показаны результаты нозерн-блот-анализа процессинга crRNA в клетках млекопитающего.

На фигурах 13А-В показан иллюстративный отбор протоспейсеров в локусах PVALB человека и Th мыши.

На фигуре 14 показаны иллюстративные целевые последовательности протоспейсера и соответствующего РАМ для системы CRISPR S. thermophilus в локусе ЕМХ1 человека.

На фигуре 15 представлена таблица последовательностей для праймеров и зондов, используемых для анализа с помощью Surveyor, RFLP, геномного секвенирования и нозерн-блот-анализов.

На фигурах 16А-С показана иллюстративная манипуляция с системой CRISPR с химерными РНК и результаты анализов с помощью SURVEYOR в отношении активности системы в эукариотических клетках.

На фигурах 17А-В показано графическое изображение результатов анализа с помощью SURVEYOR в отношении активности системы CRISPR в эукариотических клетках.

На фигуре 18 показано иллюстративное отображение некоторых целевых сайтов для Cas9 S. pyogenes в геноме человека, полученное с использованием геномного браузера UCSC.

На фигурах 19A-D показано круговое отображение филогенетического анализа, выявляющего пять семейств Cas9, включая три группы больших Cas9 (~1400 аминокислот) и две малых Cas9 (~1100 аминокислот).

На фигуре 20A-F показано линейное отображение филогенетического анализа, выявляющего пять семейств Cas9, включая три группы больших Cas9 (~1400 аминокислот) и две малых Cas9 (~1100 аминокислот).

На фигурах 21A-D показано редактирование генома посредством гомологичной рекомбинации, (а) Схематическое изображение никазы SpCas9 с мутацией D10A в каталитическом домене RuvC I. (b) Схематическое представление гомологичной рекомбинации (HR) в локусе ЕМХ1 человека при использовании смысловых или антисмысловых однонитевых олигонуклеотидов в качестве матриц для репарации. Красная стрелка вверху указывает на сайт расщепления для sgRNA; праймеры для ПЦР для генотипирования (таблицы J и K) обозначены стрелками в правой панели, (с) Последовательность участка, модифицированного с помощью HR. (d) Анализ вставок/делеций в целевом локусе 1 ЕМХ1 (n=3), опосредованных SpCas9 дикого типа (wt) и никазой SpCas9 (D10A), с помощью SURVEYOR. Стрелки указывают положения фрагментов ожидаемого размера.

На фигурах 22А-В показаны одиночные векторные структуры для SpCas9.

На фигуре 23 показана диаграмма, представляющая распределение ортологов Cas9 по длине.

На фигуре 24А-М показаны последовательности, где точки мутаций расположены в гене SpCas9.

На фигуре 25А показана карта вектора для целенаправленного воздействия с условной экспрессией Cas9, Rosa26.

На фигуре 25 В показана карта вектора для целенаправленного воздействия с конститутивной экспрессией Cas9, Rosa26.

На фигуре 26 показано схематическое изображение важных элементов в конструкциях для конститутивной и условной экспрессии Cas9.

На фигуре 27 показаны данные о доставке и in vivo экспрессии Cas9 в головном мозге мышей.

На фигуре 28 показана доставка Cas9 и химерной РНК в виде РНК в клетки. (А) Доставка репортера GFP в виде ДНК или мРНК в клетки Neuro-2A. (В) Доставка Cas9 и химерной РНК, воздействующих на ген Icam2, в виде РНК приводит к разрезанию одного из двух тестируемых спейсеров. (С) Доставка Cas9 и химерной РНК, воздействующих на ген F7, в виде РНК приводит к разрезанию одного из двух тестируемых спейсеров.

На фигуре 29 показано, как репарация двухнитевого разрыва (DSB) ДНК способствует редактированию генов. В пути склонного к ошибкам негомологичного соединения концов (NHEJ) концы DSB подвергаются обработке посредством эндогенных механизмов репарации ДНК и соединяются вместе, что может приводить к случайным мутациям по типу вставки или делеции (вставки/делеции) в месте соединения. Мутации по типу вставки/делеции, имеющие место в кодирующем участке гена, могут обуславливать сдвиг рамки считывания и появление преждевременного стоп-кодона, что приводит к нокауту гена. В альтернативном случае матрицу для репарации в форме плазмиды или однонитевых олигодезоксинуклеотидов (ssODN) можно предоставлять для эффективного использования пути репарации с участием гомологичной рекомбинации (HDR), что обеспечивает высокое качество и точное редактирование.

На фигурах 30А-С показаны предполагаемые результаты HDR в клетках HEK и HUES9. (а) Целенаправленно воздействующую плазмиду или ssODN (смысловой или антисмысловой) с гомологичными плечами можно использовать для редактирования последовательности в целевом локусе генома, расщепляемом Cas9 (красный треугольник). Для анализа эффективности HDR вводили сайт для HindIII (красный прямоугольник) в целевой локус, который подвергали ПЦР-амплификации с праймерами, отжигаемыми за пределами участка гомологии. При расщеплении продукта ПЦР с помощью HindIII выявляют число случаев обнаружения событий ITDR. (b) ssODN, ориентированные в смысловом или антисмысловом (s или а) направлении относительно представляющего интерес локуса, можно использовать в сочетании с Cas9 для достижения эффективного опосредованного HDR редактирования в целевом локусе. С каждой стороны от места модификации (красный прямоугольник) рекомендуется наличие минимального участка гомологии размером 40 п.о. и предпочтительно 90 п.о. (с) Пример эффекта ssODN в отношении HDR в локусе ЕМХ1 показан с использованием как Cas9 дикого типа, так и никазы Cas9 (D10A). Каждый ssODN содержит гомологичные плечи размером 90 п.о., фланкирующие вставку двух сайтов рестрикции размером 12 п.о.

На фигурах 31А-С показана стратегия репарации для мутации дельта-F508 гена регулятора трансмембранной проводимости при муковисцидозе.

На фигурах 32А-В (а) показано схематическое изображение экспансии GAA-повтора в интроне 1 FXN и (b) показано схематическое изображение стратегии, принятой для вырезания участка экспансии GAA с помощью системы CRISPR/Cas.

На фигуре 33 показан скрининг в отношении эффективного опосредованного SpCas9 целенаправленного воздействия на локусы генов Tet1-3 и Dnmt1, 3а и 3b. Анализ с помощью Surveyor в отношении ДНК из трансфицированных клеток N2A демонстрирует эффективное расщепление ДНК путем использования различных gRNA.

На фигуре 34 показана стратегия мультиплексного целенаправленного воздействия на геном с применением 2-векторной системы в системе доставки на основе AAV1/2. gRNA, воздействующая на Tet1-3 и Dnmt1, 3а и 3b, находится под контролем промотора U6. GFP-KASH находится под контролем промотора гена синапсина человека. Сайты рестрикции демонстрируют простую стратегию замены gRNA путем субклонирования. Показан SpCas9, меченный НА, фланкированный двумя сигналами ядерной локализации (NLS). Оба вектора доставляют в головной мозг с помощью вируса AAV1/2 в соотношении 1:1.

На фигуре 35 показано подтверждение функциональных свойств мультиплексного вектора #1 для целенаправленного воздействия на DNMT посредством анализа с помощью Surveyor. Клетки N2A совместно трансфицировали вектором #1 для целенаправленного воздействия на DNMT (+) и вектором, кодирующим SpCas9, для тестирования опосредованного SpCas9 расщепления локусов генов семейства DNMT. gRNA в отдельности (-) представляет собой отрицательный контроль. Клетки собирали для очистки и последующей обработки ДНК через 48 ч. после трансфекции.

На фигуре 36 показано подтверждение функциональных свойств мультиплексного вектора #2 для целенаправленного воздействия на DNMT посредством анализа с помощью Surveyor. Клетки N2A совместно трансфицировали вектором #1 для целенаправленного воздействия на DNMT (+) и вектором, кодирующим SpCas9, для тестирования опосредованного SpCas9 расщепления локусов генов семейства DNMT. gRNA в отдельности (-) представляет собой отрицательный контроль. Клетки собирали для очистки и последующей обработки ДНК через 48 ч. после трансфекции.

На фигуре 37 показано схематическое представление коротких промоторов и коротких вариантов поли(А), используемых для экспрессии HA-SpCas9 in vivo. Размеры кодирующих участков от L-ITR до R-ITR показаны справа.

На фигуре 38 показано схематическое представление коротких промоторов и коротких вариантов поли(А), используемых для экспрессии HA-SaCas9 in vivo. Размеры кодирующих участков от L-ITR до R-ITR показаны справа.

На фигуре 39 показана экспрессия SpCas9 и SaCas9 в клетках N2A. Иллюстративный вестерн-блоттинг меченных НА вариантов SpCas9 и SaCas9 под контролем различных коротких промоторов и с короткими поли(А)-последовательностями (spA). Тубулин представляет собой контроль загрузки. mCherry (mCh) представляет собой контроль трансфекции. Через 48 ч. после трансфекции клетки собирали и далее подвергали вестерн-блоттингу.

На фигуре 40 показан скрининг в отношении эффективного опосредованного SaCas9 целенаправленного воздействия на локус гена Tet3. Анализ с помощью Surveyor в отношении ДНК из трансфицированных клеток N2A демонстрирует эффективное расщепление ДНК путем применения различных gRNA с последовательностью PUM NNGGGT. Клетки, трансфицированные GFP, и клетки, экспрессирующие только SaCas9, являются контрольными.

На фигуре 41 показана экспрессия HA-SaCas9 в головном мозге мышей. Животным инъецировали в зубчатые извилины вирус, управляющий экспрессией HA-SaCas9 под контролем промотора гена синапсина человека. Животных умерщвляли через 2 недели после хирургической операции. НА-метку выявляли с помощью моноклонального антитела кролика C29F4 (Cell Signaling). Клеточные ядра окрашивали синим цветом с помощью красителя DAPI.

На фигуре 42 показана экспрессия SpCas9 и SaCas9 в первичных кортикальных нейронах в культуре через 7 дней после трансдукции. Иллюстративный вестерн-блоттинг меченных НА вариантов SpCas9 и SaCas9 под контролем различных промоторов и с последовательностями bgh или короткими поли(А) (spA). Тубулин представляет собой контроль загрузки.

На фигуре 43 показано окрашивание с выявлением живых/мертвых первичных кортикальных нейронов через 7 дней после трансдукции частицами AAV1, несущими SpCas9 с различными промоторами и мультиплексные конструкции gRNA (пример показан на последней панели для DNMT). Нейроны после трансдукции с помощью AAV сравнивали с контрольными нетрансдуцированными нейронами. Красные ядра указывают на мертвые клетки с нарушенной проницаемостью мембраны (второй ряд панелей). Живые клетки отмечены зеленым цветом (третий ряд панелей).

На фигуре 44 показано окрашивание с выявлением живых/мертвых первичных кортикальных нейронов через 7 дней после трансдукции частицами AAV1, несущими SaCas9 с различными промоторами. Красные ядра указывают на мертвые клетки с нарушенной проницаемостью мембраны (второй ряд панелей). Живые клетки отмечены зеленым цветом (третий ряд панелей).

На фигуре 45 показано сравнение морфологических характеристик нейронов после трансдукции вирусом AAV1, несущим SpCas9 и мультиплексы gRNA для локусов генов ТЕТ и DNMT. Нейроны без трансдукции показаны в качестве контроля.

На фигуре 46 показано подтверждение функциональных свойств мультиплексного вектора #1 для целенаправленного воздействия на DNMT посредством анализа с помощью Surveyor в первичных кортикальных нейронах. Клетки совместно трансдуцировали вектором #1 для целенаправленного воздействия на DNMT (+) и вирусами с SpCas9 с различными промоторами для тестирования опосредованного SpCas9 расщепления локусов генов семейства DNMT.

На фигуре 47 показана in vivo эффективность расщепления SpCas9 в головном мозге. Мышам инъецировали вирус AAV1/2, несущий мультиплекс gRNA, осуществляющий нацеливание на локусы генов семейства DNMT, вместе с вирусами с SpCas9 под контролем 2 различных промоторов: Меср2 мыши и Map1b крысы. Через две недели после инъекции ткань головного мозга извлекали, и ядра получали и сортировали с помощью FACS на основании экспрессии GFP под управлением промотора гена синапсина из мультиплексной конструкции gRNA. После экстракции gDNA выполняли анализ с помощью Surveyor. + означает GFP-положительные ядра, а - означает контрольные, GFP-отрицательные ядра от того же животного. Числа применительно к гелю означают оцененную эффективность SpCas9.

На фигуре 48 показана очистка меченных GFP-KASH клеточных ядер из нейронов гиппокампа. Внешняя ядерная мембрана (ONM) ядерной оболочки клетки мечена продуктом слияния GFP и белкового трансмембранного домена KASH. Наблюдается интенсивная экспрессия GFP в головном мозге через неделю после стереотаксического хирургического вмешательства и инъекции AAV1/2. Осуществляли стадию центрифугирования в градиенте плотности для очистки клеточных ядер от интактного головного мозга. Показаны очищенные ядра. Хроматин, окрашенный рубиновым красителем Vybrant® DyeCycle™, показан красным цветом, меченные GFP ядра показаны зеленым цветом. Иллюстративный профиль FACS GFP+ и GFP- клеточных ядер (пурпурный цвет: рубиновый краситель Vybrant® DyeCycle™, зеленый цвет: GFP).

На фигуре 49 показана эффективность расщепления SpCas9 в головном мозге мышей. Мышам инъецировали вирус AAV1/2, несущий мультиплекс gRNA, осуществляющий нацеливание на локусы генов семейства ТЕТ, вместе с вирусами с SpCas9 под контролем 2 различных промоторов: Меср2 мыши и Map1b крысы. Через три недели после инъекции ткань головного мозга извлекали, ядра получали и сортировали с помощью FACS на основании экспрессии GFP под управлением промотора гена синапсина из мультиплексной конструкции gRNA. После экстракции gDNA выполняли анализ с помощью Surveyor. + означает GFP-положительные ядра, а - означает контрольные, GFP-отрицательные ядра от того же животного. Числа применительно к гелю означают оцененную эффективность SpCas9.

На фигуре 50 показана экспрессия GFP-KASH в кортикальных нейронах в культуре. Нейроны трансдуцировали вирусом AAV1, несущим мультиплексные конструкции gRNA, осуществляющие нацеливание на локусы генов ТЕТ. Локализация самого сильного сигнала возле клеточных ядер обусловлена локализацией домена KASH.

На фигуре 51 показан (в верхней части) перечень расстояний (на которые указывает схема расположения для двух последовательностей РАМ) между парами направляющих РНК. Только для пар направляющих РНК, удовлетворяющих паттернам 1, 2, 3, 4, проявляются вставки/делеции в случае применения с никазой SpCas9(D10A). (Нижняя часть) Изображения гелей, демонстрирующие, что комбинация SpCas9(D10A) с парами направляющих РНК, удовлетворяющих паттернам 1, 2, 3, 4, приводит к образованию вставок/делеций в целевом сайте.

На фигуре 52 показан перечень последовательностей обратных праймеров для U6, используемых для создания кассет экспрессии U6-направляющая РНК. Каждый праймер необходимо применять в паре с прямым праймером для U6 "gcactgagggcctatttcccatgattc" для образования ампликонов, содержащих U6 и требуемую направляющую РНК.

На фигуре 53 показана карта секвенирования генома в локусе Emx1 человека, демонстрирующая местоположения 24 паттернов, перечисленных на фигуре 33.

На фигуре 54 показано (справа) изображение геля, указывающее на образование вставок/делеций в целевом сайте при наличии различных "липких" 5'-концов после расщепления никазой Cas9, нацеливаемой различными парами направляющих РНК. (Слева) Таблица, в которой указаны номера дорожек для геля справа и различные параметры, в том числе идентификация применяемых пар направляющих РНК и длина "липкого" 5'-конца, имеющегося в наличии после расщепления никазой Cas9.

На фигуре 55 показана карта секвенирования генома в локусе Emx1 человека, демонстрирующая местоположения различных пар направляющих РНК, которые обуславливают картины разделения в геле, показанные на фиг. 54 (справа), и которые дополнительно описаны в примере 35.

На фигуре 56 показано иллюстративное изображение геля в анализе с помощью Surveyor, демонстрирующее расщепление генома с помощью SaCas9.

На фигуре 57 показана эффективность расщепления генома для последовательностей РАМ (все мишени).

На фигуре 58 показана эффективность расщепления генома для последовательностей РАМ (расщепленные мишени).

На фигуре 59 показана эффективность расщепления генома для последовательностей РАМ (все мишени без учета мишеней с низкой эффективностью и редких мишеней).

На фигуре 60 показана эффективность расщепления генома для последовательностей РАМ (расщепленные мишени без учета мишеней с низкой эффективностью и редких мишеней).

На фигуре 61 показана лигатура последовательностей для рабочих расщепленных спейсеров & РАМ (новый тест эндогенного генома, показывающий, что Т не является необходимым).

На фигуре 62 показано изображение среза ткани печени, подвергнутого иммуногистохимическому окрашиванию, от животного, которому инъецировали AAV-CMV-EGFP и AAV-CMV-SaCas9-U6-sgRNA (Pcsk9) (подтверждение экспрессии белка SaCas9 через 2 недели после инъекции).

На фигуре 63 показано расщепление в ткани печени с помощью SaCas9, доставляемого путем инъекции вируса AAV2/8 в хвостовую вену (моменты времени с интервалом в 1 неделю).

На фигуре 64 показан анализ динамики расщепления в ткани печени с помощью SaCas9, доставляемого путем инъекции вируса AAV2/8 (AAV2/8-SaCas9-U6-sgRNA (Pcsk9)) в хвостовую вену.

На фигуре 65 показан скрининг функциональных мишеней для CRISPR/Cas в клетках 293FT человека после доставки SaCas9 и кассеты U6-sgRNA, целенаправленно воздействующих на локусы гена SERPINA1, с последующим анализом с помощью Surveyor и анализом в геле 12 из общего количества 24 различных спейсерных конструкций dsDNA, экспрессирующей sgRNA, осуществляющей нацеливание на ген SERPINA1 человека, маркер молекулярного веса ДНК показан слева.

На фигуре 66 показан анализ в геле 12 образцов для каждой из 6 спейсерных конструкций dsDNA, экспрессирующей sgRNA, которые вводили с плазмидой с SaCas9 путем совместной трансфекции в линию клеток гепатоцитов мышей, две реплики размещали рядом друг с другом. Маркер молекулярного веса ДНК показан слева.

На фигуре 67 показан тонкий разрез ткани печени мыши, которой инъецировали вариант EGFP с TBG в сравнении с вариантом с CMV (6 дней после инъекции, изображение в канале GFP, 10Х).

На фигурах 68А-В показано следующее. (А) Конструкция вектора AAV для упаковки SaCas9 и систем экспрессии направляющей РНК с промотором CMV, повсеместно действующим у млекопитающих, для доставки в широкий диапазон тканей. (В) Конструкция вектора AAV для упаковки SaCas9 и систем экспрессии направляющей РНК с печеночноспецифическим промотором TBG для целенаправленного воздействия в гепатоцитах in vivo. ITR - инвертированные концевые повторы AAV. hSaCas9 - кодон-оптимизированный SaCas9 человека. NLS - сигнал ядерной локализации. НА - метка, полученная из гемагглютинина вируса гриппа человека. bGHpA - сигнал полиаденилирования бычьего гормона роста. U6 - промотор U6 человека. sgRNA -одиночная направляющая РНК.

На фигурах 69А-В показано следующее. (А) Результаты анализа с помощью Surveyor, демонстрирующие частоту модификаций генома для тканей печени мышей, которым инъецировали AAV2/8, экспрессирующий SaCas9, целенаправленно воздействующий на ген Pcsk9 мыши, или контрольный вирус AAV2/8, экспрессирующий репортерный ген EGFP. Забор всех образцов производили через 1 неделю после инъекции в хвостовую вену. (В) Статистические данные, обобщающие эффективность расщепления при сборе во все три момента времени у мышей, которым инъецировали AAV2/8, экспрессирующий любой SaCas9, целенаправленно воздействующий на ген Pcsk9 мыши.

На фигурах 70A-D показан биохимический скрининг небольших ортологов Cas9. (а) Филогенетическое дерево ортологов Cas9 с указанными подсемействами и размерами (в аминокислотах). Консервативные нуклеазные домены выделены цветными рамками, черные остатки представляют консервативные последовательности. (b) Схематическая иллюстрация способа на основе расщепления in vitro, применяемого для идентификации мотивов, прилегающих к протоспейсерам (РАМ), (с) Консенсусные РАМ для восьми ортологов Cas9 по результатам секвенирования расщепленных фрагментов, (d) Биохимическая реакция расщепления с использованием ортологов и sgRNA, осуществляющих нацеливание на различные локусы, содержащие предполагаемые РАМ (показаны красным). Красные треугольники указывают на расщепленные фрагменты.

На фигурах 71A-F показано определение характеристик Cas9 Staphylococcus aureus in vitro, (а) Схематическое изображение, на котором показана структура sgRNA S. aureus. Количество вставок/делеций варьирует в зависимости от (b) длины направляющей последовательности или (с) дуплекса повтор : антиповтор. (d) Консенсусный РАМ для SaCas9 в клетках HEK 293FT. Показаны суммарные значения количества вставок/делеций для всех предполагаемых РАМ в виде комбинаций из 4 оснований (верхняя часть, n≥3) и общая лигатура последовательностей (n=116, нижняя часть). Сравнение эффективности расщепления для SpCas9 и SaCas9 в целевых сайтах генома показано на (е), а в нецелевых локусах по всему геному на (f) (планки погрешностей указывают на интервалы Вильсона). Нецелевые (ОТ) последовательности с существенными вставками/делециями отмечены над графиком, n=3, планки погрешностей представляют S.E.M., если не указано иное; N.D. - не выявляется.

На фигурах 72А-Е показана доставка живым животным Cas S. aureus с помощью AAV. (а) Схематические изображения, иллюстрирующие одновекторную систему AAV (верхняя часть) и временную шкалу эксперимента (нижняя часть). (b) Локус Pcsk9 мыши, в котором показаны местоположения целевых сайтов для SaCas9. Направляющие последовательности выделены синим цветом, а РАМ пурпурным цветом, (с) Динамика образования вставок/делеций в ткани печени в целевых сайтах 1 и 6 после инъекции частиц AAV2/8 (до 2 животных в каждом случае; планки погрешностей представляют кусочки ткани печени), (d) Образование вставок/делеций в целевом сайте 6 через 1 и 3 недели после инъекции. Каждая дорожка представляет кусочек ткани печени. Красные треугольники указывают на расщепленные фрагменты. (е) Иллюстративная хроматограмма и вставки/делеции, образованные с помощью SaCas9 in vivo.

На фигуре 73 показано схематическое изображение локусов шести ортологов CRISPR-Cas из двух подсемейств систем CRISPR-Cas типа II. Спейсерные или "направляющие" последовательности показаны синим цветом, за ними расположен прямой повтор (серый цвет). Предсказанные tracrRNA показаны красным и свернуты согласно модели сворачивания РНК "Генерация с учетом ограничений".

На фигуре 74 показана стопочная диаграмма, показывающая долю целевых сайтов, расщепленных на 2, 3, 4 или 5 п.о. выше РАМ, для каждого ортолога Cas9; все Cas9 чаще всего расщепляют на 3 п.о. выше РАМ (красный треугольник).

На фигурах 75А-В показано следующее, (а) Анализы с помощью SURVEYOR, демонстрирующие образование вставок/делеций в эндогенных локусах человека в результате совместной трансфекции ортологами Cas9 и sgRNA клеток HEK 293FT. (b) SaCas9 расщепляет несколько целевых сайтов с высокой эффективностью. Над каждой дорожкой показаны последовательности РАМ для отдельных целевых сайтов, при этом консенсусные последовательности для каждого Cas9 выделены красным. Красные треугольники указывают на расщепленные фрагменты.

На фигурах 76А-В показано следующее, (а) Гистограмма расстояний между смежными РАМ для CRISPR типа II (NNGRR) Staphylococcus aureus подвида aureus в геноме человека (GRCh38). (b) Расстояния для каждого РАМ в хромосомах.

На фигурах 77А-В показано местоположение целевых сайтов для SaCas9 и РАМ в локусе гена Pcsk9 мыши, (b) Вставки/делеции, полученные в целевых сайтах в результате трансфекции линии клеток гепатомы печени мыши (Нера1-6). Красные стрелки указывают на расщепленные сайты.

На фигуре 78А показано, что направляющая последовательность для целевого сайта 1 индуцировала более высокое процентное значение количества вставок/делеций в АроВ.

На фигуре 78В показаны результаты анализа в геле с помощью нуклеазы Surveyor в отношении эффективности образования вставок/делеций через 4 недели после инъекции.

На фигуре 79В показано окрашивание масляным красным для выявления фенотипа накопления липидов в печени in vivo после доставки AAV-Cas9-sgRNA. Масштабная метка в каждой квадратной панели представляет 20 микрометров.

На фигуре 80 показано, что оптимальной длиной спейсера является 21 нуклеотид (нт)/пара оснований (п.о.), представленные серыми прямоугольниками, по сравнению по меньшей мере с 20 или 22 парами оснований (представленными черными и белыми прямоугольниками, соответственно) среди ряда мишеней в двух различных генах (AAVS1 и ЕМХ1).

На фигуре 81 показано, можно ли направляющую последовательность вставить в интронную последовательность Cas9.

На фигуре 82 показано, что промотор H1 полной длины (серый прямоугольник) все же является более слабым, чем промотор U6 (черный прямоугольник), поскольку U6 демонстрирует повышенное процентное значение количества образующихся вставок/делеций для каждой тестируемой мишени.

На фигуре 83 показано, что короткий промотор H1 является более слабым, чем промотор H1 полной длины.

На фигуре 84 показано расстояние между 5'-концами двух направляющих последовательностей в конструкции, измеренное применительно к эффективности расщепления двойной никазой SaCas9 D10A.

На фигуре 85 (пример 40) показана доставка и целенаправленное воздействие системы CRISPR-Cas9 на локус Меср2 в головном мозге мыши, (а) Векторы экспрессии AAV-SpCas9 и AAV-Sp-направляющая последовательность (Меср2). Вектор sgRNA содержит последовательность, кодирующую белок слияния GFP-KASH для идентификации трансдуцированных нейронов. (b) Экспрессия HA-Cas9 и GFP-KASH в дорсальной части зубчатой извилины (DG) гиппокампа мыши. Масштабная метка - 100 мкм. (с) Количественная оценка клеток, в которых произошло эффективное целенаправленное воздействие двухвекторной системы Cas9-CRISPR. (d) Графическое представление локуса Меср2 мыши, демонстрирующее местоположение целевого сайта для Cas9; sgRNA показана синим цветом. Последовательность РАМ отмечена фиолетовым цветом. Иллюстративные паттерны мутаций, выявленные путем секвенирования локуса Меср2, показаны ниже: зеленый цвет - последовательность дикого типа; красная пунктирная линия - удаленные основания; красные основания: вставка или мутации; красный указатель стрелки указывает на сайт разрезания CRISPR-Cas9. (е) Анализ в геле с помощью SURVEYOR™, демонстрирующий модификацию локуса Меср2 через 2 недели после доставки с помощью AAV в DG-область. (f) Вестерн-блот-анализ экспрессии белка МеСР2 в целевой области головного мозга и количественная оценка уровней белка МеСР2 в дорсальной части DG (t-критерий, **р<0,001, n=4 от 3 животных, планки погрешностей: s.e.m.). (g) Изображения дорсальной части DG-области через 2 недели после целенаправленного воздействия CRISPR-Cas9 на локус Меср2. Масштабная метка - 150 мкм. (h) Количественная оценка популяции МеСР2-положительных клеток среди всех выявленных клеток (окрашивание DAPI) в целевой области головного мозга по сравнению с контрольным коллатеральным участком (t-критерий, ****р<0,0001, n=290 и 249 клеток от 2 животных, соответственно; планки погрешностей: s.e.m). (ITR - инвертированный концевой повтор; НА - гемагглютининовая метка; NLS - сигнал ядерной локализации; spA - синтетический сигнал полиаденилирования; U6 - промотор PolIII; sgRNA - одиночная направляющая РНК; hSyn - промотор гена синапсина 1 человека; GFP - зеленый флуоресцентный белок; KASH - ядерный трансмембранный домен гомологии Klarsicht/ANC1/Syne; bGH рА - сигнал полиаденилирования бычьего гормона роста; WPRE - посттранскрипционный регуляторный элемент вируса гепатита сурков).

На фигуре 86 (пример 40) показан анализ экспрессии генов в нейронах с нокдауном МеСР2, опосредованным Cas9. (а) Стратегия очистки клеточных ядер из клеток головного мозга мыши, подвергнутых целенаправленному воздействию CRISPR-Cas9. (b) Иерархическая кластеризация дифференциально экспрессируемых генов (t-критерий, p<0,01, n=19 групп отсортированных ядер от 8 животных), выявленная путем секвенирования РНК. Относительные уровни экспрессии генов в log2(TPM+1) нормализованы для каждого ряда и отображены на красно-синей цветовой шкале. В каждом столбце представлена группа из 100 целевых ядер нейронов, отсортированных путем FACS из выделенной популяции клеток зубчатой извилины контрольных или трансдуцированных sgRNA для Меср2 животных, как указано.

На фигуре 87 (пример 40) показаны клеточно-автономные дефекты свойств клеточных реакций нейронов после опосредованного CRISPR нокдауна МеСР2. (а) Рисунок, на котором показана схема эксперимента in vivo, состоящая из зрительной коры мыши и параметра зрительной стимуляции. Показан GFP+ нейрон. Масштабная метка - 20 мкм. (b) Рисунок, на котором показана схема регистрации в возбуждающих нейронах в слоях 2/3, которые получают специфический входной сигнал, направленный как на контра-, так и на ипсилатеральный глаз. GFP+ клетки с модифицированным геномом показаны зеленым цветом, тогда как немодифицированные клетки показаны серым цветом. Стандартная форма спайка указывает на возбуждающие нейроны с регулярными спайками. (c, d) Средние значения OSI (с) и вызванной FR (d) измеряли в GFP+ клетках, экспрессирующих Меср2 и контрольную sgRNA, соответственно (t-критерий, *р<0,05; числа на графике означают количество клеток, в которых проводили регистрацию; n=2-3 животных; планки погрешностей: s.e.m).

На фигуре 88 (пример 40) показано одновременное мультиплексное редактирование генов в головном мозге мыши, (а) Схематическое изображение системы CRISPR-Cas9, предназначенной для мультиплексного целенаправленного воздействия на геном. (b) Графическое представление целевых локусов DNMT мыши. Направляющие РНК показаны синим цветом. Последовательности РАМ отмечены фиолетовым цветом, (с) Анализ в геле с помощью SURVEYOR™, демонстрирующий модификацию локусов DNMT в отсортированных путем FACS GFP-KASH-положительных клетках через 4 недели после доставки с помощью AAV в DG-область. (d) Анализ модификации локусов DNMT в отдельных клетках на основе глубокого секвенирования, демонстрирующий совместную встречаемость модификаций в нескольких локусах. (е) Вестерн-блот-анализ белков Dnmt3a и Dnmt1 после доставки in vivo системы CRISPR-Cas9, целенаправленно воздействующей на гены семейства DNMT (верхняя часть). Количественная оценка уровней белков Dnmt3a и Dnmt1 в DG посредством вестерн-блоттинга после целенаправленного воздействия CRISPR-Cas9 in vivo (нижняя часть; t-критерий, **р<0,001, *р<0,05, Dnmt3a: n=7; Dnmt1: n=5 от 5 животных; планки погрешностей: s.e.m). (f) Контекстные дефициты обучения через 8 недель после целенаправленного воздействия на гены DNMT с помощью SpCas9 в DG-области гиппокампа при тестировании» в тренировочном и измененном контексте (t-критерий, ***р<0,0001, n=18 животных, 2 независимых эксперимента; планки погрешностей: s.e.m).

На фигуре 89 (пример 40) показаны клонирование и экспрессия меченного НА SpCas9 (HA-SpCas9) при упаковке в AAV. (а) Схематический обзор различных стратегий клонирования для сведения к минимуму размера кассеты экспрессии SpCas9 с помощью короткого промотора Map1b крысы (pMap1b), усеченного варианта промотора Меср2 мыши (рМеср2) и короткого мотива поли(А) (spA). (b) Вестерн-блот-анализ культуры первичных кортикальных нейронов, экспрессирующих HA-SpCas9 с помощью различных кассет экспрессии SpCas9. (с) Промотор Меср2 управляет экспрессией HA-SpCas9 (красный цвет) в нейронах (Map1b, NeuN; стрелки), но не в астроглии (GFAP, указатели стрелок). Показана совместная экспрессия HA-SpCas9 и GFP-KASH (нижняя часть). Ядра метили с помощью DAPI (синий цвет). Масштабные метки - 20 мкм. (d) Схематический обзор мечения с помощью GFP. Проиллюстрированы улучшенный зеленый флуоресцентный белок (GFP), слитый с ядерным трансмембранным доменом KASH, и интеграция GFP-KASH во внешнюю ядерную мембрану, (е) Расчет эффективности совместного инфицирования, показывающий популяции клеток, экспрессирующих как HA-SpCas9, так и GFP-KASH (n=973 нейрона из 3 культур; планки погрешностей: s.e.m). (f) Клетки окрашивали с помощью набора LIVE/DEAD® через 7 дней после вирусной доставки. Количественная оценка DAPI+ и мертвых (DEAD+) клеток (n=518 контрольных ядер DAPI+; n=1003 ядра DAPI+ с SpCas9/GFP-KASH из 2 культур; планки погрешностей: s.e.m). (ITR - инвертированный концевой повтор; НА - гемагглютининовая метка; NLS - сигнал ядерной локализации; spA - синтетический сигнал полиаденилирования; U6 - промотор PolIII; sgRNA - одиночная направляющая РНК; hSyn - промотор гена синапсина 1 человека; GFP - зеленый флуоресцентный белок; KASH - ядерный трансмембранный домен гомологии Klarsicht/ANC1/Syne; bGH рА - сигнал полиаденилирования бычьего гормона роста; WPRE - посттранскрипционный регуляторный элемент вируса гепатита сурков).

На фигуре 90 (пример 40) показано целенаправленное воздействие на Меср2 в клетках Neuro-2a. (а) Целевые последовательности Меср2 и соответствующие мотивы, прилегающие к протоспейсерам (РАМ). (b) Оценка 6 sgRNA для Меср2, введенных путем совместной трансфекции с SpCas9 в клетки Neuro-2a. Показатели эффективности модификации локусов анализировали через 48 ч. после трансфекции с применением анализа с помощью SURVEYOR™.

На фигуре 91 (пример 40) показано целенаправленное воздействие CRISPR-SpCas9 на Меср2 в первичных кортикальных нейронах, (а) Иммунофлуоресцентное окрашивание МеСР2 (красный цвет) в культивируемых нейронах через 7 дней после трансдукции AAV-CRISPR (зеленый цвет, GFP-KASH). Ядра метили с помощью DAPI (синий цвет). Масштабная метка - 20 мкм. (b) Оценка целенаправленного воздействия на локус Меср2 с применением SpCas9 или dSpCas9 вместе с sgRNA для Меср2 или контрольной sgRNA (осуществляющей нацеливание на бактериальный ген lacZ) посредством анализа в геле с помощью SURVEYOR™, (с) Количественная оценка МеСР2-положительных ядер в целевой популяции нейронов (GFP+). (d) Вестерн-блот-анализ уровней белка МеСР2 после целенаправленного воздействия CRISPR-SpCas9 на локус Меср2 и количественная оценка уровней белка МеСР2 (t-критерий, **р<0,001, n=5 из 3 культур, планки погрешностей: s.e.m).

На фигуре 92 (пример 40) показаны морфологические изменения в дендритном дереве нейронов после опосредованного SpCas9 нокдауна МеСР2 in vitro, (а) Снижение сложности дендритного дерева в нейронах после целенаправленного воздействия CRISPR-SpCas9 на локус Меср2. Масштабная метка - 20 мкм. (b) Изменения в морфологии дендритных шипиков в нейронах, подвергнутых целенаправленному воздействию SpCas9 и sgRNA для Меср2. Масштабная метка - 10 мкм. Морфологию клеток визуализировали путем совместной трансфекции с конструкцией mCherry. Клетки для морфологического анализа выбирали на основании результата окрашивания Меср2. (с) Морфология дендритного дерева, оцениваемая по количеству кончиков дендритов, и (d) анализ Шолла (t-критерий, ***р<0,0001, n=40 из 2 культур), (е) Количественная оценка плотности шипиков (t-критерий, ***р<0,0001, n=40 из 2 культур, планки погрешностей: s.e.m).

На фигуре 93 (пример 40) показано секвенирование РНК в ядрах нейронов от контрольных животных и с опосредованным SpCas9 нокдауном Меср2. На диаграмме размаха представлено количество выявленных генов среди библиотек для секвенирования РНК (19 библиотек для каждого из 100 ядер, отобранных из ядер, трансдуцированных контрольной sgRNA или sgRNA для Меср2; n=4 животных/группа) на квантиль уровня экспрессии. Все гены разделяли на 10 квантилей по их среднему уровню экспрессии в log2(TPM+1), а затем для каждого квантиля подсчитывали количество выявленных генов (log2(TPM+1)>2) в каждом образце. Три показанные целевые последовательности представляют собой SEQ ID NO: _, SEQ ID NO: _ и SEQ ID NO: _ для Dnmt3a, Dnmt1 и Dnmt3b, соответственно.

На фигуре 94 (пример 40) показано мультиплексное целенаправленное воздействие на геном в отношении представителей семейства DNMT in vitro, (а) Целевые последовательности Dnmt3a, Dnmt1 и Dnmt3b и соответствующие мотивы, прилегающие к протоспейсерам (РАМ). (b) Анализ клеток Neuro-2a с помощью нуклеазы SURVEYOR™ через 48 часов после трансфекции с помощью вектора с SpCas9 и 3 × sgRNA для DNMT, нацеливающегося на локусы Dnmt3a, Dnmt1 и Dnmt3b. Показано эффективное редактирование генома для всех трех целевых генов.

На фигуре 95 (пример 40) показано секвенирование нового поколения для целевых локусов Dnmt3a, Dnmt1 и Dnmt3b. Примеры результатов секвенирования мутантных локусов Dnmt3a (a), Dnmt1 (b) и Dnmt3b (с) после доставки SpCas9 и 3 × sgRNA для DNMT в зубчатую извилину мыши in vivo. Зеленый цвет: последовательность дикого типа, красная пунктирная линия: удаленные основания, красные основания: вставка или мутации. Красные указатели стрелок указывают на сайт разрезания CRISPR-SpCas9. Полные последовательности, используемые на данной фигуре, приведены как SEQ ID NO:, SEQ ID NO: и SEQ ID NO: для локусов Dnmt3a, Dnmt1 и Dnmt3b, соответственно. Они представляют собой:

На фигуре 96 показаны последовательности белка SaCas9, являющиеся кодон-оптимизированными ("повт. опт.") и с удаленными сигналами убиквитинирования ("повт. опт. (Ub)") для повышения экспрессии. Белковые блоты меченных FLAG и НА SaCas9 демонстрируют приблизительно 2-кратное повышение экспрессии оптимизированного SaCas9 (повт. опт., №2-4) по сравнению с исходными конструкциями (№№0, 5 и 6) и сходный уровень по сравнению с SpCas9 (SpCas9 330, верхний прямоугольник на левой панели; SpCas9 414, верхний прямоугольник на правой панели). Добавление метки 3 × НА (правая панель, №6) усиливает детектирующий сигнал по сравнению с таковым для метки 1 × НА (правая панель, №5) в ~2 раза.

На фигуре 97 показана эффективность введения вставок/делеций с помощью sgRNA, транскрибируемых под контролем промотора U6 в существующем состоянии (серый цвет, левый прямоугольник для каждого количества нт) или с присоединенным "G" (синий цвет, правый прямоугольник для каждого количества нт и с более толстой рамкой) до наиболее близкого к 5'-концу положения sgRNA для SaCas9. Значения общей длины спейсерных sgRNA (включая G) указаны по оси х. На графике представлены совокупные данные для 5 sgRNA.

На фигуре 98 показана оптимизация длины спейсерной sgRNA (по оси х). На графиках показано образование вставок/делеций с различными значениями длины спейсерной sgRNA в клетках HEK (слева) и Нера (справа).

Фигуры приведены в данном документе только в целях иллюстрации, и они не обязательно изображены в масштабе.

Подробное описание изобретения Относительно общей информации о системах CRISPR-Cas: ссылка делается на предварительные заявки на патенты США 61/758468; 61/802174; 61/806375; 61/814263; 61/819803 и 61/828130, поданные 30 января 2013 г.; 15 марта 2013 г.; 28 марта 2013 г.; 20 апреля 2013 г.; 6 мая 2013 г. и 28 мая 2013 г., соответственно. Ссылка также делается на предварительную заявку на патент США 61/836123, поданную 17 июня 2013 г. Ссылка также делается на предварительные заявки на патенты США 61/736527 и 61/748427, поданные 12 декабря 2012 г. и 2 января 2013 г., соответственно. Ссылка также делается на предварительную заявку на патент США 61/791409, поданную 15 марта 2013 г. Ссылка также делается на предварительную заявку на патент США 61/799800, поданную 15 марта 2013 г. Ссылка также делается на предварительные заявки на патенты США 61/835931, 61/835936, 61/836127, 61/836101, 61/836080 и 61/835973, каждая из которых подана 17 июня 2013 г. Ссылка дополнительно делается на предварительные заявки на патенты США 61/862468 и 61/862355, поданные 5 августа 2013 г.; 61/871301, поданную 28 августа 2013 г.; 61/960777, поданную 25 сентября 2013 г., и 61/961980, поданную 28 октября 2013 г. Ссылка дополнительно делается на предварительную заявку на патент США 61/915325, поданную 12 декабря 2013 г. Каждая из данных заявок, и все документы, цитируемые в них или во время их рассмотрения ("документы, цитируемые в заявке"), и все документы, цитируемые или упомянутые в документах, цитируемых в заявке, вместе с любыми инструкциями, описаниями, характеристиками продукта и технологическими картами для любых продуктов, упомянутыми в них или в любом документе, упомянутом в них и включенном с помощью ссылки в данный документ, настоящим включены в данный документ с помощью ссылки и могут быть использованы в практическом осуществлении настоящего изобретения. Все документы (например, данные заявки и документы, цитируемые в заявке) включены в данный документ при помощи ссылки в такой же мере, как если бы конкретно и отдельно было указано, что каждый отдельный документ включен при помощи ссылки.

Также относительно общей информации о системах CRISPR-Cas упоминают:

Multiplex genome engineering using CRISPR/Cas systems. Cong, L., Ran, F.A., Cox, D., Lin, S., Barretto, R., Habib, N., Hsu, P.D., Wu, X., Jiang, W., Marraffini, L.A., & Zhang, F. Science Feb 15; 339(6121): 819-23 (2013);

RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Jiang W., Bikard D., Cox D., Zhang F, Marraffini LA. Nat Biotechnol Mar; 31(3): 233-9 (2013);

One-Step Generation of Mice Carrying Mutations in Multiple Genes by CRISPR/Cas-Mediated Genome Engineering. Wang H., Yang H., Shivalila CS., Dawlaty MM., Cheng AW., Zhang F., Jaenisch R. Cell May 9; 153(4): 910-8 (2013);

Optical control of mammalian endogenous transcription and epigenetic states. Konermann S, Brigham MD, Trevino AE, Hsu PD, Heidenreich M, Cong L, Piatt RJ, Scott DA, Church GM, Zhang F. Nature. 2013 Aug 22; 500(7463): 472-6. doi: 10.1038/Nature 12466. Epub 2013 Aug 23;

Double Nicking by RNA-Guided CRISPR Cas9 for Enhanced Genome Editing Specificity. Ran, FA., Hsu, PD., Lin, CY., Gootenberg, JS., Konermann, S., Trevino, AE., Scott, DA., Inoue, A., Matoba, S., Zhang, Y., & Zhang, F. Cell Aug 28. pii: S0092-8674(13)01015-5. (2013);

DNA targeting specificity of RNA-guided Cas9 nucleases. Hsu, P., Scott, D., Weinstein, J., Ran, FA., Konermann, S., Agarwala, V., Li, Y., Fine, E., Wu, X., Shalem, O., Cradick, TJ., Marraffini, LA., Bao, G., & Zhang, F. Nat Biotechnol doi:10.1038/nbt.2647 (2013);

Genome engineering using the CRISPR-Cas9 system. Ran, FA., Hsu, PD., Wright, J., Agarwala, V., Scott, DA., Zhang, F. Nature Protocols Nov; 8(11): 2281-308. (2013);

Genome-Scale CRISPR-Cas9 Knockout Screening in Human Cells. Shalem, O., Sanjana, NE., Hartenian, E., Shi, X., Scott, DA., Mikkelson, Т., Heckl, D., Ebert, BL., Root, DE., Doench, JG., Zhang, F. Science Dec 12. (2013). [Электронная публикация, предшествующая печатной];

Crystal structure of cas9 in complex with guide RNA and target DNA. Nishimasu, H., Ran, FA., Hsu, PD., Konermann, S., Shehata, SI., Dohmae, N., Ishitani, R., Zhang, F., Nureki, O. Cell Feb 27. (2014). 156(5): 935-49;

Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian cells. Wu X., Scott DA., Kriz AJ., Chiu AC, Hsu PD., Dadon DB., Cheng AW., Trevino AE., Konermann S., Chen S., Jaenisch R., Zhang F., Sharp PA. Nat Biotechnol. (2014) Apr 20. doi: 10.1038/nbt.2889 и

Development and Applications of CRISPR-Cas9 for Genome Engineering, Hsu et al., Cell 157, 1262-1278 (June 5, 2014) (Hsu 2014),

каждый из которых включен в данный документ с помощью ссылки и вкратце обсуждается ниже.

Cong и соавт. сконструировали системы CRISPR/Cas типа II на основе Cas9 Streptococcus thermophilus, а также и Cas9 Streptococcus pyogenes для применения в эукариотических клетках и продемонстрировали, что нуклеазы Cas9 могут быть направлены короткими РНК на индукцию точного расщепления ДНК в клетках человека и мыши. Их исследование дополнительно показало, что Cas9, превращенный в фермент, вносящий однонитевой разрыв, можно применять для облегчения репарации с участием гомологичной рекомбинации в эукариотических клетках с минимальной мутагенной активностью. Дополнительно, их исследование продемонстрировало, что в одной матрице CRISPR могут быть закодированы несколько направляющих последовательностей для обеспечения одновременного редактирования в нескольких сайтах эндогенных локусов генома в геноме млекопитающих, что демонстрирует легкую программируемость и широкое применение технологии нуклеаз, направляемых РНК. Эта возможность применения РНК для программирования специфичного к последовательности расщепления ДНК в клетках определила новый класс инструментов для геномной инженерии. Данные исследования дополнительно показали, что другие локусы CRISPR, вероятно, можно пересадить в клетки млекопитающих, и они могут также опосредовать расщепление генома млекопитающих. Важно отметить, что можно предусмотреть дополнительное улучшение некоторых аспектов системы CRISPR/Cas для повышения ее эффективности и оперативной гибкости.

Jiang и соавт. применяли эндонуклеазы Cas9, ассоциированные с короткими палиндромными повторами, регулярно расположенными группами (CRISPR), в комплексе с двойной РНК для введения точных мутаций в геномы Streptococcus pneumoniae и Escherichia coli. Подход опирался на расщеплении в целевом сайте генома под управлением системы двойная PHK:Cas9 для уничтожения немутантных клеток и устранял необходимость в селектируемых маркерах или системах негативного отбора. В исследовании сообщалось о перепрограммировании специфичности системы двойная PHK:Cas9 путем изменения последовательности короткой РНК CRISPR (crRNA) для внесения одно- или многонуклеотидных изменений, выполняемых с помощью матриц редактирования. Исследование показало, что одновременное использование двух crRNA обеспечивало мультиплексный мутагенез. Кроме того, когда подход применяли в комбинации с рекомбинационной инженерией, у S. pneumoniae практически 100% клеток, извлеченных с помощью описанного подхода, содержали желаемую мутацию, а у E. coli 65% извлеченных таковых содержали мутацию.

Konermann и соавт. изучали существующую в данной области техники необходимость в гибких и надежных технологиях, позволяющих осуществлять оптическое и химическое модулирование фермента Cas9 CRISPR на основе ДНК-связывающих доменов, а также эффекторов, подобных активаторам транскрипции.

Как обсуждается в настоящем описании, нуклеаза Cas9 из микробной системы CRISPR-Cas направляется на конкретные локусы генома направляющей последовательностью размером 20 нт, которая может допускать некоторые ошибки спаривания с ДНК-мишенью и, таким образом, способствует нежелательному нецелевому мутагенезу. Для изучения этого Ran и соавт. описали подход, в котором мутантную никазу Cas9 применяли в сочетании с парными направляющими РНК для введения целевых двухнитевых разрывов. Поскольку отдельные однонитевые разрывы в геноме подвергаются высокоточной репарации, одновременное внесение однонитевых разрывов с помощью соответствующим образом смещенных друг относительно друга направляющих РНК является необходимым для образования двухнитевых разрывов и увеличивает количество специфически распознаваемых оснований для расщепления мишени. Авторы продемонстрировали, что применение парного внесения однонитевых разрывов может снижать нецелевую активность в линиях клеток в 50-1500 раз и облегчать нокаут генов в зиготах мышей без уменьшения эффективности целевого расщепления. Данная гибкая стратегия обеспечивает большое разнообразие применений редактирования генома, требующих высокой специфичности.

Hsu и соавт. охарактеризовали специфичность целенаправленного воздействия SpCas9 в клетках человека, чтобы предоставить информацию для выбора целевых сайтов и избежать нецелевых эффектов. В исследовании оценивали >700 вариантов направляющей РНК и уровней мутаций по типу вставок/делеций, индуцированных SpCas9, в >100 предсказанных нецелевых локусах генома в клетках 293Т и 293FT. Авторы показали, что SpCas9 допускает ошибки спаривания между направляющей РНК и целевой ДНК в различных положениях в зависимости от последовательности с чувствительностью к количеству, положению и распределению ошибок спаривания. Авторы дополнительно показали, что на опосредованное SpCas9 расщепление не влияет метилирование ДНК и что для сведения к минимуму нецелевых модификаций можно подобрать дозу SpCas9 и sgRNA. Дополнительно, для облегчения применений в геномной инженерии млекопитающих авторы сообщили о получении инструментального программного обеспечения на веб-основе для управления выбором и подтверждением целевых последовательностей, а также анализов нецелевых явлений.

Ran и соавт. описали набор инструментов для опосредованного Cas9 редактирования генома посредством негомологичного соединения концов (NHEJ) или репарации с участием гомологичной рекомбинации (HDR) в клетках млекопитающих, а также создания модифицированных линий клеток для последующих функциональных исследований. Для сведения к минимуму нецелевого расщепления авторы дополнительно » описали стратегию внесения двойных однонитевых разрывов с помощью мутантной никазы Cas9 с парными направляющими РНК. Протокол, представленный авторами, является полученным экспериментальным путем руководством по выбору целевых сайтов, оценке эффективности расщепления и анализу нецелевой активности. Исследования показали, что, начиная с конструирования мишени, модификации генов можно получить в течение всего-навсего 1-2 недель, и модифицированные клональные линии клеток можно получить в течение 2-3 недель.

Shalem и соавт. описали новый способ исследования функций генов в полногеномном масштабе. Их исследования показали, что доставка библиотеки CRISPR-Cas9 для нокаута в масштабе генома (GeCKO), целенаправленно воздействующей на 18080 генов, с 64751 уникальной направляющей последовательностью обеспечивала скрининг путем как позитивного, так и негативного отбора в клетках человека. Во-первых, авторы показали применение библиотеки GeCKO для идентификации генов, существенных для жизнеспособности клеток у раковых и плюрипотентных стволовых клеток. Далее, в модели меланомы, авторы провели скрининг генов, утрата функций которых вовлечена в устойчивость к вемурафенибу, терапевтическому средству, ингибирующему мутантную протеинкиназу BRAF. Их исследования показали, что кандидаты высшего ранга включали ранее подтвержденные гены NF1 и MED12, а также новые хиты NF2, CUL3, TADA2B и TADA1. Авторы наблюдали высокий уровень согласованности между независимыми направляющими РНК, осуществляющими нацеливание на один и тот же ген, и высоким показателем подтверждения хитов и, таким образом, продемонстрировали перспективность скрининга с помощью Cas9 в масштабе генома.

Nishimasu и соавт. сообщали о кристаллической структуре Cas9 Streptococcus pyogenes в комплексе с sgRNA и ее целевой ДНК при разрешающей способности в 2,5 А°. В структуре была выявлена двухлопастная архитектура, образованная лопастью распознавания мишени и нуклеазной лопастью, обеспечивающих размещение гетеродуплекса sgRNA : ДНК в положительно заряженной бороздке на поверхности их соприкосновения. При том, что лопасть распознавания является существенной для связывания sgRNA и ДНК, нуклеазная лопасть содержит нуклеазные домены HNH и RuvC, расположенные надлежащим образом для расщепления комплементарной и некомплементарной нитей целевой ДНК, соответственно. Нуклеазная лопасть также содержит карбоксиконцевой домен, отвечающий за взаимодействие с мотивом, прилегающим к протоспейсеру (РАМ). Эти структурные анализы с высокой разрешающей способностью и сопутствующие функциональные анализы выявили молекулярный механизм целенаправленного воздействия Cas9, направляемых РНК, на ДНК, проложив, таким образом, путь для рациональной разработки новых гибких технологий редактирования генома.

Wu и соавт. производили полногеномное картирование сайтов связывания для каталитически неактивного Cas9 (dCas9) из Streptococcus pyogenes, который вводили с одиночными направляющими РНК (sgRNA) в эмбриональные стволовые клетки мыши (mESC). Авторы показали, что каждая из четырех тестируемых sgRNA осуществляет нацеливание dCas9 на сайты генома в количестве от нескольких десятков до нескольких тысяч, что часто характеризуется наличием 5-нуклеотидной затравочной области в sgRNA и мотива NGG, прилегающего к протоспейсеру (РАМ). Недоступность хроматина снижает связывание dCas9 с другими сайтами с последовательностями, комплементарными затравочной; таким образом, 70% нецелевых сайтов ассоциированы с генами. Авторы показали, что целенаправленное секвенирование 295 сайтов связывания для dCas9 в mESC, трансфицированных каталитически активным Cas9, выявило мутацию, превышающую фоновые уровни, только в одном сайте. Авторы предложили модель связывания с Cas9 и опосредованного им расщепления с двумя состояниями, в которой последовательность, комплементарная затравочной, запускает связывание, но для расщепления необходимо образование многочисленных пар с целевой ДНК.

Hsu 2014 представляет собой обзорную статью, в которой в общих чертах обсуждается история CRISPR-Cas9 от йогуртной культуры до редактирования генома, в том числе генетический скрининг клеток, которая содержится в информации, данных и полученных результатах в заявках, из которых происходит настоящее описание, поданных до 5 июня 2014 г. Общие идеи Hsu 2014 не включают конкретные модели и животных из настоящего описания.

Настоящее изобретение относится к конструированию и оптимизации систем, способов и композиций, применяемых для контроля экспрессии генов, включающего целенаправленное воздействие на последовательность, такое как внесение изменений в геном или редактирование генов, связанное с системой CRISPR-Cas и ее компонентами. В преимущественных вариантах осуществления фермент Cas представляет собой Cas9.

Полинуклеотидная последовательность CRISPR-Cas обычно именуется в данном документе направляющей или даже направляющей РНК (sgRNA), хотя будет понятно, что данная терминология ранее не являлась обычной. Кроме того, в данном документе делается ссылка на систему CRISPR-Cas9, хотя будет понятно, что настоящее изобретение можно широко осуществлять на практике в отношении любой системы CRISPR-Cas. Cas преимущественно обладает функцией нуклеазы для индукции DSB, однонитевого разрыва или двойного однонитевого разрыва. Cas9 является предпочтительным, a SaCas9 является особенно предпочтительным.

В примере 38 показано, что в случае использования систем CRISPR-Cas наблюдаются как генотипические, так и, что особенно важно, фенотипические изменения. Система CRISPR-Cas9, хотя и не только она, являлась эффективной в индукции фенотипического изменения in vivo.

В частности, мишень представляла собой АроВ, ген, участвующий в метаболизме липидов. Обнадеживающим является то, что можно сказать, что АроВ является "золотым стандартом" в доставке в печень и широко применяется в мышиных моделях ожирения.

Доставку осуществляли посредством внутривенной инъекции. Применяли вектор на основе AAV, а также печеночноспецифический промотор (TBG) для Cas9.

Доставка посредством экспрессии с вирусного вектора, рассматриваемая здесь, является улучшением по сравнению с предложенным Anderson/Yin (NBT 2884) применением гидродинамической доставки в качестве способа доставки, поскольку для гидродинамической доставки требуется инъекция нескольких мл жидкости, что является стрессогенным для организма мыши и может быть смертельным. Гидродинамическая доставка лучше всего подходит для доставки плазмидной ("оголенной") ДНК, тогда как авторы настоящего изобретения показали, что упаковка направляющей последовательности и последовательности Cas9 в вирусный вектор доставки является предпочтительной с точки зрения значительно возрастающей эффективности. Более того, необходимо вводить лишь относительно небольшие объемы, и это можно выполнить внутривенно (i.v.), что, вероятно, является намного более приемлемым с терапевтической точки зрения.

Особенно обнадеживающим является то, что для гена, являющегося "золотым стандартом" в печени, такого как АроВ, наблюдали не только генотипические изменения, но регистрировали также и фенотипические изменения. Предыдущая работа с PCSK9 показала генотипические, но не фенотипические изменения, так что фенотипические изменения, наблюдаемые для АроВ, подтверждают возможность доставки CRISPR в печень и ее способность к осуществлению фенотипического изменения в ней. Ее применяют в сочетании с более приемлемыми с терапевтической точки зрения способами доставки (i.v. по сравнению с гидродинамической доставкой). В связи с этим вирусная доставка системы CRISPR-Cas9 (направляющей последовательности и Cas9), особенно внутривенная, является предпочтительной.

Возможные мишени включают: PCSK9, HMGCR, АРОВ, LDLR, ANGPTL3, F8, F9/FIX, ААТ, FAH, HPD, TAT, АТР7В, UGT1A1, ОТС, ARH.

Соответственно, представлены способы индукции фенотипического изменения in vivo, включающие введение системы CRISPR-Cas9 в целевые клетки, например, в печень. В данном документе описаны подходящие пути доставки, но в некоторых вариантах осуществления предпочтительной является i.v. инъекция. Предпочтительными являются вирусные векторы, в особенности AAV, в частности, AAV серотипа 2/8.

Также представлена система CRISPR-Cas9, содержащая одну или несколько направляющих последовательностей, осуществляющих нацеливание на гены, участвующие в метаболизме липидов, например АроВ. Также предусмотрены способы лечения ожирения, включающие введение указанной системы CRISPR-Cas9. Мышиная модель, содержащая в печени один или несколько генов с нокдауном, в частности, генов, участвующих в метаболизме липидов, например, включающих АроВ, является предпочтительной.

Печеночноспецифические промоторы для Cas9 будут очевидными, но могут включать перечисленные выше. Предпочтительным примером является TBG.

Как показано в примере 39, направляющая последовательность может иметь длину 18-23 нуклеотида. Ее длина может составлять 18-22, или 19-22, или 18-21, 20-22, но предпочтительно 22 и наиболее предпочтительно 21 нуклеотид.

Также представлены проверка и подтверждение принципа успешной упаковки направляющей последовательности в интрон SaCas9. Соответственно, системы CRISPR-Cas9, где одна или несколько направляющих последовательностей упакованы (помещены или вставлены) в интрон Cas9, являются предпочтительными.

Промотор H1 может применяться и может быть предпочтительным в некоторых обстоятельствах.

Дополняя работу Ran (Cell, 154, 21 Aug 2013), исследовали степень перекрывания в подходе с двумя направляющими последовательностями с использованием двойной никазы D10A. Оптимальные результаты демонстрировались от -5 до +1 п.о. (от 5' до 5'). Соответственно, предпочтительным является применение подхода с двумя направляющими последовательностями для сведения к минимуму нецелевых эффектов. Они предпочтительно перекрываются или близки к перекрыванию на своих 5'-концах в различных нитях ДНК в геномной мишени. Перекрывание предпочтительно находится в диапазоне от -5 до +1 п.о. В этих случаях будет понятно, что Cas9 является двойной никазой, такой как предпочтительный вариант D10A.

В примере 40 представлены, помимо прочего: первая демонстрация успешной опосредованной AAV доставки Cas9 in vivo, а также эффективной модификации генома в постмитотических нейронах; разработка методики мечения ядер, позволяющей осуществлять простое выделение ядер нейронов из клеток, экспрессирующих Cas9 и sgRNA; демонстрация применений анализа транскриптома нейрона путем секвенирования РНК; то, как электрофизиологические исследования и другие методики можно объединить с опосредованным Cas9 внесением изменений в геном для определения фенотипических изменений; то, как электрофизиологические исследования и другие методики можно объединить с опосредованным Cas9 внесением изменений в геном для определения фенотипических изменений; то, как электрофизиологические исследования и другие методики можно объединить с опосредованным Cas9 внесением изменений в геном для определения фенотипических изменений; и демонстрация мультиплексного целенаправленного воздействия и возможности изучения функций генов по поведению грызунов с помощью опосредованного Cas9 редактирования генома.

Настоящее изобретение обеспечивает понимание и тестирование функций генов, в том числе создание и тестирование моделей; в том числе в отношении генной терапии, и, следовательно, генная терапия, способы генной терапии и применения генной терапии находятся в пределах компетенции специалиста в данной области на основании настоящего раскрытия.

Дополнительный аспект, дополнительно обсуждаемый ниже, относится к способу мечения ядер.

Будет понятно, что ссылка на системы CRISPR-Cas9 в данном документе является сокращенной ссылкой на ферменты Cas9, представленные в данном документе, в комбинации с направляющими последовательностями или направляющими последовательностями, применяемыми для нацеливания на одну или несколько геномных последовательностей. (И что настоящее изобретение также может рассматриваться в широком смысле как относящееся к системам CRISPR-Cas.) Ссылка на направляющую(направляющие) последовательность(последовательности) включает sgRNA, а также химерные полинуклеотидные последовательности, описанные в данном документе, содержащие направляющие последовательности, способные к гибридизации с целевыми последовательностями в геноме субъекта, парную tracr-последовательность и tracr-последовательность.

Данные по сути показывают фенотипические изменения, обусловленные нокдауном генов с помощью двух отдельных систем CRISPR-Cas9 согласно настоящему изобретению (направляющей РНК в комбинации с ферментом Cas9), в данном случае для успешного изменения функционирования генов. Выбранная ткань представляла собой ткань головного мозга, но результаты обеспечивают проверку и подтверждение принципа действия для широкого диапазона постмитотических тканей. Это является важным отличием, поскольку предыдущая работа была сосредоточена на делящихся клетках (т.е. премитотических).

Иными словами, при том, что SpCas9 широко применялся в генной инженерии делящихся клеток, авторы настоящего изобретения продемонстрировали, что SpCas9 также можно применять для геномной инженерии постмитотических нейронов. Ее осуществляют с высокой эффективностью посредством опосредованного NHEJ образования вставок/делеций для получения нокдаунов, но применения в терапии, включающие коррекцию посредством механизма HDR (при обеспечении наличия матрицы для репарации), также предусмотрены. Оба эти направления зависят от успешной доставки и функциональной экспрессии Cas9 и направляющей или направляющих РНК, показанной здесь.

Тот факт, что генотипические изменения, индуцируемые системами CRISPR-Cas9, впоследствии приводят к фенотипическому изменению, также важен для обеих вышеуказанных областей (исследования функций генов и генной терапии).

В первой системе CRISPR-Cas9 использовали направляющие последовательности, направленные на (осуществляющие нацеливание на) Меср2. Двухвекторная система CRISPR-Cas9, в которой один вектор содержит направляющую последовательность, а другой содержит Cas9, использовалась успешно, что предоставляло дополнительные проверку и подтверждение принципа действия для таких двухвекторных систем. Двухвекторную систему CRISPR-Cas9 успешно доставляли посредством стереотаксической инъекции в два отдельных участка головного мозга, а именно в зубчатую извилину гиппокампа и зрительную кору. В обоих случаях наблюдалось внесение изменений в гены в отношении одного и того же гена, Меср2, что указывало на успешную доставку двухвекторной системы и ее действие в соответствии с ожидаемым, с транскрипцией и функциональной активностью фермента Cas9 (в данном случае SpCas9) и успешным привлечением Cas9 к целевой геномной последовательности с помощью направляющих последовательностей.

Опосредованная AAV доставка SpCas9 и sgRNA in vivo обеспечивает быструю и эффективную технологию осуществления внесения точных изменений в геном в интактных нервных цепях. В силу этого применяемым вектором являлся вектор на основе AAV, что дает дополнительное основание для его применения в общем и в двухвекторных системах CRISPR-Cas9 в частности, в особенности в постмитотических клетках и тканях и, в частности, в головном мозге.

Разумеется, будет понятно, что выбор промотора является важным в осуществлении экспрессии системы CRISPR-Cas9, в частности, Cas9 или как направляющей(направляющих) последовательности(последовательностей), так и Cas9. Подходящие примеры специфичности к клетке и стадии жизненного цикла клетки можно определить из литературы. Тем не менее, авторы настоящего изобретения приводят несколько неограничивающих примеров: TBG, печеночноспецифический промотор, применяемый здесь для управления экспрессией SaCas9; промотор H1; усеченный промотор H1; промотор U6. Также, поскольку направляющим последовательностям не обязательно нужен конкретный промотор, одна или несколько направляющих последовательностей могут быть упакованы аналогичным образом в интрон Cas9.

Вторая применяемая система CRISPR-Cas9 предусматривает мультиплексный подход. Одним из ключевых преимуществ системы SpCas9 является ее способность к облегчению мультиплексного редактирования генома. Данная вторая система успешно целенаправленно воздействовала на три гена из одного семейства (в данном случае Dmnt1, 3а и 3b) благодаря включению подходящих направляющих последовательностей и приводила к стабильным нокаутам нескольких генов. Это явление широко применяется для изучения функций не только отдельных генов, но также и целых семейств генов в тканях живых животных. Оно является особенно важным для таких тканей, как головной мозг, где оно не было возможным ранее или могло быть достигнуто лишь спустя долгие годы применения методов классической генетики. Заявители показали, что у нормального животного в постмитотических клетках может иметь место внесение изменений в один или несколько генов (и даже полный нокдаун). Его, однако, в равной степени можно применять к модельному организму (например, уже несущему мутацию или внесенное изменение в гене или имеющему некоторым образом измененную экспрессию) или трансгенному организму, предоставляя быструю альтернативу существующим способам получения модельных организмов и применения модельных организмов для понимания функций генов. Для осуществления последующих циклов внесения изменений в гены и/или возобновления их действия (с восстановлением функции гена, например, путем коррекции гена с внесенными изменениями посредством обеспечения наличия, например, матрицы для репарации, такой как ssDNA, подходящей для HDR) в том же организме можно использовать дополнительные направляющие последовательности (и/или целые системы CRISPR-Cas9).

Известно, что при опосредованном SpCas9 целенаправленном воздействии на один или несколько генов, как правило, могут воспроизводиться морфологические, электрофизиологические и поведенческие фенотипы, наблюдаемые при применении классических, более времязатратных генетических мышиных моделей.

В альтернативном случае относительно нокдауна целых семейств генов или родственных генов данные также предоставляют здесь проверку и подтверждение принципа, заключающегося в том, что одновременный нокдаун трех или более неродственных генов является в равной степени возможным. Он применим во всех тканях, но особенно убедительно представлен в отношении постмитотических тканей, особенно головного мозга.

Другим применимым аспектом данной работы является то, что она продемонстрировала, что для изучения функций генов можно прибегнуть к комбинированному, или интегрированному, подходу, в котором используют CRISPR для осуществления генотипического изменения, а затем используют классические инструменты, такие как электрофизиологическое исследование (особенно в отношении ткани головного мозга и CNS), снятие биохимических, относящихся к секвенированию, электрофизиологических и/или поведенческих показателей, для установления того, какие фенотипические изменения, если они имеют место, обусловлены генотипическим изменением, индуцированным системой CRISPR-Cas9. Например, в головном мозге он позволяет изучать функции отдельных генов, а также их групп в нервных процессах и их роль в мозговых нарушениях in vivo.

Успешное внесение изменений в гены в данной работе в равной степени применимо для коррекции или возобновления функционирования гена, т.е. для применения систем CRISPR-Cas9 в генной терапии. В частности, это относится к целенаправленному воздействию в постмитотических клетках, особенно в головном мозге.

В целом, применение систем CRISPR-Cas9 демонстрирует улучшения по сравнению с существующими методиками, такими как применение Zn-пальцев, разработка и получение которых занимает длительное время и которые не могут функционировать в мультиплексе, и shRNA, которые имеют слишком много нецелевых эффектов, тогда как нецелевые эффекты CRISPR можно свести к минимуму путем применения подходов с двойной никазой.

Целенаправленное воздействие в тканях

В новой работе обосновано применение систем CRISPR-Cas9 для целенаправленного воздействия на гены в постмитотических клетках посредством доставки системы CRISPR-Cas9 в соответствующий участок (т.е. в клетки в органах или тканях, представляющих интерес). Предпочтительные ткани находятся в следующих органах:

почка;

пищеварительная система, в том числе желудок, поджелудочная железа, двенадцатиперстная кишка, подвздошная кишка и/или толстая кишка;

сердце;

легкое;

головной мозг, в частности, нейроны и/или CNS в целом;

глаз, в том числе ткань сетчатки;

ухо, в том числе внутреннее ухо;

кожа;

мышцы;

кости; и/или

печень в целом, хотя она исключена в некоторых вариантах осуществления, поскольку она также является объектом отдельного применения.

Будет понятно, что многие из вышеперечисленных органов могут содержать премитотические клетки, но данный аспект настоящего изобретения направлен на постмитотические клетки или ткани в этих органах.

В частности, для авторов настоящего изобретения предпочтительным органом является почка или головной мозг. Данные, в частности, демонстрируют доставку в зубчатую извилину гиппокампа и зрительную кору в головном мозге, которые являются предпочтительными тканями, хотя другие ткани, включающие любое одно или несколько из следующего: первичную моторную кору, первичную слуховую кору, первичную соматосенсорную кору, мозжечок, главную обонятельную луковицу, префронтальную кору, эндопириформное ядро, миндалевидное тело, черную субстанцию, полосатое тело, бледный шар, таламус, гипоталамус, парабрахиальное ядро, верхний оливарный комплекс, кохлеарные ядра, ядра сосцевидных тел, также являются предпочтительными в некоторых вариантах осуществления. Ткань печени также является предпочтительной в некоторых вариантах осуществления.

Клетки из головного мозга, и в частности, нейроны, являются особенно предпочтительными.

Выбор промотора для управления экспрессией системы CRISPR-Cas9, в частности, Cas9, является важным, как упоминается выше. При выборе промотора необходимо учитывать стадию клеточного цикла (раннюю/позднюю) и тип клеток, поскольку промоторы будут специфичными к одному или нескольким типам клеток и одной или нескольким стадиям клеточного цикла. Подходящие промоторы могут в некоторых вариантах осуществления включать в себя любой один или несколько из следующих. Подходящие промоторы могут в некоторых вариантах осуществления включать в себя любой один или несколько из следующих.

В двухвекторной системе CRISPR-Cas9, применяемой для целенаправленного воздействия в головном мозге, в частности, в зубчатой извилине гиппокампа, кассеты экспрессии SpCas9 и sgRNA упакованы в два отдельных вирусных вектора. Cas9, в частности, SpCas9, таким образом, предпочтительно доставляют с помощью аденовирусных векторов, в частности, AAV (т.е. в виде AAV-SpCas9). Направляющие последовательности предпочтительно доставляют в виде кассет экспрессии sgRNA с помощью аденовирусных векторов, в частности, AAV (т.е. в виде AAV-Sp-направляющая последовательность). Предпочтительным путем для данной ткани (зубчатой извилины гиппокампа) и для головного мозга в целом является стереотаксическая инъекция.

Понимание и тестирование функций генов и создание и применение моделей для этого

Состояния включают болезнь Хантингтона, но по сути включают любое состояние, обнаруживаемое в постмитотических клетках, и особенно те, изучение которых in vivo может принести пользу или для которых отсутствует применимая модель.

Как упоминается выше, системы CRISPR-Cas9 можно применять для исследования функций одного или нескольких генов в постмитотических клетках. Это можно осуществлять посредством доставки системы CRISPR-Cas9 в постмитотическую клетку и ее экспрессии в ней, где направляющая(направляющие) последовательность(последовательности) системы CRISPR-Cas9 предназначены для привлечения Cas9 к геномной мишени или мишеням, представляющим интерес. В то же время, если Cas9 уже содержится в постмитотической клетке в форме белка (транскрибированной), то доставка направляющих последовательностей в постмитотическую клетку будет достаточной. Если Cas9 уже содержится в постмитотической клетке в форме полинуклеотида (нетранскрибированной), то доставка направляющих последовательностей в постмитотическую клетку, а также индукция транскрипции полинуклеотида Cas9 будет необходимой. Наличие Cas9 под контролем индуцируемого или репрессируемого промотора, такого как система tet-on/off (тетрациклиновая), здесь может быть преимущественным.

Одним особенно перспективным аспектом является объединение методик CRISPR с фенотипическими анализами для определения фенотипических изменений, если они имеют место, обусловленных внесением изменений в гены, в частности, нокдаунами. Например, в примере 40 показано, чего можно достичь с помощью целенаправленного внесения изменений в геном в сочетании со снятием количественных показателей для обеспечения проникновения в сущность биологических функций конкретных элементов генома. В частности, опосредованное Cas9 редактирование генома в головном мозге in vivo можно также сочетать с электрофизиологической регистрацией для изучения эффекта от внесения изменений в геном в отношении конкретных типов клеток или компонентов нервной цепи. В более широком смысле применение систем CRISPR-Cas9 (для обеспечения опосредованного Cas9 внесения изменений в геном) можно объединять с биохимическим, секвенирующим, электрофизиологическим и поведенческим анализом для изучения функций целевого элемента генома.

Таким образом, в одном аспекте представлен способ исследования функций одного или нескольких генов в постмитотической клетке, включающий:

индукцию дефектов в генотипе или нокдауна генов, как описано ниже; и

определение изменений в экспрессии одного или нескольких генов в данном состоянии с исследованием, таким образом, функций одного или нескольких генов.

Способ также необязательно может включать:

трансплантацию второй популяции клеток субъекту с индукцией, таким образом, состояния, ассоциированного с дефектным генотипом или нокдауном генов. Это может предшествовать этапу определения.

Следующее относится в широком смысле к соответствующим аспектам настоящего изобретения. Клетка может находиться в субъекте, таком как человек, животное или модельный организм, так что функции генов исследуют in vivo. Однако, также предусмотрено, что клетка может находиться ex vivo, например, в клеточной культуре или в модельном органе или органоиде. В некоторых вариантах осуществления способ может включать выделение первой популяции клеток из субъекта, необязательно их культивирование и их трансдукцию одной или несколькими системами CRISPR-Cas9. За этим может следовать необязательное дополнительное культивирование. Затем может происходить трансплантация трансдуцированных клеток обратно субъекту.

Клетка может быть получена из любой ткани или органа, описанных в данном документе. Головной мозг является одним предпочтительным примером, обеспечивающим осуществление указанного способа исследования функций одного или нескольких генов, где постмитотическая клетка является клеткой головного мозга, например, нейроном. В частности, он обеспечивает исследование функций генов in vivo по поведению животного. Животное предпочтительно является млекопитающим, например, грызуном. С учетом сложности нервной системы, состоящей из разветвленных сетей разнородных типов клеток, способность к эффективному редактированию генома нейронов in vivo позволяет осуществлять прямое тестирование функций генов в надлежащих типах клеток, погруженных в естественный контекст. Это подтверждается данными авторов настоящего изобретения, где нокаутные мыши демонстрировали ухудшение консолидации памяти при тестировании в условиях тренировочного контекста. Результаты авторов настоящего изобретения демонстрируют, что опосредованный CRISPR-Cas9 нокаут представителей семейства DNMT в нейронах зубчатой извилины является достаточным для изучения функций генов в поведенческих задачах.

Это показывает оперативную гибкость Cas9 в облегчении целенаправленного нокаута генов в головном мозге млекопитающих in vivo для изучения функций генов и, в частности, для разъединения нейронных цепей. Введение стабильных нокаутов нескольких генов в головном мозге живых животных будет иметь потенциально многообещающие применения, такие как казуальное исследование полигенных механизмов, лежащих в основе физиологических и невропатологических состояний.

Характерной особенностью данной работы является то, что авторы настоящего изобретения выбрали промотор Меср2 мыши (235 п.о., рМеср2)7 и минимальный сигнал полиаденилирования (48 п.о., spA) на основании их способности к обеспечению достаточных уровней экспрессии SpCas9 в культивируемых первичных кортикальных нейронах мыши. Ген Меср2 играет важнейшую роль при синдроме Ретта, типе расстройства аутистического спектра. Для целенаправленного воздействия на Меср2 авторы настоящего изобретения вначале разработали несколько sgRNA, осуществляющих нацеливание на экзон 3 гена Меср2 мыши, и оценивали их эффективность с применением клеток Neuro-2a. Наиболее эффективную sgRNA идентифицировали путем применения анализа с помощью нуклеазы SURVEYOR. Доставку осуществляли посредством стереотаксической инъекции смеси (в соотношении 1:1) высокого титра AAV-SpCas9 и AAV-Sp-направляющая последовательность. Авторы настоящего изобретения также успешно протестировали возможность мультиплексного редактирования генома в головном мозге; авторы настоящего изобретения разработали мультиплексный вектор экспрессии sgRNA, состоящий из трех sgRNA в тандеме вместе с GFP-KASH для мечения ядер.

Таким образом, также представлены способы индукции состояний, предусматривающих один или несколько нокдаунов генов в постмитотической клетке. Примеры таких состояний являются многочисленными, но могут включать синдром Ретта, проиллюстрированный на примере. Подходящие промоторы будут очевидными, и промотор Меср2 является наиболее подходящим для синдрома Ретта. Одним из способов выбора промотора для управления экспрессией системы CRISPR-Cas9, в частности, Cas9, является выбор промотора для гена, представляющего интерес.

Таким образом, в одном аспекте представлен способ индукции состояний, предусматривающих один или несколько дефектных генов (или генотипов) или нокдаунов генов в постмитотической клетке, включающий:

трансдукцию первой популяции клеток не встречающейся в природе или сконструированной композицией, содержащей векторную систему, содержащую один или несколько векторов, содержащих

первый регуляторный элемент, функционально связанный с полинуклеотидной последовательностью химерной РНК (chiRNA) системы CRISPR-Cas, где полинуклеотидная последовательность содержит

одну или несколько, предпочтительно три или более, направляющих последовательностей, способных гибридизироваться с тремя или более целевыми последовательностями в геноме субъекта,

парную tracr-последовательность, и

tracr-последовательность, и

второй регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации (NLS), где (а), (b) и (с) расположены в 5'-3' ориентации,

где компоненты I и II находятся в одном и том же или разных векторах системы, где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплексов CRISPR с целевой последовательностью,

где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью,

где фермент CRISPR изменяет геном клеток первой популяции с получением второй популяции клеток, содержащих один или несколько дефектных генов или генов с нокдауном.

Способ также необязательно может включать:

выделение первой популяции клеток из субъекта.

Способ также необязательно может включать:

трансплантацию второй популяции клеток субъекту с индукцией, таким образом, пролиферативного состояния.

Она по сути включает индукцию нефункционального (включающего частично нефункциональное) состояния генотипа в целевой клетке с получением, таким образом, модели для изучения (в том числе будущего восстановления функционального генотипа).

Системы CRISPR-Cas9 также можно применять для облегчения изучения функций генов в клеточных анализах путем обеспечения целенаправленного нокаута в постмитотических нейронах.

Способы доставки нуклеотидов в нервные клетки хорошо известны и рассматриваются Karra and Dahm в The Journal of Neuroscience (5 May 2010, 30(18): 6171-6177; doi: 10.1523/JNEUROSCI.0183-10.2010). Примеры включают электрические способы трансфекции (такие как электропорация, нуклеофекция и электропорация отдельных клеток); химические способы трансфекции (такие как совместное осаждение фосфатом Са2+ и липофекция); вирусная доставка (как, например, с помощью аденовируса, аденоассоциированного вируса (AAV), лентивируса и вируса простого герпеса) и физические способы трансфекции (такие как микроинъекция и баллистическая трансфекция (применение частиц золота, покрытых ДНК)). Все из этого можно применять для доставки системы CRISPR-Cas9, но липофекция или вирусные способы, в особенности с применением AAV или лентивируса, являются предпочтительными.

Модели

Представлены модели с нокдауном одного или нескольких генов. Примером может быть модель синдрома Ретта с нокдауном Меср2 на грызунах. В других моделях предусмотрены нокдауны генов семейства Dmnt, в частности, нокдауны Dmnt1, 3а и 3b. В силу этого представлены модели, в которых изучают неврологические состояния. Все, что должно быть сделано - это идентификация целевых генов, представляющих интерес, разработка подходящей(подходящих) направляющей(направляющих) последовательности(последовательностей) и включение их в состав подходящей системы CRISPR-Cas9, а также ее доставка в постмитотическую(постмитотические) клетку(клетки) in vivo либо ex vivo в соответствии с требованиями. Например, представлены модели, которые могут иметь измененную морфологию дендритного дерева и/или плотность шипиков.

Как упоминается выше, представлены также модельные ткани, такие как органоиды или "печень на чипе" или их эквиваленты, отличные от печени, такие как ткани уха, почки и головного мозга, например, на чипе или закрепленные на подложке. Предпочтительными являются животные модели и модельные ткани. Они могут быть уже трансформированы с помощью Cas9, так что они содержат Cas9 в форме нуклеотида или белка, как упоминается выше. Их преимущество заключается в том, что Cas9 не нужно доставлять вместе с направляющей(направляющими) последовательностью (последовательностями), и это, в свою очередь, может обеспечивать значительно более высокую степень мультиплексирования направляющих последовательностей, которые следует поместить в векторы доставки. В этом случае применение индуцируемых или репрессируемых систем, таких как tet-on или tet-off, здесь также может быть преимущественным.

Модели, которые можно получить с применением системы CRISPR-Cas9, описаны в данном документе и находятся в пределах компетенции специалиста в данной области на основании данного раскрытия и сведений из уровня техники. Ввиду оперативной гибкости системы CRISPR-Cas9 диапазон возможных моделей, на человеке, грызунах, млекопитающих либо иных, является весьма разнообразным, и он может быть установлен путем простого выбора соответствующей(соответствующих) направляющей(направляющих) последовательности(последовательностей). Также представлены способы создания таких моделей.

Генная терапия

Данные в примере 40 сосредотачивают внимание на внесении изменений в гены, главным образом на нокдаун. Нокдаун генов, вероятно, является лишь небольшой, хоть и важной, частью общей совокупности возможных применений систем CRISPR-Cas9 в генной терапии. Как уже было показано в статье Yin и Anderson (Nature Biotech 2884, опубликованной в режиме онлайн 30 марта 2014 г.), функциональный фенотип можно восстановить после коррекции мутации недостаточности при наследственной тирозинемии I типа (HTI), в иных случаях смертельном состоянии, вызываемом мутацией фумарилацетоацетатгидролазы (FAH) (замена G на А в последнем нуклеотиде экзона 8), вызывающей пропуск экзона 8 при сплайсинге и обуславливающей образование усеченного нестабильного белка FAH, что приводит к накоплению токсичных метаболитов. Коррекция мутации А с возвращением к генотипу G дикого типа приводила к восстановлению фенотипа.

В силу этого подходы, принятые в настоящей работе, вероятно, могут применяться в генной терапии. В частности, подход с двумя векторами, подход с мечением ядер, характерные особенности доставки в головной мозг (форма инъекции, применяемые промоторы и/или вирусные векторы), а также мультиплексирование (применение нескольких направляющих последовательностей для нескольких мишеней в одном и том же либо в разных генах) можно в равной степени применять в коррекционной генной терапии (т.е. где коррекции подвергается дефектный генотип), а также и в проиллюстрированном на примере нокдауне генов. Основным различием между коррекционной генной терапией и нокдауном генов является то, что в целях коррекции дефектного генотипа, как, например, точечной мутации (например, при муковисцидозе, см. ссылку на Schwank et al., Cell Stem Cell 13, 653-658, 5 декабря 2013 г.), преимущественным является обеспечение наличия матрицы для репарации для стимуляции механизма HDR, а в идеальном случае также обеспечение наличия подходящей никазы Cas9.

Соответственно, векторы по настоящему изобретению предпочтительно нацеливаются на постмитотические клетки. Если направляющая последовательность или направляющие последовательности осуществляют нацеливание на дефектный генотип, то они предпочтительно также представлены вместе с матрицей для репарации, например, ssDNA, соответствующей скорректированной последовательности (генотипу, обеспечивающему наличие функционального фенотипа). Матрицы для репарации описаны в данном документе. Cas9 может быть представлена в том же векторе, что и направляющая последовательность или направляющие последовательности, или в другом векторе. Векторы предпочтительно являются вирусными векторами, более предпочтительно аденовирусными векторами и наиболее предпочтительно векторами на основе AAV. Доставку в клетки предпочтительно осуществляют посредством внутривенной инъекции или посредством стереотаксической инъекции в соответствующих случаях. Выбор промотора также может быть важным, и предпочтительные примеры приведены в данном документе.

Представлены способы лечения генетических заболеваний или состояний, обусловленных или ассоциированных с дефектным генотипом в постмитотических клетках, включающие доставку системы CRISPR-Cas9 в соответствующую клетку. Дефектный генотип может представлять собой генотип, отличный от дикого типа. В частности, одиночные точечные мутации и/или моногенные нарушения особенно подходят для лечения с помощью систем CRISPR-Cas9. Если редактирования или коррекции требуют несколько генов, то для одновременного целенаправленного воздействия на всех них можно применять мультиплексный подход. В альтернативном случае могут быть предусмотрены два или более цикла применения различных систем GRISPR-Cas9. Целью коррекции предпочтительно является получение генотипа дикого типа. Он не обязательно должен быть наиболее распространенным генотипом, при условии, что в фенотипе восстанавливается или улучшается функция.

Примером восстановленного фенотипа является восстановление слуха с восстановлением функции VGLUT3 во внутреннем ухе и, следовательно, слуха у мышей (Omar Akil, Rebecca P. Seal., Kevin Burke, Chuansong Wang, Aurash Alemi, Matthew During, Robert H. Edwards, Lawrence R. Lustig. Restoration of Hearing in the VGLUT3 Knockout Mouse Using Virally Mediated Gene Therapy. Neuron, 2012; 75 (2): 283 DOI: 10.1016/j.neuron.2012.05.019). Его осуществляли с помощью опосредованной AAV доставки самого VGLUT3, но вполне вероятно, что также можно было применять систему CRISPR-Cas9, предпочтительно также с помощью векторов на основе AAV, для целенаправленного воздействия в клетках внутреннего уха и коррекции нефункционального генотипа VGLUT3 с аналогичными фенотипическими последствиями, а именно восстановлением слуха. В силу этого предпочтительной является доставка системы CRISPR-Cas9 во внутреннее ухо с помощью векторов на основе AAV с лечением, таким образом, потери слуха. В связи с этим можно заметить, что восстановление функций генов в органах чувств, таких как глаз, в том числе сетчатка, нос и ухо (в частности, внутреннее ухо), является предпочтительным.

Сравнительно недавний обзор, включающий обсуждение нарушений в постмитотических тканях (в глазу, ухе и за их пределами), представлен Kaufmann и соавт. (EMBO Mol Med (2013, 5, р. 1642-1661). Он подтверждает применимость AAV в коррекции моногенных нарушений в постмитотических тканях. В нем отмечено, что "в сочетании с другими характеристиками, такими как низкая воспалительная активность, они продемонстрировали, что обладают превосходным профилем безопасности и поэтому являются весьма привлекательными инструментами для генной терапии in vivo. Так, Glybera® является рекомбинантным AAV для прямой внутримышечной инъекции…" В данной статье вместе с цитируемыми документами рассматривается генная терапия в сетчатке, центральной нервной системе, печени, скелетной и сердечной мускулатуре в качестве целевых тканей. Также в ней вместе с цитируемыми документами указано, что "в начальных исследованиях использовали вектор-прототип на основе AAV серотипа 2, ассортимент векторов на основе AAV недавно был расширен с включением дополнительных серотипов и даже сконструированных капсидов". Статья Kaufmann и документы, цитируемые в статье Kaufmann, настоящим включены в данный документ с помощью ссылки.

Анализ транскриптома путем секвенирования РНК

Комбинация опосредованного SpCas9 внесения изменений в геном и анализ путем секвенирования РНК на популяционном уровне дает возможность охарактеризовать регуляцию транскрипции и предположить, какие гены могут быть важными для конкретных функций или болезненных процессов в рассматриваемых клетках. В частности, клетки являются клетками головного мозга, в частности, нейронами. Быстродействующие методики, такие как применение системы CRISPR-Cas9, являются преимущественными в исследовании транскриптома, который по своей природе является изменчивым. В силу этого представлено применение систем CRISPR-Cas9 согласно настоящему изобретению в анализе транскриптома (секвенировании РНК).

Способ мечения ядер

Для облегчения иммунофлуоресцентной идентификации нейронов, экспрессирующих SpCas9, авторы настоящего изобретения метили SpCas9 эпитопной НА-меткой (полученной из гемагглютинина вируса гриппа человека, обычной эпитопной меткой, широко применяемой в векторах экспрессии).

Авторы настоящего изобретения упаковывали в вектор AAV-Sp-направляющая последовательность кассету экспрессии U6-sgRNA, а также зеленый флуоресцентный белок (GFP), слитый с ядерным трансмембранным доменом KASH, под управлением промотора гена синапсина I человека. Белок слияния GFP-KASH направляет GFP во внешнюю ядерную мембрану и обеспечивает флуоресцентную идентификацию и очистку интактных ядер нейронов, трансдуцированных вектором AAV-Sp-направляющая последовательность.

Соответственно, векторы по настоящему изобретению предпочтительно приспосабливают аналогичным образом. Таким образом, представлены векторы, где Cas9 помечен эпитопной меткой, такой как эпитопная НА-метка. Cas9 может представлять собой любой Cas9, описанный в данном документе, например, Sp или SaCas9, и может представлять собой любой вариант (такой как двойная никаза D10A и т.д.), при условии, что он помечен или может быть помечен соответствующим образом.

Векторы по настоящему изобретению могут также быть приспособлены так, чтобы направляющая РНК была упакована в кассету экспрессии, которая содержит:

репортерный белок и

необязательно подходящий промотор для направляющей РНК, такой как U6;

где репортерный белок слит с ядерным трансмембранным доменом, функционально связанным с подходящим промотором для него.

Репортерный белок предпочтительно представляет собой флуоресцентный белок, например, один из зеленого, красного или желтого флуоресцентных белков (GFP, RFP, YFP) и т.д.

Примеры ядерных трансмембранных доменов включают KASH-подобные домены, домены Sun2, домены LEM. В некоторых предпочтительных вариантах осуществления ядерный трансмембранный домен представляет собой ядерный трансмембранный домен KASH. Промотор для трансмембранного домена предпочтительно представляет собой промотор гена синапсина I человека; см. также документы, цитируемые в данном документе.

Данный подход с мечением можно применять в рамках одновекторных или двухвекторных систем, но предпочтительно в рамках двухвекторных систем, поскольку в одновекторных системах пространство ограничено, и необходимость в отдельных метках также снижается.

Дополнительно, каждый аспект данной методики мечения можно применять независимо от другого, так что эпитопное мечение Cas9 можно применять в отдельности, или подход с кассетой с репортерным/флуоресцентным белком можно применять в отдельности, или, более предпочтительно, оба их можно применять вместе.

Для Cas9 предпочтительными являются множественные или повторяющиеся эпитопные метки. В частности, в примере 41 показана тройная эпитопная метка для улучшения выявления. Метка предпочтительно является повторяющейся, более предпочтительно тройной повторяющейся. НА является предпочтительной эпитопной меткой для Cas9. Тройная эпитопная НА-метка является, таким образом, предпочтительной в некоторых вариантах осуществления.

Публикация Kanasty and Anderson (Nature Materials, Vol 12 Nov 2013), изначально поданная 11 марта 2013 г. и опубликованная в режиме онлайн 23 октября 2013 г., является полезным обзором доставки средств для RNAi. Ввиду сходств между средствами для RNAi и направляющими последовательностями CRISPR идеи этого и других источников из уровня техники в отношении RNAi являются информативными относительно механизмов доставки направляющих последовательностей в системе CRISPR-Cas9 авторов настоящего изобретения. Некоторые из описанных методик также подходят для доставки Cas9. В некоторых случаях может быть целесообразной доставка направляющих последовательностей системы CRISPR-Cas9 авторов настоящего изобретения отдельно от Cas9. Она может быть частью двухвекторной системы доставки, где векторы рассматриваются в самом широком смысле попросту как любые средства доставки, а не как конкретные вирусные векторы. Предусмотрено, что Cas9 можно доставлять с помощью вирусного вектора, и что направляющие последовательности, специфичные к геномным мишеням, доставляют отдельно. Как обсуждается в данном документе, направляющие последовательности можно доставлять с помощью тех же типов векторов, что и в случае Cas9, например, с использованием двухвекторной системы, где Cas9 доставляют в векторе на основе AAV, а направляющую(направляющие) последовательность(последовательности) доставляют в отдельном векторе на основе AAV. Это можно осуществлять практически одновременно (т.е. путем совместной доставки), но это также можно осуществлять в разные моменты времени, разделенные даже несколькими неделями или месяцами. Например, если были доставлены системы CRISPR-Cas9 для первого цикла, но затем впоследствии требуется обеспечение наличия дополнительных направляющих последовательностей, то первоначальный Cas9, который, как следует надеяться, по-прежнему является функциональным в целевых клетках, можно использовать повторно. Если Cas9 находится под контролем индуцируемого промотора, то предпочтительной является индукция транскрипции нового Cas9 в целевых клетках. В то же время, если применяется модель, экспрессирующая Cas9, представленная в данном документе, то необходимой является только доставка направляющей(направляющих) последовательности (последовательностей). Соответственно, если требуется доставка направляющей(направляющих) последовательности (последовательностей) отдельно от Cas9, то их можно доставлять практически таким же образом, как и средство для RNAi. В силу этого обзор Kanasty является полезным в том, что указывает на ряд известных подходов, являющихся подходящими, сосредотачивая особое внимание на печени, хотя средства доставки, как правило, пригодны для широкого диапазона клеток. Примеры включают:

"липосомную систему доставки, а также siRNA, конъюгированные с липофильными молекулами, которые взаимодействуют с сывороточными липопротеинами и впоследствии проникают в гепатоциты, поглощающие эти липопротеины";

пегилирование;

конъюгаты, такие как:

динамические поликонъюгаты (DPC, наночастицы размером 10 нм), которые, как было показано, доставляют средства для RNAi с успешным подавлением экспрессии АроВ (что, таким образом, пересекается с работой авторов настоящего изобретения по целенаправленному воздействию на АроВ с помощью системы CRISPR-Cas9); и

трехантенарные конъюгаты GalNAc являются "высокоэффективными в обеих категориях", в особенности GalNAc;

другие наночастицы включают:

полимерные наночастицы на основе циклодекстрина (CDP), включающие дополнительные компоненты состава, такие как адамантин-PEG (AD-PEG) и адамантин-PEG-трансферрин (AD-PEG-Tf);

липидные наночастицы (LNP), включающие катионные или ионизируемые липиды, экранирующие липиды, холестерин и эндогенные или экзогенные нацеливающие лиганды. Примером эндогенного нацеливающего лиганда является ретинол-связывающий белок (RBP), применимый для нацеливания на звездчатые клетки печени и поджелудочной железы, которые экспрессируют рецептор RBP. Примером экзогенного нацеливающего лиганда является GalNac, который также осуществляет нацеливание на печень посредством асиалогликопротеинового рецептора на поверхности гепатоцитов. В случае ALN-VSP от Anlylams представлен комбинированный подход;

"фенестрация эндотелия печени позволяет молекулам диаметром 100-200 нм диффундировать из кровотока и получать доступ к гепатоцитам и другим клеткам печени";

лиганды, такие как GalNAc, подходят для доставки в непаренхимные клетки печени, экспрессирующие маннозный рецептор, и в гепатоциты, где было показано, что конъюгация подходящей siRNA с лигандом GalNAc обеспечивает успешное подавление экспрессии PCSK9; и

олигонуклеотидные наночастицы (ONP), состоящие из комплементарных фрагментов ДНК, предназначенных для гибридизации в предварительно определенную 3D-структуру. С помощью подходящих последовательностей с "липкими" 3'-концами к каждой частице могут быть прикреплены, и даже в определенном положении, 6 нитей siRNA. Гидродинамический диаметр составлял приблизительно 29 нм.

Эти подходы в некоторых вариантах осуществления являются предпочтительными для доставки по меньшей мере направляющих последовательностей системы CRISPR-Cas9. Особенно предпочтительными являются динамические поликонъюгаты или применение эндогенных нацеливающих лигандов, таких как ретинол-связывающий белок, или экзогенных нацеливающих лигандов, таких как GalNac.

Преимущество способов по настоящему изобретению заключается в том, что система CRISPR избегает нецелевого связывания и возникающих в результате этого побочных эффектов. Это достигается при применении систем, предусматривающих наличие высокой степени специфичности к последовательности в отношении целевой ДНК.

Cas9

Оптимизацию Cas9 можно, применять для улучшения функционирования или для формирования новых функций, можно создавать химерные белки Cas9. Созданные заявителями образцы представлены в примере 6. Химерные белки Cas9 можно получать путем объединения фрагментов от различных гомологов Cas9. Например, в данном документе описаны два иллюстративных химерных белка Cas9 из Cas9. Например, заявители слили N-конец St1Cas9 (фрагмент из этого белка выделен жирным шрифтом) с С-концом SpCas9. Выгода от создания химерных Cas9 включает любое или все из следующего: пониженная токсичность; улучшенная экспрессия в эукариотических клетках; повышенная специфичность; сниженный молекулярный вес белка, например, при получении меньшего белка за счет объединения наименьших доменов от различных гомологов Cas9; и/или изменение требований к последовательности РАМ.

Cas9 можно использовать в качестве стандартного ДНК-связывающего белка. Например, как показано в примере 7, заявители использовали Cas9 в качестве стандартного ДНК-связывающего белка путем внесения мутации в два каталитических домена (D10 и Н840), ответственных за расщепление обеих нитей ДНК-мишени. С целью повышающей регуляции транскрипции гена в целевом локусе заявители слили домен активации транскрипции (VP64) с Cas9. Известны и другие домены активации транскрипции. Как показано в примере 17, активация транскрипции является возможной. Как также показано в примере 17, репрессия генов (в этом случае гена бета-катенина) возможна при использовании репрессора Cas9 (ДНК-связывающего домена), который связывается с последовательностью целевого гена, тем самым подавляя ее активность.

Cas9 и одну или несколько направляющих РНК можно доставлять при помощи аденоассоциированного вируса (AAV), лентивируса, аденовируса или других типов плазмидных или вирусных векторов, в частности, с применением составов и доз из, например, патентов США №№8454972 (составы, дозы для аденовируса), 8404658 (составы, дозы для AAV) и 5846946 (составы, дозы для плазмидных ДНК) и из клинических испытаний и публикаций относительно клинических испытаний с участием лентивируса, AAV и аденовируса. Например, для AAV путь введения, состав и доза могут быть определены в патенте США №8454972 и в клинических испытаниях с участием AAV. Для аденовируса путь введения, состав и доза могут быть определены в патенте США №8404658 и в клинических испытаниях с участием аденовируса. Для доставки с помощью плазмид путь введения, состав и доза могут быть такими, как определено в патенте США №5846946 и в клинических испытаниях с участием плазмид. Дозы могут быть определены в расчете на или экстраполированы на среднего индивидуума массой 70 кг и могут быть скорректированы для пациентов, субъектов, млекопитающих с другой массой и из другого вида. Частота введения входит в пределы компетенции практикующего врача или ветеринара (например, доктора, ветеринарного врача) и зависит от обычных факторов, в том числе от возраста, пола, общего состояния здоровья, других состояний пациента или субъекта и конкретных рассматриваемых состояния или симптомов.

Вирусные векторы можно инъецировать в представляющую интерес ткань. В случае модификации генома, специфичной относительно типа клетки, экспрессия Cas9 может управляться промотором, специфичным к типу клеток. Например, при печеночноспецифической экспрессии может использоваться промотор гена альбумина, а при нейрон-специфической экспрессии может использоваться промотор гена синапсина I.

Трансгенные животные и растения

Также представлены трансгенные животные (модели), и следующее в равной степени относится к модельным тканям и скоплениям тканей ex vivo, таким как органоиды, печень на чипе и т.д. Предпочтительные примеры включают животных, содержащих Cas9, имея при этом в виду полинуклеотиды, кодирующие Cas9, или белок сам по себе. Предпочтительными являются мыши, крысы и кролики. Для получения трансгенных мышей с конструкциями в соответствии с примерами в данном документе можно инъецировать чистую линейную ДНК в пронуклеус зиготы от псевдобеременной самки, например, самки СВ56. Особей-основателей можно затем идентифицировать, генотипировать и подвергать возвратному скрещиванию с мышами СВ57. Конструкции можно затем клонировать и необязательно проверять, например, посредством секвенирования по Сэнгеру. Предусматриваются нокауты, где, например, один или несколько генов в модели подвергают нокауту. Однако, также предусматриваются нокины (в отдельности или в комбинации). Были получены иллюстративные мыши, нокинные по Cas9, и это представлено на примере, однако, нокины Cas9 являются предпочтительными. Для создания нокина Cas9 у мыши можно целенаправленно воздействовать теми же конструкциями для конститутивной и условной экспрессии на локус Rosa26, что описаны в данном документе (фиг. 25А-В и 26). Способы из публикаций заявок на патенты США №№20120017290 и 20110265198, закрепленных за Sangamo Biosciences, Inc., относящиеся к целенаправленному воздействию на локус Rosa, можно модифицировать для использования системы CRISPR-Cas по настоящему изобретению. В другом варианте осуществления способы из публикации заявки на патент США №20130236946, закрепленной за Cellectis, относящиеся к целенаправленному воздействию на локус Rosa, можно также модифицировать для использования системы CRISPR-Cas по настоящему изобретению.

Полезность мышей с условной экспрессией Cas9. Заявители показали на клетках 293, что конструкция для условной экспрессии Cas9 может активироваться при совместной экспрессии с Cre. Заявители также показали, что подвергшиеся точному целенаправленному воздействию mESC R1 могут иметь активный Cas9, когда Cre экспрессируется. Поскольку за Cas9 следует последовательность расщепления пептидом Р2А, а затем EGFP, заявители идентифицировали успешную экспрессию путем наблюдения EGFP. Заявители показали активацию Cas9 в mESC. Эта же идея делает использование мышей с условной экспрессией Cas9 столь полезным. Заявители могут скрещивать свою мышь с условной экспрессией Cas9 с мышью, у которой повсеместно экспрессируется Cre (линия АСТВ-Cre), и могут получать мышь, которая экспрессирует Cas9 в каждой клетке. Для этого потребуется только доставка химерной РНК для индукции редактирования генома у мышиных эмбрионов или взрослых мышей. Что интересно, если мышь с условной экспрессией Cas9 скрестить с мышью, экспрессирующей Cre под контролем тканеспецифического промотора, Cas9 будет лишь в тканях, в которых также экспрессируется Cre. Этот подход можно применять для редактирования генома только в определенных тканях путем доставки химерной РНК в ту же ткань.

Как упоминается выше, представлены также трансгенные животные. В этом отношении предпочтительными являются трансгенные животные, в особенности млекопитающие, такие как крупный рогатый скот (коровы, овцы, козы и свиньи), но также домашняя птица и съедобные насекомые.

Аденоассоциированный вирус (AAV)

Что касается доставки in vivo, то AAV является преимущественным по сравнению с другими вирусными векторами по двум причинам:

низкая токсичность (она может быть обусловлена способом очистки, не требующим ультрацентрифугирования клеточных частиц, которые могут активировать иммунный ответ);

низкая вероятность вызывания инсерционного мутагенеза, поскольку он не интегрируется в геном хозяина.

AAV имеет предел упаковки, составляющий 4,5 или 4,75 т.п.о. Это означает, что все из Cas9, а также промотора и терминатора транскрипции должны вмещаться в один вирусный вектор. Конструкции, размер которых превышает 4,5 или 4,75 т.п.о., будут обуславливать значительное снижение продуцирования вируса. SpCas9 является довольно большим, размер гена самого по себе превышает 4,1 т.п.о., что осложняет его упаковку в AAV. Следовательно, варианты осуществления настоящего изобретения включают использование более коротких гомологов Cas9. Например:

Эти виды, таким образом, в целом являются предпочтительными видами для получения Cas9. Заявители показали данные о доставке и экспрессии Cas9 в головном мозге мышей in vivo.

Предпочтительными являются два способа упаковки молекул нуклеиновых кислот, кодирующих Cas9, например, ДНК, в вирусные векторы для опосредования модификации генома in vivo.

Для обеспечения опосредованного NHEJ нокаута гена.

Один вирусный вектор:

вектор, содержащий две или более кассеты экспрессии:

промотор-молекула нуклеиновой кислоты, кодирующая Cas9-терминатор;

промотор-gRNA1-терминатор;

промотор-gRNA2-терминатор;

промотор-gRNA(N)-терминатор (до предельного размера вектора).

Два вирусных вектора:

вектор 1, содержащий одну кассету экспрессии для управления экспрессией Cas9;

промотор-молекула нуклеиновой кислоты, кодирующая Cas9-терминатор;

вектор 2, содержащий одну или несколько кассет экспрессии для управления экспрессией одной или нескольких направляющих РНК;

промотор-gRNA1-терминатор;

промотор-gRNA(N)-терминатор (до предельного размера вектора).

Для опосредования репарации с участием гомологичной рекомбинации. В дополнение к подходам с одним и двумя вирусными векторами, описанными выше, используют дополнительный вектор для доставки матрицы для репарации с участием гомологичной рекомбинации.

Промотор, используемый для управления экспрессией молекулой нуклеиновой кислоты, кодирующей Cas9, может включать следующее.

ITR AAV может служить в качестве промотора: это является преимущественным для устранения необходимости в дополнительном промоторном элементе (который может занимать пространство в векторе). Освободившееся дополнительное пространство можно задействовать для управления экспрессией дополнительных элементов (gRNA и т.д.). Также активность ITR является относительно более слабой, поэтому ее можно использовать для снижения токсичности, обусловленной сверхэкспрессией Cas9.

Для повсеместной экспрессии можно использовать следующие промоторы: CMV, CAG, CBh, PGK, SV40, генов тяжелой или легкой цепей ферритина и т.д.

Для экспрессии в головном мозге можно использовать следующие промоторы: гена синапсина I для всех нейронов, гена CaMKII-альфа для возбуждающих нейронов, GAD67, или GAD65, или VGAT для GABA-эргических нейронов и т.д.

Для экспрессии в печени можно использовать промотор гена альбумина.

Для экспрессии в легких можно использовать SP-B.

Для эндотелиальных клеток можно использовать ICAM.

Для гемопоэтических клеток можно использовать промотор гена IFN-бета или CD45.

Для остеобластов можно использовать OG-2.

Промотор, используемый для управления направляющей РНК, может включать следующее:

промоторы для Pol III, такие как U6 или H1;

использование промотора для Pol II и интронных кассет для экспрессии gRNA.

Что касается AAV, AAV может представлять собой AAV1, AAV2, AAV5 или любую их комбинацию. Можно выбрать AAV из AAV с учетом клеток, подлежащих целенаправленному воздействию, например, можно выбрать AAV серотипов 1, 2, 5, или гибридный капсид AAV1, AAV2, AAV5, или любую их комбинацию для целенаправленного воздействия в головном мозге или нервных клетках; и можно выбрать AAV4 для целенаправленного воздействия в сердечной ткани. AAV8 применим для доставки в печень. Вышеуказанные промоторы и векторы являются предпочтительными по отдельности.

Доставка РНК также является применимым способом доставки in vivo. На фигуре 27 показаны данные о доставке и экспрессии Cas9 в головном мозге мышей in vivo. Возможно доставлять Cas9 и gRNA (и, например, матрицу для HR-репарации) в клетки посредством липосом или наночастиц. Таким образом, доставка фермента CRISPR, такого как Cas9, и/или доставка РНК по настоящему изобретению может осуществляться в форме РНК и посредством микропузырьков, липосом или наночастиц. Например, мРНК Cas9 и gRNA могут быть упакованы в липосомные частицы для доставки in vivo. Реагенты для липосомной трансфекции, такие как Lipofectamine от Life Technologies, и другие реагенты, имеющиеся в продаже, могут эффективно доставлять молекулы РНК в печень.

Повышение эффективности NHEJ или HR также способствует доставке. Предпочтительно, чтобы эффективность NHEJ повышали посредством совместной экспрессии ферментов для обработки концов, таких как Trex2 (Dumitrache et al. Genetics. 2011 August; 188(4): 787-797). Предпочтительно, чтобы эффективность HR повышалась путем транзиентного ингибирования компонентов механизма NHEJ, таких как Ku70 и Ku86. Эффективность HR также можно повысить путем совместной экспрессии прокариотических или эукариотических ферментов гомологичной рекомбинации, таких как RecBCD, RecA.

Различные средства доставки описаны в данном документе и дополнительно обсуждаются в данном разделе.

Вирусная доставка: фермент CRISPR, например, Cas9, и/или любую из РНК по настоящему изобретению, например, направляющую РНК, можно доставлять с помощью аденоассоциированного вируса (AAV), лентивируса, аденовируса или других типов вирусных векторов или их комбинаций. Cas9 и одну или несколько направляющих РНК можно упаковать в один или несколько вирусных векторов. В некоторых вариантах осуществления вирусный вектор доставляют в представляющую интерес ткань посредством, например, внутримышечной инъекции, тогда как в других случаях вирусная доставка осуществляется посредством внутривенного, трансдермального, интраназального, перорального, трансмукозального или других способов доставки. Такая доставка может осуществляться в виде однократной дозы или многократных доз. Специалист в данной области понимает, что фактическая доза, подлежащая доставке в данном документе, может в значительной степени варьировать в зависимости от ряда факторов, таких как выбранный вектор, целевые клетка, организм или ткань, общее состояние субъекта, подлежащего лечению, степень желаемой трансформации/модификации, путь введения, способ введения, тип желаемой трансформации/модификации и т.п.

Такая доза может дополнительно содержать, например, носитель (воду, солевой раствор, этанол, глицерин, лактозу, сахарозу, фосфат кальция, желатин, декстран, агар, пектин, арахисовое масло, кунжутное масло и т.д.), разбавитель, фармацевтически приемлемый носитель (например, фосфатно-солевой буфер), фармацевтически приемлемый наполнитель и/или другие соединения, известные из уровня техники. Такой дозированный состав может без труда определить специалист в данной области. Доза может дополнительно содержать одну или несколько фармацевтически приемлемых солей, таких как, например, соль неорганической кислоты, такая как гидрохлорид, гидробромид, фосфат, сульфат и т.д.; и соли органических кислот, такие как ацетаты, пропионаты, малонаты, бензоаты и т.д. Дополнительно, в данном документе также могут присутствовать вспомогательные вещества, такие как смачиватели или эмульгаторы, буферные вещества, поддерживающие pH, гели или гелеобразующие материалы, ароматизаторы, красители, микросферы, полимеры, суспендирующие средства и т.д. В дополнение, также могут присутствовать один или несколько других традиционных фармацевтических ингредиентов, таких как консерванты, увлажнители, суспендирующие средства, поверхностно-активные вещества, антиоксиданты, средства против слеживания, заполнители, хелатообразователи, покрывающие средства, химические стабилизаторы и т.д., особенно если лекарственная форма представляет собой растворимую форму. Пригодные иллюстративные ингредиенты включают микрокристаллическую целлюлозу, натрий-карбоксиметилцеллюлозу, полисорбат 80, фенилэтиловый спирт, хлорбутанол, сорбат калия, сорбиновую кислоту, диоксид серы, пропилгаллат, парабены, этилванилин, глицерин, фенол, парахлорфенол, желатин, альбумин и их комбинацию. Подробное обсуждение фармацевтически приемлемых наполнителей доступно в REMINGTON'S PHARMACEUTICAL SCIENCES (Mack Pub. Co., N.J. 1991), включенном в данный документ посредством ссылки.

В варианте осуществления в данном документе доставку осуществляют посредством аденовируса, который может находиться в однократной бустерной дозе, содержащей по меньшей мере 1×105 частиц (также называемых единичными частицами, pu) аденовирусного вектора. В варианте осуществления в данном документе доза предпочтительно составляет по меньшей мере приблизительно 1×106 частиц (например, приблизительно 1×106-1×1012 частиц), более предпочтительно по меньшей мере приблизительно 1×107 частиц, более предпочтительно по меньшей мере приблизительно 1×108 частиц (например, приблизительно 1×108-1×1011 частиц или приблизительно 1×108-1×1011 частиц), и наиболее предпочтительно по меньшей мере приблизительно 1×109 частиц (например, приблизительно 1×109-1×1010 частиц или приблизительно 1×109-1×1012 частиц) или даже по меньшей мере приблизительно 1×1010 частиц (например, приблизительно 1×1010-1×1012 частиц) аденовирусного вектора. В альтернативном случае доза содержит не более приблизительно 1×1014 частиц, предпочтительно не более приблизительно 1×1013 частиц, еще более предпочтительно не более приблизительно 1×1012 частиц, еще более предпочтительно не более приблизительно 1×1011 частиц и наиболее предпочтительно не более приблизительно 1×1010 частиц (например, не более приблизительно 1×109 частиц). Таким образом, доза может включать в себя однократную дозу аденовирусного вектора с, например, приблизительно 1×106 единичных частиц (pu), приблизительно 2×106 pu, приблизительно 4×106 pu, приблизительно 1×107 pu, приблизительно 2×107 pu, приблизительно 4×107 pu, приблизительно 1×108 pu, приблизительно 2×108 pu, приблизительно 4×108 pu, приблизительно 1×109 pu, приблизительно 2×109 pu, приблизительно 4×109 pu, приблизительно 1×1010 pu, приблизительно 2×1010 pu, приблизительно 4×1010 pu, приблизительно 1×1011 pu, приблизительно 2×1011 pu, приблизительно 4×1011 pu, приблизительно 1×1012 pu, приблизительно 2×1012 pu или приблизительно 4×1012 pu аденовирусного вектора. См., например, аденовирусные векторы в патенте США №8454972 В2 Nabel et al., выданном 4 июня 2013 г.; включенном в данный документ посредством ссылки, и дозы в столбце 29, строках 36-58 данного патента. В варианте осуществления в данном документе аденовирус доставляют посредством многократных доз.

В варианте осуществления в данном документе доставку осуществляют посредством AAV. Полагают, что терапевтически эффективная доза для доставки AAV человеку in vivo находится в диапазоне от приблизительно 20 до приблизительно 50 мл физиологического раствора, содержащего от приблизительно 1×1010 до приблизительно 1×1010 функциональных частиц AAV/мл раствора. Дозу можно скорректировать для уравновешивания терапевтической пользы и любых побочных эффектов. В варианте осуществления в данном документе доза AAV, как правило, находится в диапазоне концентраций от приблизительно 1×105 до 1×1050 геномов AAV, от приблизительно 1×108 до 1×1020 геномов AAV, от приблизительно 1×1010 до приблизительно 1×1016 геномов или от приблизительно 1×1011 до приблизительно 1×1016 геномов AAV. Доза для человека может составлять приблизительно 1×1013 геномов AAV. Такие концентрации можно доставлять в от приблизительно 0,001 мл до приблизительно 100 мл, от приблизительно 0,05 до приблизительно 50 мл или от приблизительно 10 до приблизительно 25 мл раствора носителя. Другие эффективные дозы может без труда установить один из средних специалистов в данной области посредством стандартных испытаний с построением кривых зависимости "доза-эффект". См., например, патент США №8404658 В2 Hajjar et al., выданный 26 марта 2013 г., в столбце 27, строках 45-60.

В варианте осуществления в данном документе доставку осуществляют посредством плазмиды. В таких плазмидных композициях доза должна быть количеством плазмид, достаточным для того, чтобы вызвать эффект. Например, подходящее количество плазмидной ДНК в плазмидных композициях может составлять от приблизительно 0,1 до приблизительно 2 мг или от приблизительно 1 мкг до приблизительно 10 мкг.

Дозы в данном документе определяются в расчете на среднего индивидуума массой 70 кг. Частота введения находится в пределах компетенции практикующего врача или ветеринара (например, доктора, ветеринарного врача) или ученого, являющегося специалистом в данной области. Мыши, используемые в эксперименте, имели массу приблизительно 20 г. Дозы, вводимые мыши массой 20 г, можно экстраполировать на индивидуума массой 70 кг.

Лентивирус

Лентивирусы являются сложными ретровирусами, которые обладают способностью инфицировать как митотические, так и постмитотические клетки и экспрессировать в них свои гены. Наиболее широко известным лентивирусом является вирус иммунодефицита человека (HIV), который использует гликопротеины оболочки других вирусов для целенаправленного воздействия на широкий спектр типов клеток.

Лентивирусы можно получить следующим образом. После клонирования pCasES10 (которая содержит остов лентивирусной плазмиды-переносчика) HEK293FT, прошедшие малое количество пассажей (р=5), высевали в колбу Т-75 до 50% конфлюентности за день до трансфекции в DMEM с 10% фетальной бычьей сывороткой и без антибиотиков. Через 20 часов среду заменяли на среду OptiMEM (бессывороточную), и 4 часа спустя проводили трансфекцию. Клетки трансфицировали с помощью 10 мкг лентивирусной плазмиды-переносчика (pCasES10) и следующих пакующих плазмид: 5 мкг pMD2.G (псевдотип VSV-g) и 7,5 мкг psPAX2 (gag/pol/rev/tat). Трансфекцию проводили в 4 мл OptiMEM со средством доставки на основе катионного липида (50 мкл Lipofectamine 2000 и 100 мкл реагента Plus). Через 6 часов среду заменяли на DMEM, не содержащую антибиотиков, с 10% фетальной бычьей сывороткой.

Лентивирус можно очистить следующим образом. Вируссодержащие надосадочные жидкости отбирали через 48 часов. Надосадочные жидкости сперва очищали от дебриса и фильтровали через фильтр с диаметром пор 0,45 мкм с низкой степенью связывания белка (PVDF). Затем их центрифугировали на ультрацентрифуге в течение 2 часов при 24000 об/мин. Вируссодержащие осадки ресуспендировали в 50 мкл DMEM в течение ночи при 4°C. Затем их разделяли на аликвоты и сразу же замораживали при -80°C.

В другом варианте осуществления также предусмотрены минимальные лентивирусные векторы для отличных от приматов организмов на основе вируса инфекционной анемии лошадей (EIAV), особенно для генной терапии глаз (см., например, Balagaan, J Gene Med 2006; 8: 275-285, опубликовано в режиме онлайн 21 ноября 2005 г. в Wiley InterScience; доступно на веб-сайте: interscience.wiley.com. DOI: 10.1002/jgm.845). В другом варианте осуществления также предусмотрен RetinoStat®, лентивирусный вектор на основе вируса инфекционной анемии лошадей для генной терапии, экспрессирующий ангиостатические белки эндостатин и ангиостатин, который доставляют посредством субретинальной инъекции для лечения влажной формы возрастной макулодистрофии (см., например, Binley et al., HUMAN GENE THERAPY 23: 980-991 (September 2012)), который может быть модифицирован для системы CRISPR-Cas по настоящему изобретению.

В другом варианте осуществления самоинактивирующиеся лентивирусные векторы с siRNA, целенаправленно воздействующими на общий экзон, который имеют tat/rev HIV, сигналом ядрышковой локализации TAR-ловушкой и специфичным к CCR5 рибозимом в виде головки молотка (см., например, DiGiusto et al. (2010) Sci Transl Med 2:36ra43), можно использовать и/или приспосабливать к системам CRISPR-Cas по настоящему изобретению. Не менее 2,5×106 CD34+ клеток на килограмм массы пациента можно собирать и предварительно стимулировать в течение 16-20 часов в среде Х-VIVO 15 (Lonza), содержащей 2 микромоль/л L-глутамина, фактор стволовых клеток (100 нг/мл), лиганд Flt-3 (Flt-3L) (100 нг/мл) и тромбопоэтин (10 нг/мл) (CellGenix) при плотности 2×106 клеток/мл. Предварительно стимулированные клетки можно трансдуцировать лентивирусом при множественности заражения 5 в течение 16-24 часов во флаконах с культурой тканей на 75 см2, покрытых фибронектином (25 мг/см2) (RetroNectin, Takara Bio Inc.).

Лентивирусные векторы были раскрыты в отношении лечения болезни Паркинсона, см., например, публикацию заявки на патент США №20120295960 и патенты США №№7303910 и 7351585. Лентивирусные векторы также были раскрыты в отношении лечения заболеваний глаз, см., например, публикации заявок на патенты США №№20060281180, 20090007284, US 20110117189; US 20090017543; US 20070054961, US 20100317109. Лентивирусные векторы также были раскрыты в отношении доставки в головной мозг, см., например, публикации заявок на патенты США №№ US 20110293571; US 20110293571, US 20040013648, US 20070025970, US 20090111106, и патент США № US 7259015.

Доставка РНК

Доставка РНК: фермент CRISPR, например, Cas9, и/или любую из РНК по настоящему изобретению, например, направляющую РНК, также можно доставлять в форме РНК. мРНК Cas9 можно получить с помощью транскрипции in vitro. Например, мРНК Cas9 можно синтезировать с помощью кассеты для ПЦР, содержащей следующие элементы: промотор Т7-последовательность Козак (GCCACC)-Cas9-3'-UTR гена бета-глобина-поли(А)-хвост (цепь из 120 или более адениновых остатков). Кассету можно использовать для транскрипции под действием полимеразы Т7. Направляющие РНК также можно транскрибировать с помощью транскрипции in vitro с кассеты, содержащей промотор Т7-GG-последовательность направляющей РНК.

Для повышения экспрессии и снижения токсичности фермент CRISPR и/или направляющую РНК можно модифицировать с помощью псевдо-U или 5-метил-С.

Способы доставки мРНК в настоящее время являются особенно перспективными для доставки в печень. В частности, для AAV8 особенно предпочтительной является доставка в печень.

Системы доставки и/или составы на основе частиц

Известно, что несколько типов систем доставки и/или составов на основе частиц являются применимыми в разнообразном спектре биомедицинских применений. Частицу обычно определяют как небольшой объект, ведущий себя как целая единица в том, что касается ее транспорта и свойств. Частицы дополнительно классифицируют по диаметру. Крупные частицы охватывают диапазон от 2500 до 10000 нанометров. Тонкодисперсные частицы имеют размер от 100 до 2500 нанометров. Ультрадисперсные частицы, или наночастицы, как правило, имеют размер от 1 до 100 нанометров. Основанием для предела в 100 нм является тот факт, что новые свойства, отличающие частицы от насыпного материала, обычно проявляются в критическом линейном масштабе менее 100 нм.

Как используется в данном документе, систему доставки и/или состав на основе частиц определяют как любые биологические систему доставки/состав, содержащие частицы в соответствии с настоящим изобретением. Частица в соответствии с настоящим изобретением представляет собой любой объект, имеющий наибольшее измерение (например, диаметр) менее 100 микрон (μмкм). В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение менее 10 μмкм. В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение менее 2000 нанометров (нм). В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение менее 1000 нанометров (нм). В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение менее 900 нм, 800 нм, 700 нм, 600 нм, 500 нм, 400 нм, 300 нм, 200 нм или 100 нм. Частицы по настоящему изобретению обычно имеют наибольшее измерение (например, диаметр) 500 нм или менее. В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение (например, диаметр) 250 нм или менее. В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение (например, диаметр) 200 нм или менее. В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение (например, диаметр) 150 нм или менее. В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение (например, диаметр) 100 нм или менее. В некоторых вариантах осуществления настоящего изобретения применяют меньшие частицы, например, имеющие наибольшее измерение 50 нм или менее. В некоторых вариантах осуществления частицы по настоящему изобретению имеют наибольшее измерение, варьирующее в диапазоне от 25 нм до 200 нм.

Определение характеристик частиц (в том числе, например, определение характеристик морфологии, размеров и т.д.) осуществляют с применением ряда различных методик. Стандартными методиками являются электронная микроскопия (ТЕМ, SEM), атомно-силовая микроскопия (AFM), динамическое рассеяние света (DLS), рентгеновская фотоэлектронная спектроскопия (XPS), порошковая рентгеновская дифракция (XRD), инфракрасная спектроскопия с преобразованием Фурье (FTIR), времяпролетная масс-спектрометрия с лазерной десорбцией и ионизацией из матрицы (MALDI-TOF), спектроскопия в ультрафиолетовой и видимой области спектра, двойная поляризационная интерферометрия и ядерный магнитный резонанс (NMR). Определение характеристик (измерение размеров) можно проводить в отношении нативных частиц (т.е. до загрузки) или после загрузки молекулы-карго (в данном документе молекула-карго относится, например, к одному или нескольким компонентам системы CRISPR-Cas, например, ферменту или мРНК CRISPR, или направляющей РНК, или любой их комбинации, и может включать дополнительные компоненты, носители и/или наполнители) для получения частиц, имеющих оптимальный размер для доставки, для любого применения настоящего изобретения in vitro, ex vivo и/или in vivo. В определенных предпочтительных вариантах осуществления определение характеристик размеров частиц (например, диаметра) основано на измерениях с применением динамического рассеяния лазерного излучения (DLS). Упоминаются патент США №8709843; патент США,№6007845; патент США №5855913; патент США №5985309; патент США №5543158 и публикация James Е. Dahlman и Carmen Barnes и соавт.в Nature Nanotechnology (2014), опубликованная в режиме онлайн 11 мая 2014 г., doi:10.1038/nnano.2014.84, которая относится к частицам, способам их получения и применения и их измерениям.

Системы доставки на основе частиц в пределах объема настоящего изобретения могут быть представлены в любой форме, в том числе, без ограничения, в форме твердых, полутвердых, эмульгированных или коллоидных частиц. В силу этого любые системы доставки, описанные в данном документе, в том числе, без ограничения, например, липидные системы, липосомы, мицеллы, микропузырьки, экзосомы или генная пушка, могут быть представлены в качестве систем доставки на основе частиц в пределах объема настоящего изобретения.

Наночастицы

В контексте настоящего изобретения предпочтительно, чтобы один или несколько компонентов комплекса CRISPR, например, фермент или мРНК CRISPR или направляющая РНК, были доставлены с помощью наночастиц или липидных оболочек. мРНК, кодирующую фермент CRISPR, и направляющую РНК можно доставлять одновременно с помощью наночастиц или липидных оболочек. Вместе с аспектами наночастиц по настоящему изобретению можно применять другие системы доставки или векторы.

"Наночастица" обычно относится к любой частице, имеющей диаметр менее 1000 нм. В определенных предпочтительных вариантах осуществления наночастицы по настоящему изобретению имеют наибольшее измерение (например, диаметр) 500 нм или менее. В других предпочтительных вариантах осуществления наночастицы по настоящему изобретению имеют наибольшее измерение, варьирующее в диапазоне от 25 нм до 200 нм. В других предпочтительных вариантах осуществления наночастицы по настоящему изобретению имеют наибольшее измерение 100 нм или менее. В других предпочтительных вариантах осуществления наночастицы по настоящему изобретению имеют наибольшее измерение, варьирующее в диапазоне от 35 нм до 60 нм.

Наночастицы, охватываемые настоящим изобретением, могут быть представлены в различных формах, например, в виде твердых наночастиц (например, металла, такого как серебро, золото, железо, титан, неметалла, липидных твердых веществ, полимеров), суспензий наночастиц или их комбинаций. Могут быть получены наночастицы металла, диэлектрика и полупроводника, а также гибридные структуры (например, наночастицы типа ядро/оболочка). Наночастицы, изготовленные из полупроводникового материала, также могут являться меченными квантовыми точками, если они достаточно малы (как правило, менее 10 нм), чтобы происходило квантование уровней энергии электронов. Такие наноразмерные частицы применяются в биомедицинских применениях в качестве носителей лекарственных средств или визуализирующих средств и могут быть приспособлены для аналогичных целей в настоящем изобретении.

Были получены полутвердые и мягкие наночастицы, и они находятся в пределах объема настоящего изобретения. Наночастицей-прототипом полутвердой природы является липосома. Различные типы наночастиц-липосом в настоящее время применяют в клинической практике в качестве систем доставки противораковых лекарственных средств и вакцин. Наночастицы, одна полусфера которых является гидрофильной, а другая полусфера - гидрофобной, называются частицами Януса и являются особенно эффективными в стабилизации эмульсий. Они способны к самосборке на поверхностях раздела вода/масло и действовать в качестве твердых поверхностно-активных веществ. В патенте США №8709843, включенном в данный документ с помощью ссылки, представлена система доставки лекарственных средств для целенаправленной доставки частиц, содержащих терапевтическое средство, в ткани, клетки и внутриклеточные компартменты. Настоящее изобретение предусматривает нацеленные частицы, содержащие полимер, конъюгированный с поверхностно-активным веществом, гидрофильным полимером или липидом.

В патенте США №6007845, включенном в данный документ с помощью ссылки, представлены частицы, имеющие сердцевину из мультиблочного сополимера, образованного ковалентными связями соединения с несколькими функциональными группами с одним или несколькими гидрофобными полимерами и одним или несколькими гидрофильными полимерами, и содержащие биологически активный материал.

В патенте США №5855913, включенном в данный документ с помощью ссылки, представлена композиция в форме частиц, содержащая аэродинамически легкие частицы, имеющие плотность после утряски менее 0,4 г/см3 и средний диаметр от 5 μмкм до 30 μмкм, содержащие поверхностно-активное вещество на их поверхности, для доставки лекарственных средств в легочную систему.

В патенте США №5985309, включенном в данный документ с помощью ссылки, представлены частицы, содержащие поверхностно-активное вещество и/или гидрофильный или гидрофобный комплекс положительно или отрицательно заряженного терапевтического или диагностического средства и заряженной молекулы, имеющей противоположный заряд, для доставки в легочную систему.

В патенте США №5543158, включенном в данный документ с помощью ссылки, представлены биоразлагаемые инъекционные наночастицы, имеющие биоразлагаемую твердую сердцевину, содержащую биологически активный материал, и поли(алкиленгликолевые) фрагменты на поверхности.

В WO 2012135025 (также опубликованном как US 20120251560), включенном в данный документ с помощью ссылки, описаны конъюгированные полимеры на основе полиэтиленимина (PEI) и конъюгированные азамакроциклы (совместно именуемые "конъюгированным липополимером" или "липополимерами"). В определенных вариантах осуществления может быть предусмотрено, что такие конъюгированные липополимеры можно применять в случае с системой CRISPR-Cas для осуществления внесения изменений в геном in vitro, ex vivo и in vivo с модификацией экспрессии гена, включающей модулирование экспрессии белка.

В одном варианте осуществления наночастица может представлять собой гибрид липида, модифицированного эпоксидными группами, и полимера, преимущественно 7С1 (см., например, James Е. Dahlman and Carmen Barnes et al. Nature Nanotechnology (2014), опубликовано в режиме онлайн 11 мая 2014 г., doi:10.1038/nnano.2014.84). С71 синтезировали путем осуществления реакции липидов С15 с концевыми эпоксидными группами с PEI600 в молярном соотношении 14:1 и составляли с C14PEG2000 с получением наночастиц (диаметром от 35 до 60 нм), которые были стабильными в растворе PBS в течение по меньшей мере 40 дней.

Гибрид липида, модифицированного эпоксидными группами, и полимера можно использовать для доставки системы CRISPR-Cas по настоящему изобретению в клетки легких, сердечно-сосудистой системы или почек, однако, специалист в данной области может приспособить систему для доставки в другие целевые органы. Предусмотрена доза, варьирующая в диапазоне от приблизительно 0,05 до приблизительно 0,6 мг/кг. Также предусмотрен прием доз в течение нескольких дней или недель, при этом общая доза составляет приблизительно 2 мг/кг.

Например, у Su X, Fricke J, Kavanagh DG, Irvine DJ ("In vitro and in vivo mRNA delivery using lipid-enveloped pH-responsive polymer nanoparticles" Mol Pharm. 2011 Jun 6; 8(3): 774-87. doi: 10.1021/mp100390w. Epub 2011 Apr 1) раскрываются биоразлагаемые наночастицы со структурой ядро/оболочка с ядром из сложного поли-р-аминоэфира (РВАЕ), окруженным фосфолипидной двухслойной оболочкой. Они были разработаны для доставки мРНК in vivo. Чувствительный к pH компонент РВАЕ был выбран для содействия разрушению эндосом, тогда как поверхностный липидный слой был выбран для сведения к минимуму токсичности поликатионного ядра. Они, таким образом, являются предпочтительными для доставки РНК по настоящему изобретению.

В одном варианте осуществления предусмотрены наночастицы на основе самособирающихся биоадгезивных полимеров, которые можно использовать для пероральной доставки пептидов, внутривенной доставки пептидов и интраназальной доставки пептидов, во всех случаях в головной мозг. Также предусмотрены другие варианты осуществления, такие как абсорбция при пероральном применении и внутриглазная доставка гидрофобных лекарственных средств. Технология молекулярных оболочек предусматривает сконструированную полимерную оболочку, защищающую и доставляющую в очаг заболевания (см., например, Mazza, М. et al. ACSNano, 2013. 7(2): 1016-1026; Siew, A., et al. Mol Pharm, 2012. 9(1): 14-28; Lalatsa, A., et al. J Contr Rel, 2012. 161(2): 523-36; Lalatsa, A., et al., Mol Pharm, 2012. 9(6): 1665-80; Lalatsa, A., et al. Mol Pharm, 2012. 9(6): 1764-74; Garrett, N.L., et al. J Biophotonics, 2012. 5(5-6): 458-68; Garrett, N.L., et al. J Raman Spect, 2012. 43(5): 681-688; Ahmad, S., et al. J Royal Soc Interface 2010. 7: S423-33; Uchegbu, I.F. Expert Opin Drug Deliv, 2006. 3(5): 629-40; Qu, X., et al. Biomacromolecules, 2006. 7(12): 3452-9, и Uchegbu, I.F., et al. Int J Pharm, 2001. 224: 185-199). Предусмотрены дозы, составляющие приблизительно 5 мг/кг, которые в зависимости от целевой ткани будут однократными или многократными дозами.

В одном варианте осуществления наночастицы, которые могут доставлять РНК в раковые клетки для прекращения роста опухолей, разработанные в лаборатории Дэна Андерсона в MIT, можно использовать для систем CRISPR-Cas по настоящему изобретению и/или приспосабливать к ним. В частности, в лаборатории Андерсона были разработаны полностью автоматизированные, комбинаторные системы для синтеза, очистки, определения характеристик и составления новых биоматериалов и наносоставов. См., например, Alabi et al., Proc Natl Acad Sci USA. 2013 Aug 6; 110(32): 12881-6; Zhang et al., Adv Mater. 2013 Sep 6; 25(33): 4641-5; Jiang et al., Nano Lett. 2013 Mar 13; 13(3): 1059-64; Karagiannis et al., ACS Nano. 2012 Oct 23; 6(10): 8484-7; Whitehead et al., ACS Nano. 2012 Aug 28; 6(8): 6922-9, и Lee et al., Nat Nanotechnol. 2012 Jun 3; 7(6): 389-93.

Заявка на патент США 20110293703 относится к липидоподобным соединениям, также являющимся особенно применимыми при введении полинуклеотидов, которые можно использовать для доставки системы CRISPR-Cas по настоящему изобретению. В одном аспекте аминоспиртовые липидоподобные соединения объединяют со средством, подлежащим введению в клетку или субъекту, с образованием микрочастиц, наночастиц, липосом или мицелл. Средство, подлежащее доставке с помощью частиц, липосом или мицелл, может быть в форме газа, жидкости или твердого вещества, и средство может представлять собой полинуклеотид, белок, пептид или малую молекулу. Аминоспиртовые липидоподобные соединения можно объединять с другими аминоспиртовыми липидоподобными соединениями, полимерами (синтетическими или природными), поверхностно-активными веществами, холестерином, углеводами, белками, липидами и т.д. с образованием частиц. Эти частицы можно затем необязательно объединять с фармацевтическим наполнителем с образованием фармацевтической композиции.

В публикации заявки на патент США №0110293703 также представлены способы получения аминоспиртовых липидоподобных соединений. Одному или нескольким эквивалентам амина позволяют вступать в реакцию с одним или несколькими эквивалентами соединения с концевыми эпоксидными группами в подходящих условиях с образованием аминоспиртового липидоподобного соединения по настоящему изобретению. В определенных вариантах осуществления все аминогруппы амина полностью реагируют с соединением с концевыми эпоксидными группами с образованием третичных аминов. В других вариантах осуществления не все аминогруппы амина полностью реагируют с соединением с концевыми эпоксидными группами с образованием третичных аминов, в результате чего, таким образом, образуются первичные или вторичные аминогруппы аминоспиртового липидоподобного соединения. Эти первичные или вторичные аминогруппы оставляют в существующем состоянии или могут вводить в реакцию с другим электрофилом, таким как другое соединение с концевыми эпоксидными группами. Специалисту в данной области следует принять во внимание, что введение амина в реакцию с меньшим, чем избыточное, количеством соединения с концевыми эпоксидными группами приведет к получению множества различных аминоспиртовых липидоподобных соединений с различным количеством "хвостов". Определенные амины могут быть полностью функционализированными с помощью двух "хвостов" соединений, полученных из эпоксидов, тогда как другие молекулы могут быть не полностью функционализированными с помощью "хвостов" соединений, полученных из эпоксидов. Например, диамин или полиамин может содержать один, два, три или четыре "хвоста" соединений, полученных из эпоксидов, у различных аминофрагментов молекулы, в результате чего образуются первичные, вторичные и третичные аминогруппы. В определенных вариантах осуществления все аминогруппы являются не полностью функционализированными. В определенных вариантах осуществления используют два соединения с концевыми эпоксидными группами одного типа. В других вариантах осуществления используют два или более различных соединения с концевыми эпоксидными группами. Синтез аминоспиртовых липидоподобных соединений осуществляют с помощью или без растворителя, и синтез можно осуществлять при более высоких температурах, варьирующих в диапазоне от 30 до 100°C, предпочтительно при примерно 50-90°C. Получаемые аминоспиртовые липидоподобные соединения можно необязательно очищать. Например, смесь аминоспиртовых липидоподобных соединений можно очищать с получением аминоспиртового липидоподобного соединения с определенным количеством "хвостов" соединений, полученных из эпоксидов. Или же смесь можно очищать с получением определенного стерео- или региоизомера. Аминоспиртовые липидоподобные соединения можно также алкилировать с помощью алкилгалогенида (например, йодистого метила) или другого алкилирующего средства, и/или их можно ацилировать.

В публикации заявки на патент США №0110293703 также представлены библиотеки аминоспиртовых липидоподобных соединений, полученных согласно способам по настоящему изобретению. Эти аминоспиртовые липидоподобные соединения можно получать и/или подвергать скринингу с применением высокопроизводительных методик, предусматривающих использование дозаторов жидкостей, роботов, планшетов для микротитрования, компьютеров и т.д. В определенных вариантах осуществления аминоспиртовые липидоподобные соединения подвергают скринингу в отношении их способности к трансфекции полинуклеотидов или других средств (например, белков, пептидов, малых молекул) в клетку.

Публикация заявки на патент США №20130302401 относится к классу поли(бета-аминоспиртов) (РВАА), получаемых при помощи комбинаторных методик полимеризации. РВАА по настоящему изобретению можно применять в биотехнологии и биомедицинских применениях в качестве покрытий (таких как пленочные покрытия или многослойные пленки для медицинских инструментов или имплантатов), добавок, материалов, наполнителей, средств против биологического обрастания, средств для формирования микроструктуры и средств для инкапсулирования клеток. В случае применения в качестве поверхностных покрытий эти РВАА вызывают различные уровни воспаления как in vitro, так и in vivo в зависимости от их химических структур. Большое химическое разнообразие этого класса материалов позволяет идентифицировать полимерные покрытия, ингибирующие активацию макрофагов in vitro. Кроме того, эти покрытия уменьшают мобилизацию воспалительных клеток и уменьшают выраженность фиброза после подкожной имплантации микрочастиц карбоксилированного полистирола. Эти полимеры можно использовать для образования капсул на основе полиэлектролитных комплексов для инкапсулирования клеток. Настоящее изобретение также может иметь много других применений в биологии, таких как получение противомикробных покрытий, доставка ДНК или siRNA и тканевая инженерия с применением стволовых клеток. Идеи, изложенные в публикации заявки на патент США №20130302401, можно применять к системе CRISPR-Cas по настоящему изобретению.

В другом варианте осуществления предусмотрены липидные наночастицы (LNP). В частности, малые интерферирующие РНК, воздействующие на транстиретин, инкапсулированные в липидных наночастицах (см., например, Coelho et al., N Engl J Med 2013; 369: 819-29), можно применять в отношении системы CRISPR-Cas по настоящему изобретению. Предусмотрены дозы, составляющие от приблизительно 0,01 до приблизительно 1 мг на кг массы тела, вводимые внутривенно. Предусмотрены лекарственные препараты для снижения риска возникновения инфузионных реакций, такие как дексаметазон, ацетаминофен, дифенгидрамин или цетиризин и ранитидин. Также предусмотрены многократные дозы, состоящие из пяти доз по приблизительно 0,3 мг на килограмм, принимаемых каждые 4 недели.

Было показано, что LNP являются высокоэффективными в доставке siRNA в печень (см., например, Tabernero et al., Cancer Discovery, April 2013, Vol. 3, No. 4, pp. 363-470) и, таким образом, предусмотрены для доставки CRISPR-Cas в печень. Может быть предусмотрен режим дозирования с приемом приблизительно четырех доз по 6 мг/кг LNP (или РНК CRISPR-Cas) каждые две недели. Tabernero и соавт.продемонстрировали, что после первых 2 циклов дозирования LNP при 0,7 мг/кг наблюдалась регрессия опухоли, а к концу 6 циклов у пациента достигался частичный ответ с полной регрессией метастазов в лимфатических узлах и значительным уменьшением размеров опухолей в печени. У данного пациента, у которого сохранялась ремиссия и который завершил лечение после получения доз в течение 26 месяцев, полный ответ достигался после приема 40 доз. У двух пациентов с RCC и внепеченочными очагами заболевания, включающими почку, легкое и лимфатические узлы, в которых наблюдалось прогрессирование после предшествующей терапии ингибиторами сигнального пути VEGF, наблюдалось стабильное заболевание во всех очагах в течение примерно 8-12 месяцев, а пациент с PNET и метастазами в печени продолжал участие в расширенном исследовании в течение 18 месяцев (36 доз) при стабильном заболевании.

Однако следует принимать во внимание заряд LNP. Так, объединение катионных липидов с отрицательно заряженными липидами индуцирует образование структур, не являющихся двухслойными, которые содействуют внутриклеточной доставке. Поскольку заряженные LNP быстро выводятся из кровотока после внутривенной инъекции, были разработаны ионизируемые катионные липиды со значениями pKa ниже 7 (см., например, Rosin et al., Molecular Therapy, vol. 19, no. 12, pp. 1286-2200, Dec. 2011). Отрицательно заряженные полимеры, такие как олигонуклеотиды siRNA, можно загружать в LNP при низких значениях pH (например, pH 4), где ионизируемые липиды проявляют положительный заряд. Однако при физиологических значениях pH LNP проявляют низкий поверхностный заряд, совместимый с большими значениями времени пребывания в кровотоке. Основное внимание было сосредоточено на четырех молекулах ионизируемых катионных липидов, а именно 1,2-дилинолеоил-3-диметиламмонийпропане (DLinDAP), 1,2-дилинолеилокси-3-N,N-диметиламинопропане (DLinDMA), 1,2-дилинолеилоксикето-N,N-диметил-3-аминопропане (DLinKDMA) и 1,2-дилинолеил-4-(2-диметиламиноэтил)-[1,3]-диоксолане (DLinKC2-DMA). Было показано, что системы LNP с siRNA, содержащие эти липиды, проявляют существенно отличающиеся свойства сайленсинга генов в гепатоцитах in vivo, при этом их активность изменяется в ряду DLinKC2-DMA>DLinKDMA>DLinDMA>>DLinDAP, при использовании модели сайленсинга гена фактора VII (см., например, Rosin et al., Molecular Therapy, vol. 19, no. 12, pages 1286-2200, Dec. 2011). Могут быть предусмотрены уровни дозы 1 мкг/мл, особенно для состава, содержащего DLinKC2-DMA.

Получение LNP и инкапсулирование CRISPR-Cas можно применять и/или приспосабливать согласно Rosin et al., Molecular Therapy, vol. 19, no. 12, pp. 1286-2200, Dec. 2011. Катионные липиды 1,2-дилинолеоил-3-диметиламмонийпропан (DLinDAP), 1,2-дилинолеилокси-3-N,N-диметиламинопропан (DLinDMA), 1,2-дилинолеилоксикето-N,N-диметил-3-аминопропан (DLinK-DMA), 1,2-дилинолеил-4-(2-диметиламиноэтил)-[1,3]-диоксолан (DLinKC2-DMA), (3-о-[2''-(метоксиполиэтиленгликоль 2000)-сукциноил]-1,2-димиристоил-sn-гликоль (PEG-S-DMG) и R-3-[(ω-метоксиполи(этиленгликоль)2000)-карбамоил]-1,2-димиристилоксипропил-3-амин (PEG-C-DOMG) могут быть предоставлены Tekmira Pharmaceuticals (Ванкувер, Канада) или синтезированы. Холестерин можно приобрести у Sigma (Сент-Луис, Миссури). Конкретную РНК CRISPR-Cas можно инкапсулировать в LNP, содержащие DLinDAP, DLinDMA, DLinK-DMA и DLinKC2-DMA (катионный липид:DSPC:холестерин:PEG-S-DMG или PEG-C-DOMG в молярном соотношении 40:10:40:10). При необходимости можно включать в состав 0,2% SP-DiOC18 (Invitrogen, Берлингтон, Канада) для определения поглощения клетками, внутриклеточной доставки и биораспределения. Инкапсулирование можно осуществлять путем растворения липидных смесей, содержащих катионный липид:DSPC:холестерин:PEG-С-DOMG (молярное соотношение 40:10:40:10) в этаноле до конечной концентрации липидов 10 ммоль/л. Этот раствор липидов в этаноле можно добавлять по каплям к 50 ммоль/л цитрата, pH 4,0, с образованием многослойных пузырьков до получения конечной концентрации этанола 30% об./об. Крупные однослойные пузырьки можно формировать после экструзии многослойных пузырьков через два установленных один над другим поликарбонатных фильтра Nuclepore на 80 нм при помощи экструдера (Northern Lipids, Ванкувер, Канада). Инкапсулирование можно осуществлять путем добавления РНК, растворенной при 2 мг/мл в 50 ммоль/л цитрата, pH 4,0, содержащего 30% этанол об./об., по каплям к экструдированным предварительно сформированным крупным однослойным пузырькам и инкубирования при 31°C в течение 30 минут при постоянном перемешивании до конечного весового соотношения РНК/липид 0,06/1 вес/вес. Удаление этанола и нейтрализацию буфера для получения состава проводили путем диализа против фосфатно-солевого буфера (PBS), pH 7,4, в течение 16 часов при помощи диализных мембран Spectra/Por 2 из регенерированной целлюлозы. Распределение наночастиц по размеру можно определить посредством динамического рассеяния света с использованием измерителя размера частиц NICOMP 370, режимов объема пузырьков/интенсивности рассеянного света и аппроксимации функцией Гаусса (Nicomp Particle Sizing, Санта-Барбара, Калифорния). Размер частиц для всех трех систем LNP может составлять ~70 нм в диаметре. Эффективность инкапсулирования siRNA можно определить путем удаления свободной siRNA из образцов, отобранных до или после диализа, с помощью колонок VivaPureD MiniH (Sartorius Stedim Biotech). Инкапсулированную РНК можно экстрагировать из элюированных наночастиц и подвергать количественной оценке при 260 нм. Соотношение siRNA и липидов определяли путем измерения содержания холестерина в пузырьках с помощью ферментативного анализа Cholesterol Е от Wako Chemicals USA (Ричмонд, Виргиния). Для доставки также можно применять пегилированные липосомы (или LNP).

Получение крупных LNP можно применять и/или приспосабливать согласно Rosin et al., Molecular Therapy, vol. 19, no. 12, pp. 1286-2200, Dec. 2011. Раствор предварительно приготовленной смеси липидов (общая концентрация липидов 20,4 мг/мл) можно получать в этаноле, содержащем DLinKC2-DMA, DSPC и холестерин в молярном соотношении 50:10:38,5. К предварительно приготовленной смеси липидов можно добавлять ацетат натрия в молярном соотношении 0,75:1 (ацетат натрия:DLinKC2-DMA). Липиды затем можно гидрировать путем объединения смеси с 1,85 объема цитратного буфера (10 ммоль/л, pH 3,0) при энергичном перемешивании, вызывая самопроизвольное образование липосом в водном буфере, содержащем 35% этанол. Раствор липосом можно инкубировать при 37°C для обеспечения зависимого от времени увеличения размера частиц. Можно отбирать аликвоты в различные моменты времени в ходе инкубирования для изучения изменений размера липосом посредством динамического рассеяния света (Zetasizer Nano ZS, Malvern Instruments, Вустершир, Великобритания). По достижении желаемого размера частиц к смеси липосом можно добавлять водный раствор конъюгатов PEG-липид (исходный раствор = 10 мг/мл PEG-DMG в 35% (об./об.) этаноле) с получением конечной молярной концентрации PEG 3,5% от общего количества липидов. После добавления конъюгатов PEG-липид липосомы должны сохранять свой размер с эффективным подавлением дальнейшего роста. К "пустым" липосомам можно затем добавить РНК при соотношении siRNA и общих липидов, составляющем примерно 1:10 (вес:вес), с последующим инкубированием в течение 30 минут при 37°C с образованием нагруженных LNP. Смесь можно затем подвергнуть диализу в течение ночи в PBS и отфильтровать через шприцевой фильтр с диаметром пор 0,45 мкм.

Конструкции сферических нуклеиновых кислот (SNA™) и другие наночастицы (в частности, наночастицы золота) также предусмотрены в качестве средств доставки системы CRISPR/Cas к предполагаемым мишеням. Существенные данные показывают, что конструкции сферических нуклеиновых кислот (SNA™) AuraSense Therapeutics на основе наночастиц золота, функционализированных нуклеиновыми кислотами, превосходят альтернативные платформы на основании нескольких следующих ключевых факторов успеха.

Высокая стабильность in vivo. По причине их плотной загрузки большинство молекул-карго (ДНК или siRNA) остаются связанными с конструкциями внутри клеток, что придает нуклеиновым кислотам стабильность и устойчивость к ферментативному расщеплению.

Возможность доставки. Для всех изучаемых типов клеток (например, нейронов, линий опухолевых клеток и т.д.) конструкции демонстрируют 99% эффективность трансфекции без необходимости в носителях или средствах для трансфекции.

Терапевтическое целенаправленное воздействие. Уникальная аффинность связывания с мишенью и специфичность конструкций обеспечивают превосходную специфичность в отношении совпадающих целевых последовательностей (т.е. с ограниченными нецелевыми эффектами).

Превосходящая эффективность. Конструкции значительно превосходят ведущие традиционные реагенты для трансфекции (Lipofectamine 2000 и Cytofectin).

Низкая токсичность. Конструкции могут поступать в ряд культивируемых клеток, первичных клеток и тканей без видимой токсичности.

Отсутствие значительного иммунного ответа. Конструкции вызывают минимальные изменения глобальной экспрессии генов согласно измерениям в полногеномных микроматричных исследованиях и специфичных в отношении цитокинов анализах белков.

Способность получения заданных химических свойств. Для получения заданных свойств поверхности конструкций можно использовать любое количество отдельных или комбинированных средств (например, белков, пептидов, малых молекул).

Данная платформа для терапевтических средств на основе нуклеиновых кислот может быть применима к многочисленным болезненным состояниям, включающим воспаление и инфекционное заболевание, рак, кожные нарушения и сердечно-сосудистое заболевание.

Литературные источники, на которые можно ссылаться, включают: Cutler et al.,. J. Am. Chem. Soc. 2011 133: 9254-9257, Hao et al., Small. 2011 7: 3158-3162, Zhang et al., ACS Nano. 2011 5: 6962-6970, Cutler et al., J. Am. Chem. Soc. 2012 134: 1376-1391, Young et al.,. Nano Lett. 2012 12: 3867-71, Zheng et al., Proc. Natl. Acad. Sci. USA. 2012 109: 11975-80, Mirkin, Nanomedicine 2012 7: 635-638, Zhang et al., J. Am. Chem. Soc. 2012 134: 16488-1691, Weintraub, Nature 2013 495: S14-S16, Choi et al., Proc. Natl. Acad. Sci. USA. 2013 110(19): 7625-7630, Jensen et al., Sci. Transl. Med. 5, 209ra152 (2013) и Mirkin, et al., Small, doi.org/10.1002/smll.201302143.

Самособирающиеся наночастицы с siRNA могут быть сконструированы с помощью полиэтиленимина (PEI), пегилированного пептидным лигандом Arg-Gly-Asp (RGD), присоединенным к дистальному концу полиэтиленгликоля (PEG), например, в качестве средства для нацеливания на новообразованные сосуды опухоли, в которых экспрессируются интегрины, и использоваться для доставки siRNA, ингибирующих экспрессию рецептора фактора роста эндотелия сосудов-2 (VEGF R2) и, таким образом, ангиогенез опухоли (см., например, Schiffelers et al., Nucleic Acids Research, 2004, Vol. 32, No. 19). Наноплексы можно получать путем смешивания равных объемов водных растворов катионного полимера и нуклеиновой кислоты с получением чистого молярного избытка ионизируемого азота (полимера) относительно фосфата (нуклеиновой кислоты) в диапазоне от 2 до 6. Электростатические взаимодействия между катионными полимерами и нуклеиновой кислотой приводили к образованию полиплексов, характеризующихся распределением частиц по размеру со средним размером, составляющим приблизительно 100 нм, называемых здесь, таким образом, наноплексами. Для доставки в самособирающихся наночастицах согласно Schiffelers и соавт.предполагается доза, составляющая приблизительно от 100 до 200 мг CRISPR-Cas.

Наноплексы по Bartlett et al. (PNAS, September 25, 2007, vol. 104, no. 39) также можно применять в настоящем изобретении. Наноплексы по Bartlett и соавт.получают путем смешивания равных объемов водных растворов катионного полимера и нуклеиновой кислоты с получением чистого молярного избытка ионизируемого азота (полимера) относительно фосфата (нуклеиновой кислоты) в диапазоне от 2 до 6. Электростатические взаимодействия между катионными полимерами и нуклеиновой кислотой приводили к образованию полиплексов, характеризующихся распределением частиц по размеру со средним размером, составляющим приблизительно 100 нм, называемых здесь, таким образом, наноплексами. Конъюгаты DOTA-siRNA по Bartlett et al. синтезировали следующим образом. Сложный моно(N-гидроксисукцинимидный эфир) 1,4,7,10-тетраазациклододекан-1,4,7,10-тетрауксусной кислоты (сложный эфир DOTA-NHS) заказывали у Macrocyclics (Даллас, Техас). В микроцентрифужную пробирку добавляли аминомодифицированную смысловую нить РНК со 100-кратным молярным избытком сложного эфира DOTA-NHS в карбонатном буфере (pH 9). Содержимое вводили в реакцию путем перемешивания в течение 4 ч. при комнатной температуре. Конъюгат DOTA-смысловая нить РНК осаждали этанолом, ресуспендировали в воде и отжигали с немодифицированной антисмысловой нитью с получением конъюгата DOTA-siRNA. Все жидкости предварительно обрабатывали с помощью Chelex-100 (Bio-Rad, Геркулес, Калифорния) для удаления следовых количеств металлических примесей. Нацеленные на Tf или ненацеленные наночастицы с siRNA можно получать с помощью поликатионов, содержащих циклодекстрин. Как правило, наночастицы получают в воде при соотношении зарядов 3 (+/-) и концентрации siRNA 0,5 г/литр. Один процент молекул конъюгатов адамантан-PEG на поверхности нацеленных наночастиц модифицировали с помощью Tf (адамантан-PEG-Tf). Наночастицы суспендировали в 5% (вес/об.) глюкозе в качестве раствора-носителя для инъекции.

Davis и соавт. (Nature, Vol 464, 15 April 2010) проводят клиническое испытание с siRNA, в котором используют систему доставки на основе нацеленных наночастиц (регистрационный номер клинического испытания NCT00689065). Пациентам с солидными формами рака, трудно поддающимися стандартным методикам лечения, вводили дозы нацеленных наночастиц в дни 1, 3, 8 и 10 21-дневного цикла посредством 30-минутной внутривенной инфузии. Наночастицы состоят из синтетической системы доставки, содержащей: (1) линейный полимер на основе циклодекстрина (CDP), (2) лиганд, нацеливающийся на белок трансферрин человека (TF), представленный на внешней поверхности наночастиц, который входит в контакт с рецепторами TF (TFR) на поверхности раковых клеток, (3) гидрофильный полимер (полиэтиленгликоль (PEG), используемый для обеспечения стабильности наночастиц в биологических жидкостях), и (4) siRNA, предназначенную для снижения экспрессии RRM2 (последовательность, применяемая в клинической практике, ранее была обозначена как siR2B+5). Давно известно, что в злокачественных клетках повышена экспрессия TFR, a RRM2 является общепризнанной мишенью для противораковой терапии. Было показано, что эти наночастицы (клинический вариант обозначен как CALAA-01) хорошо переносятся в исследованиях с использованием многократных доз у отличных от человека приматов. Даже при том, что отдельным пациентам с хроническим миелоидным лейкозом вводили siRNA посредством доставки с помощью липосом, клиническое испытание по Davis и соавт.является первым испытанием с участием человека, в котором проводят системную доставку siRNA с помощью системы целенаправленной доставки и лечат пациентов с солидным раком. Для того, чтобы выяснить, может ли система целенаправленной доставки обеспечивать эффективную доставку функциональных siRNA в опухоли человека, Davis и соавт. исследовали биоптаты от трех пациентов из трех различных групп дозирования; пациентов А, В и С, все из которых имели метастазирующую меланому и получали дозы CALAA-01 с 18, 24 и 30 мг*м-2 siRNA, соответственно. Аналогичные дозы также могут быть предусмотрены для системы CRISPR-Cas по настоящему изобретению. Доставку по настоящему изобретению можно осуществлять с помощью наночастиц, содержащих линейный полимер на основе циклодекстрина (CDP), лиганд, нацеливающийся на белок трансферрин человека (TF), представленный на внешней поверхности наночастиц, который входит в контакт с рецепторами TF (TFR) на поверхности раковых клеток, и/или гидрофильный полимер (например, полиэтиленгликоль (PEG), применяемый для обеспечения стабильности наночастиц в биологических жидкостях).

Экзосомы

Экзосомы являются эндогенными нанопузырьками, переносящими РНК и белки, которые могут доставлять короткие интерферирующие РНК (siRNA) в головной мозг мышей. Для снижения иммуногенности Alvarez-Erviti и соавт. (2011, Nat Biotechnol 29: 341) использовали аутогенные дендритные клетки для получения экзосом. Нацеливания достигали путем конструирования дендритных клеток, экспрессирующих Lamp2b, мембранный белок экзосом, слитый с нейрон-специфическим пептидом RVG. Очищенные экзосомы нагружали экзогенной siRNA путем электропорации. Меченные RVG нацеленные экзосомы, инъецируемые внутривенно, осуществляли специфическую доставку siRNA для GAPDH в нейроны, микроглию, олигодендроциты в головном мозге, обуславливая нокдаун конкретного гена. Предварительное воздействие меченных RVG экзосом не ослабляло выраженность нокдауна, и неспецифическое поглощение в других тканях не наблюдалось. Терапевтические возможности опосредованной экзосомами доставки siRNA были продемонстрированы сильно выраженным нокдауном мРНК (60%) и белка (62%) ВАСЕ1, терапевтической мишени при болезни Альцгеймера.

Для получения пула иммунологически инертных экзосом Alvarez-Erviti и соавт. отбирали костный мозг у инбредных мышей C57BL/6 с гомогенным гаплотипом главного комплекса гистосовместимости (МНС). Поскольку незрелые дендритные клетки вырабатывают большие количества экзосом, лишенных активаторов Т-клеток, таких как МНС-II и CD86, Alvarez-Erviti и соавт. производили отбор дендритных клеток с гранулоцитарно-макрофагальным колониестимулирующим фактором (GM-CSF) в течение 7 дней. Экзосомы очищали от культуральной надосадочной жидкости на следующий день с применением общепринятых протоколов ультрацентрифугирования. Вырабатываемые экзосомы были физически однородными и характеризовались распределением по размеру с пиком при 80 нм в диаметре, как определяли с помощью анализа отслеживания наночастиц (NTA) и электронной микроскопии. Alvarez-Erviti и соавт. получали 6-12 мкг экзосом (измерено по концентрации белка) на 106 клеток.

Затем Alvarez-Erviti и соавт.исследовали возможность загрузки модифицированных экзосом экзогенными молекулами-карго с применением протоколов электропорации, приспособленных для применений на наноразмерном уровне. Поскольку электропорация для мембранных частиц в нанометрическом масштабе изучена недостаточно хорошо, для эмпирической оптимизации протокола электропорации использовали неспецифичную меченную Су5 siRNA. Количество инкапсулированной siRNA анализировали после ультрацентрифугирования и лизиса экзосом. Электропорация при 400 В и 125 мкФ приводила к наибольшему удержанию siRNA и применялась для всех последующих экспериментов.

Alvarez-Erviti и соавт.вводили по 150 мкг каждой siRNA для ВАСЕ1, инкапсулированной в 150 мкг меченных RVG экзосом, нормальным мышам C57BL/6 и сравнивали эффективность нокдауна с таковой в четырех контрольных группах: необработанные мыши, мыши, которым инъецировали только меченные RVG экзосомы, мыши, которым инъецировали siRNA для ВАСЕ1, образующие комплекс с реагентом на основе катионных липосом для доставки in vivo, и мыши, которым инъецировали siRNA для ВАСЕ1, образующие комплекс с RVG-9R, пептидом RVG, конъюгированным с 9 остатками D-аргинина, который электростатически связывается с siRNA. Образцы кортикальной ткани анализировали через 3 дня после введения, и как у обработанных siRNA-RVG-9R, так и у обработанных меченными RVG экзосомами с siRNA мышей наблюдали значительный нокдаун белка (45%, Р<0,05 и 62%, Р<0,01), обусловленный значительным снижением уровней мРНК ВАСЕ1 (66% [+или -] 15%, Р<0,001 и 61% [+или -] 13%, Р<0,01, соответственно). Кроме того, заявители продемонстрировали значительное снижение (55%, Р<0,05) общих уровней [бета]-амилоидного пептида 1-42, основного компонента амилоидных бляшек в патологическом процессе при болезни Альцгеймера у животных, обработанных меченными RVG экзосомами. Наблюдавшееся снижение было большим, чем снижение уровней β-амилоидного пептида 1-40, демонстрируемое у нормальных мышей после внутрижелудочковой инъекции ингибиторов ВАСЕ1. Alvarez-Erviti и соавт. проводили быструю амплификацию 5'-концов кДНК (RACE) в отношении продукта расщепления ВАСЕ1, что свидетельствовало об опосредованном RNAi нокдауне с помощью siRNA.

Наконец, Alvarez-Erviti и соавт. исследовали, индуцируют ли меченные RVG экзосомы с siRNA иммунные ответы in vivo, путем определения концентраций IL-6, IP-10, TNFα и IFN-α в сыворотке. После обработки с помощью меченных RVG экзосом с siRNA для всех цитокинов регистрировали незначительные изменения подобно обработке реагентом для трансфекции с siRNA и в отличие от siRNA-RVG-9R, который активно стимулировал секрецию IL-6, что подтверждало иммунологическую инертность как особенность обработки экзосомами. С учетом того, что экзосомы инкапсулируют только 20% siRNA, доставка с помощью меченных RVG экзосом, по-видимому, является более эффективной, чем доставка с помощью RVG-9R, поскольку с использованием в пять раз меньшего количества siRNA без соответствующего уровня стимуляции иммунного ответа достигали сопоставимого нокдауна мРНК и большего нокдауна белка. Данный эксперимент продемонстрировал терапевтические возможности технологии меченных RVG экзосом, которая потенциально подходит для долговременного сайленсинга генов, связанных с нейродегенеративными заболеваниями. Систему доставки на основе экзосом по Alvarez-Erviti и соавт.можно использовать для доставки системы CRISPR-Cas по настоящему изобретению к терапевтическим мишеням, особенно при нейродегенеративных заболеваниях. В настоящем изобретении может быть предусмотрена доза, составляющая приблизительно 100-1000 мг CRISPR-Cas, инкапсулированных в приблизительно 100-1000 мг меченных RVG экзосом.

El-Andaloussi и соавт.(Nature Protocols 7, 2112-2126(2012)) раскрывают, как экзосомы, полученные из культивируемых клеток, можно приспособить для доставки siRNA in vitro и in vivo. В данном протоколе впервые описано создание нацеленных экзосом посредством трансфекции вектором экспрессии, содержащим экзосомный белок, слитый с пептидным лигандом. Затем El-Andaloussi и соавт. объясняют, как очищать и характеризовать экзосомы из надосадочной жидкости культуры трансфицированных клеток. Затем El-Andaloussi и соавт. подробно описывают важнейшие стадии загрузки siRNA в экзосомы. Наконец, El-Andaloussi и соавт. излагают в общих чертах, как использовать экзосомы для эффективной доставки siRNA in vitro и in vivo в головной мозг мышей. Также приведены примеры предполагаемых результатов, в которых опосредованная экзосомами доставка siRNA оценивается посредством функциональных анализов и визуализации. Выполнение полного протокола занимает ~3 недели. Доставку или введение согласно настоящему изобретению можно осуществлять с помощью экзосом, полученных из аутогенных дендритных клеток.

В другом варианте осуществления предусмотрены плазменные экзосомы по Wahlgren и соавт. (Nucleic Acids Research, 2012, Vol. 40, No. 17 e130). Экзосомы представляют собой наноразмерные пузырьки (размером 30-90 нм), вырабатываемые многими типами клеток, в том числе дендритными клетками (DC), В-клетками, Т-клетками, тучными клетками, эпителиальными клетками и опухолевыми клетками. Данные пузырьки образуются путем внутреннего почкования поздних эндосом, а затем высвобождаются во внеклеточную среду при слиянии с плазматической мембраной. Поскольку экзосомы в естественных условиях переносят РНК между клетками, это свойство может быть полезным в генной терапии.

Экзосомы из плазмы получают путем центрифугирования лейкоцитарной пленки при 900 g в течение 20 мин для выделения плазмы с последующим сбором надосадочной жидкости культуры клеток, центрифугированием при 300 g в течение 10 мин для удаления клеток и при 16500 g в течение 30 мин с последующей фильтрацией через фильтр с диаметром пор 0,22 мм. Экзосомы осаждают путем ультрацентрифугирования при 120000 g в течение 70 мин. Введение siRNA в экзосомы посредством химической трансфекции проводят согласно инструкциям производителя в наборе RNAi Human/Mouse Starter Kit (Quiagen, Хильден, Германия). siRNA добавляют к 100 мл PBS в конечной концентрации 2 ммоль/мл. После добавления реагента для трансфекции HiPerFect смесь инкубируют в течение 10 мин при RT. С целью удаления избытка мицелл экзосомы повторно выделяют при помощи латексных частиц с альдегидными/сульфатными группами. Введение CRISPR-Cas в экзосомы посредством химической трансфекции можно проводить аналогично введению siRNA. Экзосомы можно совместно культивировать с моноцитами и лимфоцитами, выделенными из периферической крови здоровых доноров. Таким образом, может быть предусмотрено, чтобы экзосомы, содержащие CRISPR-Cas, можно было вводить в моноциты и лимфоциты и подвергать аутологическому обратному введению в организм человека. Соответственно, доставку или введение согласно настоящему изобретению можно осуществлять с помощью плазменных экзосом.

Липосомы

Доставку или введение согласно настоящему изобретению можно осуществлять с помощью липосом. Липосомы являются сферическими везикулярными структурами, содержащими одно- или многослойный липидный бислой, окружающий внутренние водные компартменты, и относительно непроницаемый внешний липофильный фосфолипидный бислой. Липосомы получили значительное внимание в качестве носителей для доставки лекарственных средств, поскольку они являются биологически совместимыми, нетоксичными, могут доставлять как гидрофильные, так и липофильные молекулы лекарственных средств, защищают свою молекулу-карго от расщепления плазматическими ферментами и переносят свой "груз" через биологические мембраны и гематоэнцефалический барьер (ВВВ) (для обзора см., например, Spuch and Navarro, Journal of Drug Delivery, vol. 2011, Article ID 469679, 12 pp., 2011. doi: 10.1155/2011/469679).

Липосомы можно получать из нескольких различных типов липидов; однако, для создания липосом в качестве носителей лекарственных средств чаще всего применяют фосфолипиды. Хотя образование липосом является самопроизвольным при смешивании липидной пленки с водным раствором, его также можно ускорить путем приложения силы в виде встряхивания посредством применения гомогенизатора, ультразвукового диспергатора или экструзионного аппарата (для обзора см., например, Spuch and Navarro, Journal of Drug Delivery, vol. 2011, Article ID 469679, 12 pp., 2011. doi: 10.1155/2011/469679).

К липосомам можно добавлять некоторые другие добавки с целью модификации их структуры и свойств. Например, холестерин либо сфингомиелин можно добавлять к смеси липосом в целях содействия стабилизации структуры липосом и предотвращения утечки внутренних молекул-карго липосом. Дополнительно, липосомы получают из гидрогенизированного яичного фосфатидилхолина или яичного фосфатидилхолина, холестерина и дицетилфосфата, и их средние размеры пузырьков доводили до приблизительно 50 и 100 нм (для обзора см., например, Spuch and Navarro, Journal of Drug Delivery, vol. 2011, Article ID 469679, 12 pp., 2011. doi: 10.1155/2011/469679).

Традиционный липосомный состав содержит главным образом природные фосфолипиды и липиды, такие как 1,2-дистеароил-sn-глицеро-3-фосфатидилхолин (DSPC), сфингомиелин, формы яичного фосфатидилхолина и моносиалоганглиозид. Поскольку данный состав состоит только из фосфолипидов, липосомные составы сталкиваются со многими проблемами, одной из которых является нестабильность в плазме. Было предпринято несколько попыток преодоления данных проблем, в частности, посредством манипуляции с липидной мембраной. Одна из этих попыток направлена на манипуляцию с холестерином. Добавление холестерина к традиционным составам уменьшает быстрое высвобождение инкапсулированного биологически активного соединения в плазму, а 1,2-диолеоил-sn-глицеро-3-фосфоэтаноламин (DOPE) повышает стабильность (для обзора см., например, Spuch and Navarro, Journal of Drug Delivery, vol. 2011, Article ID 469679, 12 pp., 2011. doi: 10.1155/2011/469679).

В особенно преимущественном варианте осуществления желательными являются липосомы "троянские кони" (также известные как "молекулярные троянские кони"), и протоколы можно найти на http://cshprotocols.cshlp.Org/content/2010/4/pdb.prot5407.long. Эти частицы обеспечивают доставку трансгена в головной мозг в целом после внутрисосудистой инъекции. Без ограничений полагают, что нейтральные липидные частицы со специфичными антителами, конъюгированными с поверхностью, обеспечивают проникновение через гематоэнцефалический барьер посредством эндоцитоза. Заявитель теоретически допускает использование липосом "троянских коней" для доставки нуклеаз семейства CRISPR в головной мозг посредством внутрисосудистой инъекции, что будет обеспечивать получение животных с трансгенами во всем головном мозге без необходимости в манипуляции с эмбрионами. Может быть предусмотрено приблизительно 1-5 г молекулы нуклеиновой кислоты, например, ДНК, РНК, для введения в липосомы in vivo.

В другом варианте осуществления систему CRISPR-Cas можно вводить в липосомы, такие как стабильная частица из нуклеиновой кислоты и липидов (SNALP) (см., например, Morrissey et al., Nature Biotechnology, Vol. 23, No. 8, August 2005). Предусматриваются ежедневные внутривенные инъекции приблизительно 1, 3 или 5 мг/кг/день специфичной целенаправленно воздействующей CRISPR-Cas в SNALP. Ежедневное лечение можно осуществлять в течение приблизительно трех дней и затем еженедельно в течение приблизительно пяти недель. В другом варианте осуществления также предусмотрена специфичная CRISPR-Cas, инкапсулированная в SNALP, вводимая посредством внутривенной инъекции в дозах, составляющих приблизительно 1 или 2,5 мг/кг (см., например, Zimmerman et al., Nature Letters, Vol. 441, 4 May 2006). Состав на основе SNALP может содержать липиды 3-N[ω-метоксиполи(этиленгликоль)2000)-карбамоил]-1,2-димиристилоксипропиламин (PEG-C-DMA), 1,2-дилинолеилокси-N,N-диметил-3-аминопропан (DLinDMA), 1,2-дистеароил-sn-глицеро-3-фосфохолин (DSPC) и холестерин в молярном процентном соотношении 2:40:10:48 (см., например, Zimmerman et al., Nature Letters, Vol. 441, 4 May 2006).

В другом варианте осуществления было подтверждено, что стабильные частицы из нуклеиновой кислоты и липидов (SNALP) являются эффективными молекулами для доставки в высоковаскуляризированные опухоли печени, происходящие из HepG2, но не в слабо васкуляризированные опухоли печени, происходящие из НСТ-116 (см., например, Li, Gene Therapy (2012) 19, 775-780). SNALP-липосомы можно получать путем составления D-Lin-DMA и PEG-C-DMA с дистеароилфосфатидилхолином (DSPC), холестерином и siRNA с использованием соотношения липид/siRNA 25:1 и молярного соотношения холестерин/D-Lin-DMA/DSPC/PEG-C-DMA 48/40/10/2. Полученные в результате SNALP-липосомы имеют размер приблизительно 80-100 нм.

В еще одном варианте осуществления SNALP может содержать синтетический холестерин (Sigma-Aldrich, Сент-Луис, Миссури, США), дипальмитоилфосфатидилхолин (Avanti Polar Lipids, Алабастер, Алабама, США), 3-N-[(ω-метоксиполи(этиленгликоль)2000)карбамоил]-1,2-димиристилоксипропиламин и катионный 1,2-дилинолеилокси-3-N,N-диметиламинопропан (см., например, Geisbert et al., Lancet 2010; 375: 1896-905). Может предусматриваться режим дозирования с приемом приблизительно 2 мг/кг общего количества CRISPR-Cas на дозу, вводимую, например, в виде болюсной внутривенной инфузии.

В еще одном варианте осуществления SNALP может содержать синтетический холестерин (Sigma-Aldrich), 1,2-дистеароил-зп-глицеро-3-фосфохолин (DSPC; Avanti Polar Lipids Inc.), PEG-C-DMA и 1,2-дилинолеилокси-3-(N,N-диметил)аминопропан (DLinDMA) (см., например, Judge, J. Clin. Invest. 119: 661-673 (2009)). Составы, используемые для исследований in vivo, могут содержать липиды и РНК в конечном массовом соотношении, составляющем приблизительно 9:1.

Профиль безопасности нанопрепаратов для RNAi был рассмотрен Barros и Gollob из Alnylam Pharmaceuticals (см., например, Advanced Drug Delivery Reviews 64 (2012) 1730-1737). Стабильная частица из нуклеиновой кислоты и липидов (SNALP) содержит четыре различных липида - ионизируемый липид (DLinDMA), который является катионным при низком рН, нейтральный вспомогательный липид, холестерин и диффундирующий конъюгат полиэтиленгликоль (PEG)-липид. Частица имеет диаметр примерно 80 нм и является электронейтральной при физиологическом значении рН. Во время составления ионизируемый липид служит для конденсации липида с анионной siRNA в ходе образования частиц. Будучи положительно заряженным в условиях возрастающей кислотности в эндосомах, ионизируемый липид также опосредует слияние SNALP с мембраной эндосомы, обеспечивая высвобождение siRNA в цитоплазму. Конъюгат PEG-липид стабилизирует частицу и уменьшает агрегацию во время составления, а также впоследствии обеспечивает нейтральную гидрофильную наружную поверхность, улучшающую фармакокинетические свойства.

К настоящему времени была начата реализация двух программ клинических исследований с применением составов на основе SNALP с siRNA. В Tekmira Pharmaceuticals недавно завершили фазу I однодозового исследования SNALP-ApoB с участием взрослых добровольцев с повышенным уровнем холестерина LDL. АроВ преимущественно экспрессируется в печени и тонкой кишке и является ключевым для сборки и секреции VLDL и LDL. АроВ также успешно подвергается целенаправленному воздействию систем CRISPR-Cas авторов настоящего изобретения, см. примеры 38-39. Семнадцать субъектов получали однократную дозу SNALP-АроВ (повышение дозы, охватывающее 7 уровней дозирования). Не наблюдалось свидетельств гепатотоксичности (предполагаемой в качестве возможной дозолимитирующей токсичности на основании доклинических исследований). Один (или два) субъекта при наиболее высокой дозе испытывали симптомы гриппоподобных заболеваний, указывающие на стимуляцию иммунной системы, и было принято решение завершить испытание.

В Alnylam Pharmaceuticals аналогичным образом успешно провели исследование ALN-TTR01, который использует технологию SNALP, описанную выше, и целенаправленно воздействует на выработку гепатоцитами как мутантного TTR, так и TTR дикого типа, для лечения опосредованного TTR амилоидоза (ATTR). Были описаны три синдрома при ATTR: семейная амилоидическая полинейропатия (FAP) и семейная амилоидическая кардиомиопатия (FAC) - оба из которых обусловлены аутосомно-доминантными мутациями в TTR; и старческий системный амилоидоз (SSA), обусловленный отложением TTR дикого типа. Недавно завершили I фазу плацебо-контролируемого испытания с повышением однократной дозы ALN-TTR01 с участием пациентов с ATTR. Введение ALN-TTR01 осуществляли в виде 15-минутной IV инфузии 31 пациенту (исследуемое лекарственное средство для 23 и плацебо для 8) в диапазоне доз 0,01-1,0 мг/кг (из расчета siRNA). Лечение хорошо переносилось без значительного повышения показателей печеночных проб. Инфузионные реакции отмечались у 3 из 23 пациентов при ≥0,4 мг/кг; все они реагировали на замедление скорости инфузии и все они продолжали исследование. Минимальные и временные повышения уровней цитокинов IL-6, IP-10 и IL-1RA в сыворотке отмечались у двух пациентов при наиболее высокой дозе 1 мг/кг (как предполагалось на основании доклинических исследований и исследований с участием NHP). Снижение уровня TTR в сыворотке, ожидаемый фармакодинамический эффект ALN-TTR01, наблюдалось при 1 мг/кг.

В еще одном варианте осуществления SNALP можно получить путем солюбилизации катионного липида, DSPC, холестерина и конъюгата PEG-липид, которые солюбилизируют в этаноле в молярном соотношении 40:10:40:10, соответственно (см. Semple et al., Nature Biotechnology, Volume 28 Number 2 February 2010, pp. 172-177). Смесь липидов добавляли к водному буферу (50 мМ цитрат, рН 4) с перемешиванием до конечной концентрации этанола и липидов 30% (об./об.) и 6,1 мг/мл, соответственно, и ей позволяли уравновешиваться при 22°C в течение 2 мин перед экструзией. Гидрированные липиды экструдировали через два установленных один над другим фильтра с размером пор 80 нм (Nuclepore) при 22°C при помощи экструдера Lipex (Northern Lipids) до достижения диаметра пузырьков 70-90 нм, определяемого посредством анализа по методу динамического рассеяния света. Для этого обычно требовалось 1-3 прохождения. siRNA (солюбилизированную в водном растворе, содержащем 30% этанол, с 50 мМ цитратом, рН 4) добавляли к предварительно уравновешенным (35°C) пузырькам со скоростью ~5 мл/мин при перемешивании. После достижения конечного целевого соотношения siRNA/липиды 0,06 (вес/вес) смесь инкубировали в течение дополнительных 30 мин при 35°C для обеспечения реорганизации пузырьков и инкапсулирования siRNA. Этанол затем удаляли, а внешний буфер заменяли на PBS (155 мМ NaCl, 3 мМ Na2HPO4, 1 мМ КН2Р04, рН 7,5) путем диализа либо тангенциальной поточной диафильтрации. siRNA инкапсулировали в SNALP посредством регулируемого способа по методу ступенчатого разбавления. Липидные составляющие KC2-SNALP представляли собой DLin-KC2-DMA (катионный липид), дипальмитоилфосфатидилхолин (DPPC; Avanti Polar Lipids), синтетический холестерин (Sigma) и PEG-C-DMA, используемые в молярном соотношении 57,1:7,1:34,3:1,4. После образования нагруженных частиц SNALP подвергали диализу против PBS и стерилизации путем фильтрации через фильтр с диаметром пор 0,2 мкм перед применением. Средние значения размера частиц составляли 75-85 нм, и 90-95% siRNA были инкапсулированы в липидных частицах. Конечное соотношение siRNA/липиды в составах, используемых для тестирования in vivo, составляло ~0,15 (вес/вес). Системы LNP-siRNA, содержащие siRNA для фактора VII, разбавляли до соответствующих концентраций в стерильном PBS непосредственно перед применением, и составы вводили внутривенно через латеральную хвостовую вену в общем объеме 10 мл/кг. Данный способ можно экстраполировать на систему CRISPR-Cas по настоящему изобретению.

Другие липиды

Другие катионные липиды, такие как аминолипид 2,2-дилинолеил-4-диметиламиноэтил-[1,3]-диоксолан (DLin-KC2-DMA), можно использовать для инкапсулирования CRISPR-Cas аналогично siRNA (см., например, Jayaraman, Angew. Chem. Int. Ed. 2012, 51, 8529-8533). Может быть предусмотрен предварительно сформированный пузырек со следующим составом липидов: аминолипид, дистеароилфосфатидилхолин (DSPC), холестерин и (R)-2,3-бис(октадецилокси)пропил-1-(метоксиполи(этиленгликоль)2000)пропилкарбамат (конъюгат PEG-липид) в молярном соотношении 40/10/40/10, соответственно, и с соотношением siRNA для FVII/общие липиды, составляющим примерно 0,05 (вес/вес). Для обеспечения узкого распределения частиц по размеру в диапазоне 70-90 нм и низкого коэффициента полидисперсности 0,11±0,04 (n=56) частицы можно экструдировать до трех раз через мембраны с диаметром пор 80 нм перед добавлением РНК CRISPR-Cas. Можно использовать частицы, содержащие высокоактивный аминолипид 16, в которых молярное соотношение четырех липидных компонентов 16, DSPC, холестерина и конъюгата PEG-липид (50/10/38,5/1,5) можно дополнительно оптимизировать для повышения активности in vivo.

Michael S D Kormann и соавт. ("Expression of therapeutic proteins after delivery of chemically modified mRNA in mice: Nature Biotechnology, Volume: 29, Pages: 154-157 (2011), опубликовано в режиме онлайн 09 января 2011 г.) описывают применение липидных оболочек для доставки РНК. Применение липидных оболочек также является предпочтительным в настоящем изобретении.

В другом варианте осуществления липиды можно составлять с системой CRISPR-Cas по настоящему изобретению с образованием липидных наночастиц (LNP). Липиды включают, без ограничения, DLin-KC2-DMA4, С12-200 и совместно действующие липиды дистеароилфосфатидилхолин, холестерин и PEG-DMG, которые можно составлять с CRISPR-Cas вместо siRNA (см., например, Novobrantseva, Molecular Therapy-Nucleic Acids (2012) 1, e4; doi: 10.1038/mtna.2011.3) с помощью процедуры самопроизвольного образования пузырьков. Молярное соотношение компонентов может составлять приблизительно 50/10/38,5/1,5 (DLin-KC2-DMA или С12-200/дистеароилфосфатидилхолин/холестерин/PEG-DMG). Конечное весовое соотношение липиды: siRNA может составлять ~12:1 и 9:1 в случае липидных наночастиц (LNP) на основе DLin-KC2-DMA и С12-200, соответственно. Составы могут характеризоваться средними диаметрами частиц ~80 нм при >90% эффективности включения. Может быть предусмотрена доза 3 мг/кг.

Tekmira имеет портфель из примерно 95 семейств патентов-аналогов, выданных в США и за границей, которые направлены на различные аспекты LNP и составы на основе LNP (см., например, патенты США №№7982027; 7799565; 8058069; 8283333; 7901708; 7745651; 7803397; 8101741; 8188263; 7915399; 8236943 и 7838658 и европейские патенты №№1766035; 1519714; 1781593 и 1664316), все из которых можно применять в настоящем изобретении и/или приспосабливать к нему.

Систему CRISPR-Cas можно доставлять инкапсулированной в микросферах на основе PLGA, таких как дополнительно описанные в опубликованных заявках на патенты США 20130252281, и 20130245107, и 20130244279 (закрепленных за Moderna Therapeutics), которые относятся к аспектам составления композиций, содержащих модифицированные молекулы нуклеиновых кислот, которые могут кодировать белок, предшественник белка или частично или полностью процессированную форму белка или предшественника белка. Состав может характеризоваться молярным соотношением 50:10:38,5:1,5-3,0 (катионный липид:фузогенный липид:холестерин:конъюгат PEG-липид). Конъюгат PEG-липид может быть выбран из, без ограничения, PEG-C-DOMG, PEG-DMG. Фузогенный липид может представлять собой DSPC. См. также Schrum et al., "Доставка и составление сконструированных нуклеиновых кислот", опубликованную заявку на патент США 20120251618.

Технология Nanomerics преодолевает проблемы, связанные с биологической доступностью, для широкого спектра терапевтических средств, в том числе низкомолекулярных гидрофобных лекарственных средств, пептидов и терапевтических средств на основе нуклеиновых кислот (плазмид, siRNA, miRNA). Конкретные пути введения, для которых технология продемонстрировала очевидные преимущества, включают пероральный путь, перенос через гематоэнцефалический барьер, доставка в солидные опухоли, а также в глаз. См., например, Mazza et al., 2013, ACS Nano. 2013 Feb 26; 7 (2): 1016-26; Uchegbu and Siew, 2013, J Pharm Sci. 102 (2): 305-10, и Lalatsa et al., 2012, J Control Release. 2012 Jul 20; 161 (2): 523-36.

В публикации заявки на патент США №20050019923 описаны катионные дендримеры для доставки биологически активных молекул, таких как молекулы полинуклеотидов, пептиды и полипептиды и/или фармацевтические средства, в организм млекопитающего. Дендримеры подходят для обеспечения нацеленной доставки биологически активных молекул в, например, печень, селезенку, легкое, почку или сердце. Дендримеры являются синтетическими 3-мерными макромолекулами, получаемыми ступенчатым способом из простых разветвленных мономерных звеньев, природу и количество функциональных групп которых можно легко регулировать и изменять. Дендримеры синтезируют путем повторяющегося присоединения "строительных блоков" в направлении от сердцевины с несколькими функциональными группами (дивергентный подход к синтезу) или к сердцевине с несколькими функциональными группами (конвергентный подход к синтезу), и каждое присоединение 3-мерной оболочки из "строительных блоков" приводит к образованию дендримеров более высокой генерации. Синтез полипропилениминовых дендримеров начинается с диаминобутановой сердцевины, к которой присоединяют удвоенное количество аминогрупп посредством двойного присоединения по Михаэлю ацетонитрила к первичным аминогруппам с последующим гидрированием нитрильных групп. Это обуславливает удвоение количества аминогрупп. Полипропилениминовые дендримеры содержат 100% протонируемых атомов азота и до 64 концевых аминогрупп (генерация 5, DAB 64). Протонируемые группы обычно представляют собой аминогруппы, способные принимать протоны при нейтральном рН. Применение дендримеров в качестве средств для доставки генов в основном ориентировано на использование полиамидоамина и фосфорсодержащих соединений со смесью из амина/амида или N--P(O2)S в качестве конъюгирующих единиц, соответственно, при этом в работах не сообщалось о применении полипропилениминовых дендримеров более низкой генерации для доставки генов. Полипропилениминовые дендримеры также изучали в качестве рН-чувствительных систем с контролируемым высвобождением для доставки лекарственных средств и для инкапсулирования в них гостевых молекул в случае химической модификации периферических аминокислотных групп. Также изучали цитотоксичность и взаимодействие полипропилениминовых дендримеров с ДНК, а также эффективность трансфекции с помощью DAB 64.

Публикация заявки на патент США №20050019923 основана на наблюдении того, что, в противоположность более ранним сообщениям, катионные дендримеры, такие как полипропилениминовые дендримеры, проявляют надлежащие свойства, такие как специфичное нацеливание и низкая токсичность, для применения в целенаправленной доставке биологически активных молекул, таких как генетический материал. В дополнение, производные катионного дендримера также проявляют подходящие свойства для целенаправленной доставки биологически активных молекул. См. также "Биологически активные полимеры", публикацию заявки на патент США 20080267903, в которой раскрыто следующее: "Показано, что различные полимеры, в том числе катионные полиаминные полимеры и дендримерные полимеры, обладают антипролиферативной активностью и могут, таким образом, быть применимыми для лечения нарушений, характеризующихся нежелательной пролиферацией клеток, таких как неоплазии и опухоли, воспалительные нарушения (в том числе аутоиммунные нарушения), псориаз и атеросклероз. Полимеры можно применять в отдельности в качестве активных средств или в качестве средств доставки других терапевтических средств, таких как молекулы лекарственных средств или нуклеиновые кислоты, для генной терапии. В таких случаях присущая полимерам собственная противоопухолевая активность может дополнять активность средства, подлежащего доставке".

Белки с избыточным зарядом

Белки с избыточным зарядом представляют собой класс сконструированных или встречающихся в природе белков с необычно высоким положительным или отрицательным теоретическим суммарным зарядом. Белки как с избыточным отрицательным, так и с избыточным положительным зарядом проявляют особое свойство устойчивости к термически или химически индуцированной агрегации. Белки с избыточным положительным зарядом также способны проникать в клетки млекопитающих. Ассоциация молекул-карго, таких как плазмидная ДНК, siRNA, с этими белками или другими белками может обеспечивать функциональную доставку данных макромолекул в клетки млекопитающих как in vitro, так и in vivo. В лаборатории Дэвида Лю сообщили о создании и определении характеристик белков с избыточным зарядом в 2007 г. (Lawrence et al., 2007, Journal of the American Chemical Society 129, 10110-10112).

Невирусная доставка siRNA и плазмидной ДНК в клетки млекопитающих является значимой как в исследованиях, так и в терапевтических применениях (Akinc et al., 2010, Nat. Biotech. 26, 561-569). Очищенный белок GFP с зарядом +36 (или другой белок с избыточным положительным зарядом) смешивают с siRNA в подходящей бессывороточной среде, и обеспечивают возможность образования ими комплекса перед добавлением к клеткам. Включение сыворотки на этой стадии ингибирует образование комплексов белок с избыточным зарядом-siRNA и снижает эффективность обработки. Было обнаружено, что следующий протокол является эффективным для ряда линий клеток (McNaughton et al., 2009, Proc. Natl. Acad. Sci. USA 106, 6111-6116). Однако в целях оптимизации процедуры для конкретных линий клеток следует проводить предварительные эксперименты с различными дозами белка и siRNA.

(1) За один день до обработки высеять 1×105 клеток на лунку в 48-луночный планшет.

(2) В день обработки разбавить очищенный белок GFP с зарядом +36 в бессывороточной среде до конечной концентрации 200 нМ. Добавить siRNA до конечной концентрации 50 нМ. Перемешать в вихревой мешалке и инкубировать при комнатной температуре в течение 10 мин.

(3) Во время инкубирования аспирировать среду от клеток и промыть один раз с помощью PBS.

(4) После инкубирования GFP с зарядом +36 и siRNA добавить к клеткам комплексы белок-siRNA.

(5) Инкубировать клетки с комплексами при 37°C в течение 4 ч.

(6) После инкубирования аспирировать среду и промыть три раза с помощью 20 ЕД/мл гепарина в PBS. Инкубировать клетки в сывороточной среде в течение дополнительных 48 ч. или дольше в зависимости от анализа нокдауна.

(7) Анализировать клетки с помощью иммуноблоттинга, количественной ПЦР, фенотипического анализа или другого соответствующего способа.

Было обнаружено, что GFP с зарядом +36 является эффективным реагентом для доставки плазмид в ряд клеток. Поскольку плазмидная ДНК является более крупной молекулой-карго, чем siRNA, то для образования эффективного комплекса с плазмидами требуется пропорционально больше белка GFP с зарядом +36. Для эффективной доставки плазмид заявители разработали вариант GFP с зарядом +36, несущий С-концевую пептидную метку НА2, известный пептид, разрушающий эндосомы, полученный из белка гемагглютинина вируса гриппа. Следующий протокол был эффективным для многих клеток, но, как указано выше, рекомендуется, чтобы дозы плазмидной ДНК и белка с избыточным зарядом были оптимизированы для конкретных линий клеток и применений в доставке.

(1) За один день до обработки высеять 1×105 клеток на лунку в 48-луночный планшет.

(2) В день обработки разбавить очищенный белок GFP с зарядом в бессывороточной среде до конечной концентрации 2 мМ. Добавить 1 мг плазмидной ДНК. Перемешать в вихревой мешалке и инкубировать при комнатной температуре в течение 10 мин.

(3) Во время инкубирования аспирировать среду от клеток и промыть один раз с помощью PBS.

(4) После инкубирования GFP с зарядом и плазмидной ДНК осторожно добавить к клеткам комплексы белок-ДНК.

(5) Инкубировать клетки с комплексами при 37°C в течение 4 ч.

(6) После инкубирования аспирировать среду и промыть с помощью PBS. Инкубировать клетки в сывороточной среде и инкубировать в течение дополнительных 24-48 ч.

(7) При необходимости проанализировать доставку плазмид (например, посредством экспрессии генов, обусловленной плазмидами).

См. также, например, McNaughton et al., Proc. Natl. Acad. Sci. USA 106, 6111-6116 (2009); Cronican et al., ACS Chemical Biology 5, 747-752 (2010); Cronican et al., Chemistry & Biology 18, 833-838 (2011); Thompson et al., Methods in Enzymology 503, 293-319 (2012); Thompson, D.B., et al., Chemistry & Biology 19 (7), 831-843 (2012). Способы использования белков с избыточным зарядом можно применять для доставки системы CRISPR-Cas по настоящему изобретению и/или приспосабливать к ней.

Пептиды, проникающие в клетку

В еще одном варианте осуществления предусмотрены пептиды, проникающие в клетку (СРР), для доставки системы CRISPR-Cas. СРР представляют собой короткие пептиды, содействующие поглощению клетками различных молекул-карго (от наноразмерных частиц до малых химических молекул и крупных фрагментов ДНК). Выражение "молекула-карго", используемое в данном документе, включает, без ограничения, группу, состоящую из терапевтических средств, диагностических зондов, пептидов, нуклеиновых кислот, антисмысловых олигонуклеотидов, плазмид, белков, наночастиц, липосом, хромофоров, малых молекул и радиоактивных материалов. В аспектах настоящего изобретения молекула-карго может также содержать любой компонент системы CRISPR-Cas или всю функциональную систему CRISPR-Cas. В аспектах настоящего изобретения дополнительно представлены способы доставки желаемой молекулы-карго субъекту, включающие: (а) получение комплекса, содержащего пептид, проникающий в клетку, по настоящему изобретению и желаемую молекулу-карго, и (b) пероральное, внутрисуставное, внутрибрюшинное, интратекальное, внутриартериальное, интраназальное, интрапаренхиматозное, подкожное, внутримышечное, внутривенное, накожное, ректальное или местное введение комплекса субъекту. Молекула-карго связана с пептидами химической связью посредством ковалентных связей либо посредством нековалентных взаимодействий.

Функцией СРР является доставка молекулы-карго в клетки, процесс, который обычно происходит с молекулой-карго, доставляемой в эндосомы живых клеток млекопитающих, посредством эндоцитоза. Пептиды, проникающие в клетку, имеют различные размер, аминокислотные последовательности и заряды, но все СРР имеют одну отличительную характеристику, которая представляет собой способность к перемещению через плазматическую мембрану и содействию доставке различных молекул-карго в цитоплазму или органеллу. Перемещение СРР можно подразделить на три основных механизма поступления: прямое прохождение через мембрану, поступление, опосредованное эндоцитозом, и перемещение посредством образования промежуточной структуры. СРР нашли многочисленные применения в медицине в качестве средств для доставки лекарственных средств при лечении различных заболеваний, в том числе рака, и ингибиторов вирусов, а также контрастных веществ для мечения клеток. Примеры последнего включают действие в качестве носителя GFP, контрастных веществ для MPI или квантовых точек. СРР обладают большим потенциалом в качестве векторов доставки in vitro и in vivo для применения в научно-исследовательской работе и медицине. СРР обычно имеют такой аминокислотный состав, при котором они характеризуются высокой относительной распространенностью положительно заряженных аминокислот, таких как лизин или аргинин, либо имеют последовательности, характеризующиеся чередующимся расположением полярных/заряженных аминокислот и неполярных гидрофобных аминокислот. Эти два типа структур называются поликатионными или амфипатическими, соответственно. Третьим классом СРР являются гидрофобные пептиды, содержащие только неполярные остатки с низким суммарным зарядом или имеющие гидрофобные группы аминокислот, крайне важные для поглощения клетками. Одним из первых обнаруженных СРР был трансактивирующий активатор транскрипции (Tat) вируса иммунодефицита человека 1 (HIV-1), который, как было выявлено, эффективно поглощался из окружающей среды многочисленными типами клеток в культуре. С тех пор количество известных СРР значительно увеличилось, и были созданы низкомолекулярные синтетические аналоги с более эффективными свойствами белковой трансдукции. СРР включают, без ограничения, пенетратин, Tat (48-60), транспортан и (R-AhX-R4) (Ahx = аминогексаноил).

Как описано в патенте США 8372951, представлен СРР, полученный из катионного белка эозинофилов (ЕСР), проявляющий высокую эффективность проникновения в клетку и низкую токсичность. Также представлены аспекты доставки СРР со своей молекулой-карго позвоночному субъекту. Дополнительные аспекты, касающиеся СРР и их доставки, описаны в патентах США 8575305; 8614194 и 8044019.

Эти СРР можно использовать для доставки системы CRISPR-Cas, что также представлено в рукописи "Gene disruption by cell-penetrating peptide-mediated delivery of Cas9 protein and guide RNA" Suresh Ramakrishna, Abu-Bonsrah Kwaku Dad, Jagadish Beloor, et al. Genome Res. 2014 Apr 2. [Электронная публикация, предшествующая печатной], включенной с помощью ссылки во всей своей полноте, где продемонстрировано, что обработка с помощью рекомбинантного белка Cas9 конъюгированного с СРР, и направляющих РНК, образующих комплекс с СРР, приводит к нарушениям функционирования эндогенных генов в линиях клеток человека. В данной статье белок Cas9 был конъюгирован СРР с помощью тиоэфирной связи, тогда как направляющая РНК образовывала комплекс с СРР с образованием конденсированных положительно заряженных наночастиц. Было показано, что одновременная и последовательная обработка клеток человека, в том числе эмбриональных стволовых клеток, дермальных фибробластов, клеток НЕК293Т, клеток HeLa и клеток эмбриональной карциномы, модифицированным Cas9 и направляющей РНК приводила к эффективным нарушениям функционирования генов со снижением частоты нецелевых мутаций по сравнению с трансфекцией плазмидами.

Имплантируемые устройства

В другом варианте осуществления также предусмотрены имплантируемые устройства для доставки системы CRISPR-Cas. Например, в публикации заявки на патент США 20110195123 раскрыто представленное имплантируемое медицинское устройство, высвобождающее лекарственное средство локально и в течение длительного периода, в, том числе несколько типов такого устройства, реализуемые методы лечения и способы имплантации. Устройство содержит полимерный субстрат, такой как матрица, например, применяемый в качестве корпуса устройства, и лекарственные средства, и в некоторых случаях дополнительные трехмерные подложки-носители, такие как металлы или дополнительные полимеры, и материалы для улучшения видимости и визуализации. В основе выбора лекарственного средства лежит преимущество высвобождения лекарственного средства, происходящего локально и в течение длительного периода, где лекарственное средство высвобождается непосредственно во внеклеточный матрикс (ЕСМ) пораженной заболеванием области, как, например, в случае опухоли, воспаления, дегенерации, или в целях симптоматической терапии, или в пораженные гладкомышечные клетки, или для предупреждения. Один вид лекарственных средств представляет собой лекарственные средства для сайленсинга генов на основе РНК-интерференции (RNAi), включающие, без ограничения, siRNA, shRNA или антисмысловые РНК/ДНК, рибозимы и нуклеозидные аналоги. Таким образом, данную систему можно применять для системы CRISPR-Cas по настоящему изобретению и/или приспосабливать к ней. Методы имплантации в некоторых вариантах осуществления представляют собой существующие процедуры имплантации, разработанные и применяемые в настоящее время для других видов лечения, в том числе для брахитерапии и пункционной биопсии. В таких случаях размеры нового имплантата, описанного в настоящем изобретении, аналогичны размерам первоначального имплантата. Как правило, в ходе одной процедуры лечения имплантируют несколько устройств.

Как описано в публикации заявки на патент США 20110195123, представлена имплантируемая или вставная система доставки лекарственных средств, в том числе системы, применимые для введения в полость, такую как брюшная полость, и/или для любого другого типа введения, в которой система доставки лекарственных средств не закреплена и не присоединена, содержащая биоустойчивый, и/или разлагаемый, и/или биопоглощаемый полимерный субстрат, который может, например, необязательно представлять собой матрицу. Следует отметить, что выражение "вставка" также включает имплантацию. Система доставки лекарственных средств преимущественно реализуется как "Loder", описанный в публикации заявки на патент США 20110195123.

Полимер или множество полимеров, содержащие средство и/или множество средств, являются биосовместимыми, обеспечивая высвобождение средства с контролируемой скоростью, где общий объем полимерного субстрата, такого как матрица, например, в некоторых вариантах осуществления необязательно и предпочтительно не превосходит максимальный объем, позволяющий достигнуть терапевтического уровня средства. В качестве неограничивающего примера, такой объем предпочтительно находится в диапазоне от 0,1 м3 до 1000 мм3, как того требует объем загруженного средства. Loder необязательно может иметь больший размер, например, будучи включенным в состав устройства, размер которого определяется функциональным назначением, например, без ограничения, коленного сустава, внутриматочного или шеечного кольца и т.п.

Система доставки лекарственных средств (для доставки композиции) в некоторых вариантах осуществления предназначена для предпочтительного использования разлагаемых полимеров, где основным механизмом высвобождения является объемная эрозия; или же в некоторых вариантах осуществления применяются неразлагаемые или медленно разлагаемые полимеры, где основным механизмом высвобождения является диффузия, а не объемная эрозия, так что их наружная часть функционирует в качестве мембраны, а их внутренняя часть функционирует в качестве депо лекарственного средства, которое практически не подвергается воздействию окружения в течение продолжительного периода (например, от приблизительно недели до приблизительно нескольких месяцев). Также можно необязательно применять комбинации различных полимеров с различными механизмами высвобождения. Градиент концентраций на поверхности предпочтительно эффективно поддерживается постоянным в течение значительного периода в ходе общего периода высвобождения лекарственного средства, и, таким образом, скорость диффузии (называемой "диффузией нулевого порядка") является эффективно постоянной. Под выражением "постоянный" подразумевают скорость диффузии, которая предпочтительно поддерживается выше нижнего порога терапевтической эффективности, но которая, тем не менее, может необязательно характеризоваться начальным всплеском и/или колебаться, например, повышаясь и понижаясь в некоторой степени. Скорость диффузии предпочтительно поддерживается таким образом в течение длительного периода, и до определенного уровня она может считаться постоянной для оптимизации терапевтически эффективного периода, например, эффективного периода сайленсинга.

Система доставки лекарственных средств необязательно и предпочтительно предназначена для защиты нуклеотидного терапевтического средства от деградации, химической по своей природе или обусловленной воздействием ферментов и других факторов в организме субъекта.

Система доставки лекарственных средств, описанная в публикации заявки на патент США 20110195123, необязательно связана с чувствительными и/или активирующими приборами, функционирующими во время и/или после имплантации устройства посредством неинвазивных и/или минимально инвазивных способов активации и/или ускорения/замедления, например, необязательно включающих, без ограничения, способы или устройства с применением термического нагревания и охлаждения, лазерных пучков и ультразвука, в том числе фокусированного ультразвука, и/или RF (радиочастот).

Согласно некоторым вариантам осуществления публикации заявки на патент США 20110195123 участок для локальной доставки может необязательно включать целевые участки, характеризующиеся высокой аномальной пролиферацией клеток и подавлением апоптоза, в том числе опухоли, очаги активного и/или хронического воспаления и инфекции, включающих аутоиммунные болезненные состояния, ткань с дегенеративными изменениями, включающую мышечную и нервную ткань, очаги хронической боли, участки с дегенеративными изменениями, и местоположения переломов костей, и другие местоположения ран, для усиления регенерации ткани, а также поврежденные сердечные, гладкие и поперечно-полосатые мышцы. Участок для локальной доставки также может необязательно включать участки, позволяющие осуществлять профилактические мероприятия, в том числе при беременности, для предупреждения инфекции и для пожилых людей.

Участок для имплантации композиции, или целевой участок, предпочтительно характеризуется радиусом, площадью и/или объемом, достаточно малыми для целенаправленной локальной доставки. Например, целевой участок необязательно имеет диаметр в диапазоне от приблизительно 0,1 мм до приблизительно 5 см.

Местоположение целевого участка предпочтительно выбирают для достижения максимальной терапевтической эффективности. Например, композицию системы доставки лекарственных средств (необязательно вместе с устройством для имплантации, описанным выше) необязательно и предпочтительно имплантируют в опухолевое окружение, или рядом с ним, или в кровеносную сеть, связанную с ним.

Например, композицию (необязательно вместе с устройством) необязательно имплантируют в поджелудочную железу, предстательную железу, молочную железу, печень или рядом с ними, через сосок, в сосудистую систему и т.д.

Целевое местоположение необязательно выбирают из группы, состоящей из (только в качестве неограничивающих примеров, поскольку любой участок в организме необязательно может подходить для имплантации Loder): 1. участков головного мозга с дегенеративными изменениями, таких как базальные ганглии, белое и серое вещество, при болезни Паркинсона или Альцгеймера; 2. спинного мозга, как в случае бокового амиотрофического склероза (ALS); 3. шейки матки для предупреждения HPV-инфекции; 4. суставов с активным или хроническим воспалением; 5. дермы, как в случае псориаза; 6. участков симпатических и чувствительных нервов для обезболивающего эффекта; 7. участков внутрикостной имплантации; 8. очагов острой и хронической инфекции; 9. интравагинальньгх участков; 10. внутреннего уха слуховой системы, лабиринта внутреннего уха, вестибулярной системы; 11. внутритрахеальных участков; 12. внутрисердечных участков; участков коронарных сосудов, эпикардиальных участков; 13. мочевого пузыря; 14. желчевыделительной системы; 15. паренхимной ткани, включающей, без ограничения, почку, печень, селезенку; 16. лимфатических узлов; 17. слюнных желез; 18. десен вокруг зубов; 19. внутрисуставных участков (имплантация в суставы); 20. внутриглазных участков; 21. ткани головного мозга; 22. желудочков головного мозга; 23. полостей, в том числе брюшной полости (например, без ограничения, для лечения рака яичника); 24. внутрипищеводных участков и 25. внутрипрямокишечных участков.

Вставка системы (например, устройства, содержащего композицию) необязательно связана с инъекцией материала в ЕСМ целевого участка и окружение этого участка для воздействия на локальные рН, и/или температуру, и/или другие биологические факторы, влияющие на диффузию лекарственного средства и/или кинетику лекарственного средства в ЕСМ целевого участка и окружении такого участка.

Согласно некоторым вариантам осуществления высвобождение указанного средства необязательно может быть связано с чувствительными и/или активирующими приборами, функционирующими до, и/или во время, и/или после вставки посредством неинвазивных, и/или минимально инвазивных, и/или других способов активации и/или ускорения/замедления, включающих способы или устройства с применением лазерных пучков, излучения, термического нагревания и охлаждения, и ультразвука, в том числе фокусированного ультразвука, и/или RF (радиочастот), а также химических активаторов.

Согласно другим вариантам осуществления в публикации заявки на патент США 20110195123 лекарственное средство предпочтительно включает биологическое лекарственное средство для сайленсинга генов на основе RNAi, например, для лечения случаев локализованного рака молочной железы, поджелудочной железы, головного мозга, почки, мочевого пузыря, легкого и предстательной железы, описанных ниже. Кроме того, многие лекарственные средства, отличные от siRNA, применимы для инкапсулирования в Loder и могут применяться в контексте настоящего изобретения, поскольку такие лекарственные средства могут быть инкапсулированы в субстрат Loder, такой как, например, матрица. Такие лекарственные средства включают одобренные лекарственные средства, доставляемые в настоящее время с помощью способов, отличных от способов по настоящему изобретению, включающие амфотерицин В для лечения грибковой инфекции; антибиотики, как, например, при остеомиелите; обезболивающие средства, такие как наркотические средства; антидегенеративные средства, как, например, при болезни Альцгеймера или Паркинсона, в Loder, имплантируемом вблизи спинного мозга в случае боли в спине. Такую систему можно применять для доставки системы CRISPR-Cas по настоящему изобретению и/или приспосабливать к ней.

Например, для конкретных применений, таких как предупреждение роста или возобновления роста гладкомышечных клеток (поврежденных в ходе процедуры стентирования и вследствие этого склонных к пролиферации), лекарственное средство может необязательно представлять собой siRNA, осуществляющую сайленсинг в гладкомышечных клетках, в том числе сайленсинг H19, или лекарственное средство, выбранное из группы, состоящей из таксола, рапамицина и аналогов рапамицина. В таких случаях Loder предпочтительно представляет собой стент, выделяющий лекарственное средство (DES), с пролонгированным высвобождением при постоянной скорости либо выделенное устройство, которое имплантируют отдельно, совместно со стентом. Все из этого можно применять для системы CRISPR-Cas по настоящему изобретению и/или приспосабливать к ней.

В качестве другого примера конкретного применения, нейро- и миодегенеративные заболевания развиваются в связи с аномальной экспрессией генов. Локальная доставка РНК для сайленсинга может иметь терапевтические свойства, препятствующие такой аномальной экспрессии генов. Локальная доставка антиапоптотических, противовоспалительных и антидегенеративных лекарственных средств, в том числе низкомолекулярных лекарственных средств и макромолекул, может также необязательно быть терапевтической. В таких случаях Loder применяют для пролонгированного высвобождения при постоянной скорости и/или посредством выделенного устройства, которое имплантируют отдельно. Все из этого можно применять для системы CRISPR-Cas по настоящему изобретению и/или приспосабливать к ней.

В качестве еще одного примера конкретного применения, психические и когнитивные расстройства лечат с помощью модификаторов генов. Нокдаун гена с помощью РНК для сайленсинга является возможным методом лечения. Применение Loder для локальной доставки нуклеотидных средств в участки центральной нервной системы является возможным методом терапии психических и когнитивных расстройств, в том числе, без ограничения, психоза, биполярных расстройств, невротических расстройств и расстройств поведения. Loder могут также обеспечивать локальную доставку лекарственных средств, в том числе низкомолекулярных лекарственных средств и макромолекул, при имплантации в конкретные участки головного мозга. Все из этого можно применять для системы CRISPR-Cas по настоящему изобретению и/или приспосабливать к ней.

В качестве другого примера конкретного применения, сайленсинг генов медиаторов врожденного и/или приобретенного иммунного ответа в локальных участках обеспечивает предупреждение отторжения трансплантированного органа. Локальная доставка РНК для сайленсинга и иммуномодулирующих реагентов с помощью Loder, имплантированного в трансплантированный орган и/или участок имплантации, активирует подавление местного иммунитета в отношении трансплантированного органа путем отвлечения иммунных клеток, таких как CD8+. Все из этого можно применять для системы CRISPR-Cas по настоящему изобретению и/или приспосабливать к ней.

В качестве другого примера конкретного применения, факторы роста сосудов, в том числе VEGF, и ангиогенин, и другие, являются существенно важными для неоваскуляризации. Локальная доставка факторов, пептидов, пептидомиметиков или подавление их репрессоров является важным терапевтическим воздействием; сайленсинг репрессоров и локальная доставка факторов, пептидов, макромолекул и низкомолекулярных лекарственных средств, стимулирующих ангиогенез, с помощью Loder являются терапевтическими мерами в отношении заболевания периферических сосудов, системного заболевания сосудов и заболевания сосудов сердца.

Способ вставки, такой как имплантация, необязательно можно еще применять для других типов имплантации в ткань, и/или для вставок, и/или для отбора образцов тканей, необязательно без модификаций или, в альтернативном случае, необязательно лишь с незначительными модификациями таких способов. Такие способы необязательно включают, без ограничения, способы брахитерапии, биопсию, эндоскопию с применением ультразвуковых технологий и/или без них, такую как ERCP, стереотаксические способы в отношении ткани головного мозга, лапароскопию, в том числе имплантацию с помощью лапароскопа в суставы, органы брюшной полости, стенку мочевого пузыря и полости тела.

мРНК фермента CRISPR и направляющая РНК

мРНК фермента CRISPR и направляющую РНК можно также доставлять по отдельности. мРНК фермента CRISPR можно доставлять перед направляющей РНК, чтобы предоставить время для экспрессии фермента CRISPR. мРНК фермента CRISPR можно вводить за 1-12 часов (предпочтительно примерно за 2-6 часов) до введения направляющей РНК.

В альтернативном случае мРНК фермента CRISPR и направляющую РНК можно вводить совместно. Вторую бустерную дозу направляющей РНК можно преимущественно вводить через 1-12 часов (предпочтительно примерно через 2-6 часов) после первого введения мРНК фермента CRISPR + направляющей РНК.

Введение дополнительных доз мРНК фермента CRISPR и/или направляющей РНК может быть применимым для достижения наиболее эффективных уровней модификации генома.

Для сведения к минимуму токсичности и нецелевого эффекта будет важной регуляция концентрации доставляемых мРНК фермента CRISPR и направляющей РНК. Оптимальные концентрации мРНК фермента CRISPR и направляющей РНК можно определить путем тестирования различных концентраций в клеточной или животной модели и применения глубокого секвенирования для анализа степени модификации в возможных нецелевых локусах генома. Например, для направляющей последовательности, нацеливающейся на в гене ЕМХ1 генома человека, можно применять глубокое секвенирование для определения уровня модификации в следующих двух нецелевых локусах, 1: и 2: . Для доставки in vivo следует выбрать концентрацию, дающую наиболее высокий уровень целевой модификации при сведении к минимуму уровня нецелевой модификации.

В альтернативном случае для сведения к минимуму уровня токсичности и нецелевого эффекта можно доставлять мРНК фермента никазы CRISPR (например, Cas9 S. pyogenes с мутацией D10A) вместе с парой направляющих РНК, которые осуществляют нацеливание на сайт, представляющий интерес. Две направляющие РНК необходимо расположить следующим образом. Направляющие последовательности показаны красным (одинарное подчеркивание) и синим (двойное подчеркивание), соответственно (эти примеры основаны на требованиях к РАМ для Cas9 Streptococcus pyogenes).

Дополнительное исследование системы предоставило заявителям свидетельство наличия "липкого" 5'-конца (см., например, Ran et al., Cell. 2013 Sep 12; 154 (6): 1380-9 и предварительную заявку на патент США с регистрационным номером 61/871301, поданную 28 августа 2013 г.). Заявители дополнительно идентифицировали параметры, связанные с эффективным расщеплением мутантной никазой Cas9 в сочетании с двумя направляющими РНК, и эти параметры включают, без ограничения, длину "липкого" 5'-конца. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит не более 200 пар оснований, предпочтительно не более 100 пар оснований или более предпочтительно не более 50 пар оснований. В вариантах осуществления настоящего изобретения "липкий" 5'-конец содержит по меньшей мере 26 пар оснований, предпочтительно по меньшей мере 30 пар оснований или более предпочтительно 34-50 пар оснований или 1-34 пары оснований. В других предпочтительных способах по настоящему изобретению первая направляющая последовательность, управляющая расщеплением одной нити ДНК-дуплекса возле первой целевой последовательности, и вторая направляющая последовательность, управляющая расщеплением другой нити возле второй целевой последовательности, обуславливают возникновение "тупого" конца или "липкого" 3'-конца. В вариантах осуществления настоящего изобретения "липкий" 3'-конец содержит не более 150, 100 или 25 пар оснований или не менее 15, 10 или 1 пары оснований. В предпочтительных вариантах осуществления "липкий" 3'-конец содержит 1-100 пар оснований.

Аспекты настоящего изобретения относятся к снижению экспрессии продукта гена, или к дополнительному введению матричного полинуклеотида в молекулу ДНК, кодирующую продукт гена, или к точному вырезанию вставочной последовательности путем обеспечения повторного отжига и лигирования двух "липких" 5'-концов, или к изменению активности или функционирования продукта гена, или к повышению экспрессии продукта гена. В варианте осуществления настоящего изобретения продукт гена представляет собой белок.

Только пары sgRNA, создающие "липкие" 5'-концы, с перекрыванием между направляющими последовательностями, составляющим менее 8 п.о. (смещение превышает -8 п.о.), были способны опосредовать выявляемое образование вставок/делеций. Важно, что каждая направляющая последовательность, применяемая в данных анализах, способна эффективно индуцировать образование вставок/делеций при спаривании с Cas9 дикого типа, что указывает на то, что взаимное расположение пар направляющих последовательностей является наиболее важным параметром для предсказания активности внесения двойных однонитевых разрывов.

Поскольку Cas9n и Cas9H840A вносят однонитевые разрывы в противоположные нити ДНК, замена Cas9n на Cas9H840A с указанной парой sgRNA должна обуславливать инверсию типа "липкого" конца. Например, пара sgRNA, которая с Cas9n будет образовывать "липкий" 5'-конец, теоретически будет образовывать вместо этого соответствующий "липкий" 3'-конец. Таким образом, пары sgRNA, обуславливающие с Cas9n образование "липкого" 3'-конца, можно применять с Cas9H840A для образования "липкого" 5'-конца. Заявители тестировали Cas9H840A с набором пар sgRNA, предназначенных для образования "липких" как 5'-, так и 3'-концов (диапазон смещений от -278 до +58 п.о.), но, вопреки ожиданиям, не могли наблюдать образование вставок/делеций. Может потребоваться дополнительная работа для определения необходимых правил конструирования пар sgRNA для обеспечения внесения двойных однонитевых разрывов с помощью Cas9H840A.

Печень, пропротеинконвертаза субтилизин/кексин 9 (PCSK9)

Данные демонстрируют фенотипическую конверсию.

Пропротеинконвертаза субтилизин/кексин 9 (PCSK9) является представителем семейства сериновых протеаз субтилизинового типа. PCSK9 экспрессируется главным образом в печени и является критически важным для снижения экспрессии рецепторов LDL в гепатоцитах. Уровни LDL-C в плазме значительно повышены у людей с мутациями приобретения функции в PCSK9, вследствие чего их считают имеющими тяжелую гиперхолестеринемию. Таким образом, PCSK9 является привлекательной мишенью для CRISPR. Целенаправленно воздействующие на PCS9K CRISPR можно составлять в липидных частицах и вводить, например, при приблизительно 15, 45, 90, 150, 250 и 400 мкг/кг внутривенно (см., например, информацию, доступную на веб-сайте http://ww.alnylam.com/capella/wp-content/uploads/2013/08/ALN-PCS02-001-Protocol-Lancet.pdf).

Bailey и соавт. (J Mol Med (Berl). 1999 Jan; 77 (1): 244-9) раскрывают доставку инсулина посредством генной терапии соматических клеток ex vivo, включающей выделение отличных от В-клеток соматических клеток (например, фибробластов) у пациента с диабетом и генетическое изменение их in vitro для выработки и секреции инсулина. Клетки можно выращивать в культуре и возвращать донору в качестве источника заменителя инсулина. Клетки, модифицированные таким образом, можно оценивать перед имплантацией, а резервные запасы можно подвергать криоконсервации. В случае применения собственных клеток пациента процедура будет избавлена от необходимости в подавлении иммунитета и преодолеет проблему снабжения тканей, избегая при этом повторного разрушения клеток. Для генной терапии соматических клеток ex vivo требуется доступный и устойчивый тип клеток, поддающийся нескольким трансфекциям и подвергаемый регулируемой пролиферации. Особые проблемы, связанные с применением отличных от В-клеток соматических клеток, включают процессинг проинсулина в инсулин и придание чувствительности стимулируемому глюкозой биосинтезу проинсулина и регулируемому высвобождению инсулина. Предварительные исследования с применением фибробластов, гипофизарных клеток, клеток почек (COS) и клеток яичников (СНО) позволяют предположить, что с этими проблемами можно столкнуться и что генная терапия соматических клеток ex vivo предлагает возможный подход к заместительной терапии инсулином. Систему по Bailey и соавт. можно применять для доставки системы CRISPR-Cas по настоящему изобретению в печень и/или приспосабливать к ней.

Способы по Sato и соавт. (Nature Biotechnology Volume 26 Number 4 April 2008, Pages 431-442) можно применять для доставки системы CRISPR-Cas по настоящему изобретению в печень. Sato и соавт. обнаружили, что виды лечения с помощью связанных с витамином А липосом, содержащих siRNA, практически полностью устраняли фиброз печени и продлевали период выживаемости у крыс со смертельным в иных случаях циррозом печени, индуцированным диметилнитрозамином, в зависимости от дозы и продолжительности. Катионные липосомы (Lipotrust), содержащие O,O'-дитетрадеканоил-N-(а-триметиламмонийацетил)диэтаноламинохлорид (DC-6-14) в качестве катионного липида, холестерин и диолеоилфосфатидилэтаноламин в молярном соотношении 4:3:3 (демонстрировавшие высокую эффективность трансфекции в условиях сывороточной среды для доставки генов in vitro и in vivo), приобретали у Hokkaido System Science. Липосомы изготовляли посредством способа с применением подвергнутых сублимационной сушке "пустых" липосом и получали в концентрации 1 мМ (DC-16-4) путем добавления бидистиллированной воды (DDW) к лиофилизированной смеси липидов при перемешивании вихревым способом перед применением. Для получения связанных с VA липосом 200 нмоль витамина А (ретинол, Sigma), растворенного в DMSO, смешивали с суспензиями липосом (в виде 100 нмоль DC-16-4) путем перемешивания вихревым способом в пробирке на 1,5 мл при 25°C. Для получения связанных с VA липосом, несущих siRNAgp46 (VA-липосома-siRNAgp46), раствор siRNAgp46 (580 пмоль/мл в DDW) добавляли к раствору связанных с ретинолом липосом при перемешивании при 25°C. Соотношение siRNA и DC-16-4 составляло 1:11,5 (моль/моль), а соотношение siRNA и липосом (вес/вес) составляло 1:1. Любой свободный витамин А или siRNA, не поглощенную липосомами, отделяли от липосомных препаратов при помощи системы микроразделения (концентратор VIVASPIN 2, MWCO 30000, PES, VIVASCIENCE). Суспензию липосом добавляли на фильтры и центрифугировали при 1500 g в течение 5 мин 3 раза при 25°C. Фракции собирали, и материал, захваченный фильтром, разводили в PBS с получением желаемой дозы для применения in vitro или in vivo. Крысам проводили три инъекции по 0,75 мг/кг siRNA через день. Систему по Sato и соавт. можно применять для доставки системы CRISPR-Cas по настоящему изобретению в печень посредством доставки приблизительно 0,5-1 мг/кг РНК CRISPR-Cas в липосомах, как описано Sato и соавт., людям, и/или приспосабливать к ней.

Способы по Rozema и соавт.(PNAS, August 7, 2007, vol. 104, no. 32) в отношении средств доставки siRNA в гепатоциты как in vitro, так и in vivo, которые Rozema и соавт. назвали динамическими поликонъюгатами siRNA, можно также применять в настоящем изобретении. Ключевые особенности технологии динамических поликонъюгатов включают применение мембраноактивного полимера, способность к обратимой маскировке активности данного полимера до достижения им кислой среды эндосом и способность к специфичному целенаправленному воздействию этого модифицированного полимера и его молекулы-карго siRNA на гепатоциты in vivo после простой i.v. инъекции под низким давлением. SATA-модифицированные siRNA синтезируют с помощью реакции 5'-аминомодифицированной siRNA с 1 весовым эквивалентом (вес. экв.) реагента N-сукцинимидил-S-ацетилтиоацетата (SATA) (Pierce) и 0,36 вес. экв. NaHCO3 в воде при 4°C в течение 16 ч. Модифицированные siRNA затем осаждают путем добавления 9 об. этанола и инкубирования при 80°C в течение 2 ч. Осадок ресуспендируют в 1X буфере для siRNA (Dharmacon) и оценивают количественно путем измерения поглощения при длине волны 260 нм. PBAVE (30 мг/мл в 5 мМ TAPS, рН 9) модифицируют путем добавления 1,5 вес. % SMPT (Pierce). После инкубирования в течение 1 ч. 0,8 мг SMPT-PBAVE добавляли к 400 мкл изотонического раствора глюкозы, содержащего 5 мМ TAPS (рН 9). К этому раствору добавляли 50 мкг SATA-модифицированной siRNA. Для экспериментов по изучению зависимости "доза-эффект", где [PBAVE] была постоянной, добавляют различные количества siRNA. Смесь затем инкубируют в течение 16 ч. К раствору затем добавляют 5,6 мг свободного основания HEPES, а после этого смесь 3,7 мг CDM-NAG и 1,9 мг CDM-PEG. Раствор затем инкубируют в течение по меньшей мере 1 ч. при комнатной температуре перед инъекцией. CDM-PEG и CDM-NAG синтезируют из хлорангидрида, образующегося посредством применения оксалилхлорида. К хлорангидриду добавляют 1,1 молярного эквивалента монометилового эфира полиэтиленгликоля (средняя молекулярная масса 450) с образованием CDM-PEG или (аминоэтокси)этокси-2-(ацетиламино)-2-дезокси-β-D-глюкопиранозида с образованием CDM-NAG. Конечный продукт очищают с помощью обращенно-фазовой HPLC с 0,1% TFA в градиенте вода/ацетонитрил. Мышам доставляли приблизительно 25-50 мкг siRNA. Систему по Rozema и соавт. можно применять для доставки системы CRISPR-Cas по настоящему изобретению в печень, например, предусматривая дозу от приблизительно 50 до приблизительно 200 мг CRISPR-Cas для доставки человеку.

Целенаправленная делеция, терапевтические применения

Целенаправленная делеция генов является предпочтительной. Примеры проиллюстрированы в примере 18. Таким образом, предпочтительными являются гены, вовлеченные в биосинтез холестерина, биосинтез жирных кислот и другие метаболические нарушения, гены, кодирующие неправильно свернутые белки, вовлеченные в амилоидоз и другие заболевания, онкогены, приводящие к трансформации клеток, гены латентных вирусов и гены, приводящие к доминантно-негативным нарушениям среди прочих нарушений. Как проиллюстрировано здесь, заявители отдают предпочтение доставке генов системы CRISPR-Cas в ткань печени, головного мозга, глазную, эпителиальную, кроветворную или иную ткань субъекта или пациента, нуждающегося в этом, страдающего от метаболических нарушений, амилоидоза и заболеваний, связанных с агрегацией белков, трансформации клеток, возникающей в результате генетических мутаций и транслокаций, доминантно-негативных эффектов генных мутаций, латентных вирусных инфекций и других связанных симптомов, с использованием либо вирусных систем доставки, либо систем доставки на основе наночастиц.

Терапевтические применения системы CRISPR-Cas включают применения при глаукоме, амилоидозе и болезни Хантингтона. Они проиллюстрированы в примере 20, и особенности, описанные там, являются предпочтительными по отдельности или в комбинации.

Другой пример заболевания, характеризующегося экспансией полиглутаминовых повторов, которое можно лечить с помощью настоящего изобретения, включает спинально-церебеллярную атаксию 1 типа (SCA1). При внутримозжечковой инъекции векторы на основе рекомбинантного аденоассоциированного вируса (AAV), экспрессирующие короткие шпилечные РНК, существенно улучшают координацию движений, восстанавливают морфологические характеристики мозжечка и устраняют характерные включения атаксина 1 в клетках Пуркинье мышей с SCA1 (см., например, Xia et al., Nature Medicine, Vol. 10, No. 8, Aug. 2004). В частности, предпочтительными являются векторы AAV1 и AAV5, и желаемыми являются титры AAV, составляющие приблизительно 1×1012 векторных геномов/мл.

В качестве примера, можно лечить или предупреждать хроническую инфекцию, вызываемую HIV-1. Для выполнения этой задачи можно создать направляющие РНК CRISPR-Cas, которые осуществляют нацеливание на подавляющее большинство геномов HIV-1 с учетом вариантов штаммов HIV-1 для максимального охвата и эффективности. Можно осуществлять доставку системы CRISPR-Cas с помощью общепринятой, опосредованной аденовирусом или лентивирусом инфекции иммунной системы хозяина. В зависимости от подхода иммунные клетки хозяина могут быть а) выделены, трансдуцированы CRISPR-Cas, подвергнуты отбору и повторно введены хозяину или b) трансдуцированы in vivo путем системной доставки системы CRISPR-Cas. Первый подход обеспечивает возможность получения популяции устойчивых иммунных клеток, тогда как второй, по всей вероятности, целенаправленно воздействует на скрытые резервуары вируса в хозяине. Более подробно это обсуждается в разделе "Примеры".

В другом примере публикация заявки на патент США №20130171732, закрепленная за Sangamo Biosciences, Inc., относится к вставке в геном трансгена, действующего против HIV, способы которой можно применять к системе CRISPR-Cas по настоящему изобретению. В другом варианте осуществления можно целенаправленно воздействовать на ген CXCR4, и систему TALE согласно публикации заявки на патент США №20100291048, закрепленной за Sangamo Biosciences, Inc., можно модифицировать для системы CRISPR-Cas по настоящему изобретению. Способ согласно публикациям заявок на патенты США №№20130137104 и 20130122591, закрепленным за Sangamo Biosciences, Inc., и публикации заявки на патент США №20100146651, закрепленной за Cellectis, может быть в более общем смысле применимым к экспрессии трансгена, поскольку он включает модификацию локуса гена гипоксантингуанинфосфорибозилтрансферазы (HPRT) для повышения частоты модификации гена.

В настоящем изобретении также предусматривается создание клеточной библиотеки нокаутных генов. Каждая клетка может иметь один нокаутный ген. Это проиллюстрировано в примере 23.

Можно получить библиотеку клеток ES, в которой каждая клетка имеет один нокаутный ген, и в полной библиотеке клеток ES все без исключения гены будут нокаутными. Эта библиотека применима для скрининга функций генов в клеточных процессах, а также в заболеваниях. Для получения этой клеточной библиотеки заявители могут интегрировать Cas9, управляемый индуцируемым промотором (например, индуцируемым доксициклином промотором), в клетку ES. Кроме того, можно интегрировать одну направляющую РНК, осуществляющую нацеливание на конкретный ген в клетке ES. Для создания библиотеки клеток ES можно просто смешать клетки ES с библиотекой генов, кодирующих направляющие РНК, которые осуществляют нацеливание на каждый ген в геноме человека. Сначала можно ввести один сайт attB для ВхВ1 в локус AAVS1 в клетках ES человека. Затем можно использовать интегразу ВхВ1 для облегчения интеграции отдельных генов направляющих РНК в сайт attB для ВхВ1 в локусе AAVS1. Для облегчения интеграции каждый ген направляющей РНК можно размещать на плазмиде, которая несет один сайт attP. Таким образом, ВхВ1 будет рекомбинировать сайт attB в геноме с сайтом attP на плазмиде, содержащей направляющую РНК. Для создания клеточной библиотеки можно взять библиотеку клеток, имеющих отдельные интегрированные направляющие РНК, и индуцировать экспрессию Cas9. После индукции Cas9 опосредует двухнитевой разрыв в сайтах, определенных направляющей РНК.

Длительное введение белковых терапевтических средств может вызвать нежелательные иммунные ответы на данный белок. Иммуногенность белковых лекарственных средств может объясняться наличием нескольких иммунодоминантных эпитопов для Т-лимфоцитов-хелперов (HTL). Путем снижения аффинности связывания этих эпитопов для HTL, содержащихся в данных белках, с МНС можно создавать лекарственные средства с более низкой иммуногенностью (Tangri S, et al. ("Rationally engineered therapeutic proteins with reduced immunogenicity" J Immunol. 2005 Mar 15; 174 (6): 3187-96.) В настоящем изобретении иммуногенность фермента CRISPR, в частности, можно снизить, следуя подходу, впервые изложенному Tangri и соавт.в отношении эритропоэтина и впоследствии получившему развитие. Соответственно, для снижения иммуногенности фермента CRISPR (например, Cas9) у вида-хозяина (человека или другого вида) можно применять направленную эволюцию или рациональное проектирование.

В примере 28 заявители применяют 3 направляющие РНК, представляющие интерес, и могут визуализировать эффективное расщепление ДНК in vivo, имеющее место лишь в небольшой субпопуляции клеток. В сущности, здесь заявители показали целенаправленное расщепление in vivo. В частности, это предоставляет подтверждение концепции, заключающейся в том, что у высших организмов, таких как млекопитающие, также можно достичь специфичного целенаправленного воздействия. Это также подчеркивает множественность аспекта в том отношении, что несколько направляющих последовательностей (т.е. воздействующих на отдельные мишени) можно использовать одновременно (в смысле совместной доставки). Другими словами, заявители применяли многосторонний подход с несколькими различными последовательностями, целенаправленно воздействующими в одно и то же время, но независимо.

Подходящий пример протокола получения AAV, предпочтительного вектора согласно настоящему изобретению, приведен в примере 34.

Нарушения, связанные с экспансией тринуклеотидных повторов, являются предпочтительными состояниями для лечения. Они также проиллюстрированы в данном документе.

Например, в публикации заявки на патент США №20110016540 описывается применение нуклеаз с "цинковыми пальцами" для генетической модификации клеток, животных и белков, ассоциированных с нарушениями, связанными с экспансией тринуклеотидных повторов. Нарушения, связанные с экспансией тринуклеотидных повторов, являются комплексными прогрессирующими нарушениями, затрагивающими биологию развития нервной системы и часто нарушающими когнитивные функции, а также сенсомоторные функции.

Белки, связанные с экспансией тринуклеотидных повторов, представляют собой разнородную группу белков, ассоциированных с восприимчивостью к развитию нарушения, связанного с экспансией тринуклеотидных повторов, наличием нарушения, связанного с экспансией тринуклеотидных повторов, тяжестью нарушения, связанного с экспансией тринуклеотидных повторов, или любой их комбинацией. Нарушения, связанные с экспансией тринуклеотидных повторов, подразделяют на две категории, определяемые типом повтора. Наиболее распространенным повтором является триплет CAG, который в случае наличия в кодирующем участке гена кодирует аминокислоту глутамин (Q). Таким образом, эти нарушения называются нарушениями, связанными с экспансией полиглутаминовых повторов (поли-Q), и включают следующие заболевания: болезнь Хантингтона (HD); спинобульбарную мышечную атрофию (SBMA); формы спинально-церебеллярной атаксии (SCA типов 1, 2, 3, 6, 7 и 17) и дентато-рубро-паллидо-льюисову атрофию (DRPLA). Остальные нарушения, связанные с экспансией тринуклеотидных повторов, при которых триплет CAG не вовлечен либо триплет CAG находится не в кодирующем участке гена, называются, таким образом, нарушениями, не связанными с экспансией полиглутаминовых повторов. Нарушения, не связанные с экспансией полиглутаминовых повторов, включают синдром ломкой Х-хромосомы (FRAXA); синдром умственной отсталости, сцепленный с ломкой Х-хромосомой (FRAXE); атаксию Фридрейха (FRDA); миотоническую дистрофию (DM) и формы спинально-церебеллярной атаксии (SCA типов 8 и 12).

Белки, ассоциированные с нарушениями, связанными с экспансией тринуклеотидных повторов, обычно выбирают на основании экспериментального изучения взаимосвязи белка, ассоциированного с нарушением, связанным с экспансией тринуклеотидных повторов, и нарушения, связанного с экспансией тринуклеотидных повторов. Например, скорость образования или концентрация в кровотоке белка, ассоциированного с нарушением, связанным с экспансией тринуклеотидных повторов, может быть повышенной или пониженной в популяции, имеющей нарушение, связанное с экспансией тринуклеотидных повторов, по сравнению с популяцией, не имеющей нарушения, связанного с экспансией тринуклеотидных повторов. Различия по уровням белка можно оценить при помощи протеомных методик, в том числе, без ограничения, вестерн-блоттинга, иммуногистохимического окрашивания, твердофазного иммуноферментного анализа (ELISA) и масс-спектрометрии. В альтернативном случае белки, ассоциированные с нарушениями, связанными с экспансией тринуклеотидных повторов, можно идентифицировать путем получения профилей экспрессии генов для генов, кодирующих белки, при помощи методик геномного анализа, в том числе, без ограничения, микроматричного анализа ДНК, последовательного анализа экспрессии генов (SAGE) и количественной полимеразной цепной реакции в режиме реального времени (Q-PCR).

Неограничивающие примеры белков, ассоциированных с нарушениями, связанными с экспансией тринуклеотидных повторов, включают AR (андрогенный рецептор), FMR1 (белок 1, ассоциированный с умственной отсталостью, сцепленной с ломкой Х-хромосомой), НТТ (хантингтин), DMPK (миотонинпротеинкиназу), FXN (фратаксин), ATXN2 (атаксин 2), ATN1 (атрофии 1), FEN1 (структуроспецифичную флэп-эндонуклеазу 1), TNRC6A (белок, кодируемый геном 6А, содержащим тринуклеотидные повторы), PABPN1 (ядерный поли(А)-связывающий белок 1), JPH3 (юнктофилин 3), MED15 (субъединицу 15 медиаторного комплекса), ATXN1 (атаксин 1), ATXN3 (атаксин 3), ТВР (ТАТА-бокс-связывающий белок), CACNA1A (альфа-1А-субъединицу потенциал-зависимого кальциевого канала P/Q-типа), ATXN80S (белок, синтезируемый с противоположной нити ATXN8 (не кодирующей белок)), PPP2R2B (бета-изоформу регуляторной субъединицы В протеинфосфатазы 2), ATXN7 (атаксин 7), TNRC6B (белок, кодируемый геном 6В, содержащим тринуклеотидные повторы), TNRC6C (белок, кодируемый геном 6С, содержащим тринуклеотидные повторы), CELF3 (CUGBP, представителя 3 семейства Elav-подобных белков), MAB21L1 (mab-21-подобный белок 1 (С. elegans)), MSH2 (гомолог 2 mutS, ассоциированный с неполипозным колоректальным раком типа 1 (Е. coli)), ТМЕМ185А (трансмембранный белок 185A), SIX5 (белок, кодируемый гомеобоксом 5 SIX), CNPY3 (гомолог Canopy 3 (данио-рерио)), FRAXE (белок, ассоциированный с "редким" ломким сайтом, проявляющимся при недостатке фолиевой кислоты, fra(X)(q28) Е), GNB2 (бета-полипептид 2 белка, связывающего гуаниновые нуклеотиды (G-белка)), RPL14 (рибосомный белок L14), ATXN8 (атаксин 8), INSR (инсулиновый рецептор), TTR (транстиретин), ЕР400 (Е1А-связывающий белок р400), GIGYF2 (белок GYF 2, взаимодействующий с GRB10), OGG1 (8-оксогуанин-ДНК-гликозилазу), STC1 (станниокальцин 1), CNDP1 (карнозиндипептидазу 1 (металлопептидазу семейства М20)), C10orf2 (белок, кодируемый открытой рамкой считывания 2 хромосомы 10), MAML3 (mastermind-подобный белок 3 (Drosophila)), DKC1 (белок 1, ассоциированный с врожденным дискератозом, дискерин), PAXIP1 (белок 1, взаимодействующий с PAX (с доменом активации транскрипции)), CasK (кальций/кальмодулин-зависимую сериновую протеинкиназу (семейства MAGUK)), МАРТ (белок tau, ассоциированный с микротрубочками), SP1 (фактор транскрипции Sp1), POLG (полимеразу гамма (ДНК-направленную)), AFF2 (представитель 2 семейства AF4/FMR2), THBS1 (тромбоспондин 1), ТР53 (опухолевый белок р53), ESR1 (эстрогеновый рецептор 1), CGGBP1 (белок 1, связывающий триплетный повтор CGG), АВТ1 (активатор 1 базальной транскрипции), KLK3 (родственную калликреину пептидазу 3), PRNP (белок приона), JUN (онкоген jun), KCNN3 (кальций-активируемый калиевый канал средней/малой проводимости, представитель 3 подсемейства N), ВАХ (BCL2-ассоциированный белок X), FRAXA (белок, ассоциированный с "редким" ломким сайтом, проявляющимся при недостатке фолиевой кислоты, fra(X)(q27.3) А (макроорхидизм, умственная отсталость)), KBTBD10 (белок 10, содержащий повтор Kelch и домен ВТВ (POZ)), MBNL1 (muscleblind-подобный белок (Drosophila)), RAD51 (гомолог RAD51 (гомолог RecA, Е. coli) (S. cerevisiae)), NCOA3 (коактиватор 3 ядерных рецепторов), ERDA1 (белок с экспансией повторяющихся доменов, CAG/CTG 1), TSC1 (белок 1, ассоциированный с туберозным склерозом), СОМР (олигомерный матриксный белок хряща), GCLC (каталитическую субъединицу глутаматцистеинлигазы), RRAD (Ras-родственный белок, ассоциированный с сахарным диабетом), MSH3 (гомолог 3 mutS (E. coli)), DRD2 (дофаминовый рецептор D2), CD44 (молекулу CD44 (система групп крови Indian)), CTCF (СССТС-связывающий фактор (белок с "цинковыми пальцами")), CCND1 (циклин D1), CLSPN (гомолог класпина (Xenopus laevis)), MEF2A (энхансерный фактор 2А миоцитов), PTPRU (протеинтирозинфосфатазу рецепторного типа U), GAPDH (глицеральдегид-3-фосфатдегидрогеназу), TRIM22 (белок 22, содержащий тройной мотив), WT1 (белок 1 опухоли Вильмса), AHR (арил-углеводородный рецептор), GPX1 (глутатионпероксидазу 1), ТРМТ (тиопурин-S-метилтрансферазу), NDP (белок, ассоциированный с болезнью Норри (псевдоглиомой)), ARX (белок, кодируемый гомеобоксом гена, родственного aristaless), MUS81 (гомолог эндонуклеазы MUS81 (S. cerevisiae)), TYR (тирозиназу (глазокожный альбинизм IA)), EGR1 (белок 1 раннего ростового ответа), UNG (урацил-ДНК-гликозилазу), NUMBL (белок, подобный гомологу numb (Drosophila)), FABP2 (белок 2, связывающий жирные кислоты в кишечнике), EN2 (белок, кодируемый гомеобоксом engrailed 2), CRYGC (гамма-С-кристаллин), SRP14 (гомологичный РНК-связывающий белок Alu размером 14 кДа из частицы узнавания сигнала), CRYGB (гамма-В-кристаллин), PDCD1 (белок 1 запрограммированной гибели клеток), НОХА1 (белок, кодируемый гомеобоксом A1), ATXN2L (атаксин-2-подобный белок), PMS2 (PMS2, белок 2, противодействующий повышению уровня постмейотической сегрегации (S. cerevisiae)), GLA (альфа-галактозидазу), CBL (белок, кодируемый последовательностью, трансформирующей с экотропным ретровирусом Cas-Br-М (мышей)), FTH1 (полипептид 1 тяжелой субъединицы ферритина), IL12RB2 (бета-2-субъединицу рецептора интерлейкина 12), ОТХ2 (белок, кодируемый гомеобоксом orthodenticle 2), НОХА5 (белок, кодируемый гомеобоксом А5), POLG2 (вспомогательную гамма-2-субъединицу полимеразы (ДНК-направленной)), DLX2 (белок, кодируемый гомеобоксом distal-less 2), SIRPA (сигнально-регуляторный белок альфа), ОТХ1 (белок, кодируемый гомеобоксом orthodenticle 1), AHRR (репрессор арил-углеводородного рецептора), MANF (мезэнцефальный нейротрофический фактор, происходящий из астроцитов), ТМЕМ158 (трансмембранный белок 158 (ген/псевдоген)) и ENSG00000078687.

Предпочтительные белки, ассоциированные с нарушениями, связанными с экспансией тринуклеотидных повторов, включают НТТ (хантингтин), AR (андрогенный рецептор), FXN (фратаксин), Atxn3 (атаксин), Atxn1 (атаксин), Atxn2 (атаксин), Atxn7 (атаксин), Atxn10 (атаксин), DMPK (миотонинпротеинкиназу), Atn1 (атрофии 1), СВР (creb-связывающий белок), VLDLR (рецептор липопротеинов очень низкой плотности) и их любую комбинацию.

В соответствии с другим аспектом предусматривается способ генной терапии для лечения субъекта, имеющего мутацию в гене CFTR, который включает введение терапевтически эффективного количества частиц с CRISPR-Cas для генной терапии, необязательно посредством биологически совместимого фармацевтического носителя, в клетки субъекта. Целевая ДНК предпочтительно содержит мутацию дельта-F508. Обычно предпочтительно, чтобы у мутантов восстанавливался дикий тип. В этом случае мутация представляет собой делецию трех нуклеотидов, включающих в себя кодон фенилаланина (F), в положении 508. Соответственно, репарация в данном случае требует повторного введения мутанту недостающего кодона.

Для реализации этой стратегии репарации генов предпочтительно, чтобы векторную систему на основе аденовируса/AAV вводили в клетку-хозяина, в клетки или пациенту. Система предпочтительно содержит Cas9 (или никазу Cas9) и направляющую РНК вместе с векторной системой на основе аденовируса/AAV, содержащей матрицу для репарации путем гомологичной рекомбинации, содержащую остаток F508. Ее можно вводить субъекту посредством одного из обсуждаемых ранее способов доставки. Система CRISPR-Cas может направляться химерной направляющей РНК для дельта-508 CFTR. Она целенаправленно воздействует на конкретный сайт локуса генома CFTR, подлежащий внесению однонитевого разрыва или расщеплению. После расщепления матрицу для репарации вставляли в сайт расщепления посредством гомологичной рекомбинации, исправляющей делецию, которая приводит к муковисцидозу или вызывает связанные с муковисцидозом симптомы. Данную стратегию для управления доставкой и обеспечения системного встраивания систем CRISPR с помощью соответствующих направляющих РНК можно использовать для целенаправленного воздействия на генные мутации, чтобы редактировать или проводить иного рода манипуляции с генами, которые вызывают метаболические заболевания и нарушения, заболевания и нарушения печени, почек и заболевания и нарушения, связанные с белками, такие как приведенные в таблице В.

Редактирование генома

Системы CRISPR/Cas9 по настоящему изобретению можно применять для коррекции генетических мутаций, попытки которой с ограниченным успехом ранее предпринимались с применением TALEN и ZFN. Например, в опубликованной заявке Duke University WO 2013163628 А2 "Генетическая коррекция мутантных генов" описаны попытки коррекции, например, мутации по типу сдвига рамки считывания, которая вызывает появление преждевременного стоп-кодона и усечение продукта гена, которую можно скорректировать посредством опосредованного нуклеазами негомологичного соединения концов, как, например, обуславливающей мышечную дистрофию Дюшенна ("DMD"), рецессивное смертельное сцепленное с Х-хромосомой нарушение, приводящее к мышечной дегенерации в связи с мутациями гена дистрофина. Большинство мутаций гена дистрофина, вызывающих DMD, представляют собой делеции экзонов, нарушающие рамку считывания и вызывающие преждевременную терминацию трансляции гена дистрофина. Дистрофии представляет собой цитоплазматический белок, обеспечивающий стабильность структуры дистрогликанового комплекса клеточной мембраны, отвечающего за регуляцию целостности и функционирования мышечных клеток. Ген дистрофина или "ген DMD", как взаимозаменяемо используется в данном документе, образован 2,2 миллиона пар оснований в локусе Хр21. Размер первичного транскрипта составляет приблизительно 2400 т.п.о., при этом размер зрелой мРНК составляет приблизительно 14 т.п.о. 79 экзонов кодируют белок, образованный более 3500 аминокислотами. Экзон 51 часто является смежным с положениями делеций, нарушающих рамку считывания, у пациентов с DMD, и в клинических испытаниях на него был направлен пропуск экзона, основанный на применении олигонуклеотидов. Недавно в клиническом испытании с пропуском экзона 51 с помощью соединения этерлипсена сообщали о значительном положительном функциональном эффекте в течение 48 недель со средним количеством дистрофин-положительных волокон 47% по сравнению с исходным уровнем. Мутации в экзоне 51 идеально подходят для устойчивой коррекции посредством редактирования генома на основе NHEJ.

Способы согласно публикации заявки на патент США №20130145487, закрепленной за Cellectis, которые относятся к вариантам мегануклеаз для расщепления целевой последовательности гена дистрофина человека (DMD), также можно модифицировать для системы CRISPR-Cas по настоящему изобретению.

Кровь

Настоящее изобретение также предусматривает доставку системы CRISPR-Cas в кровь.

Плазменные экзосомы по Wahlgren и соавт.(Nucleic Acids Research, 2012, Vol. 40, No. 17 e130) были описаны ранее и могут быть использованы для доставки системы CRISPR-Cas в кровь.

Система CRISPR-Cas по настоящему изобретению также предусматривается для лечения гемоглобинопатии, таких как формы талассемии и серповидно-клеточная анемия. См., например, международную публикацию заявки на патент WO 2013/126794 в отношении потенциальных мишеней, на которые может целенаправленно воздействовать система CRISPR-Cas по настоящему изобретению.

Публикации заявок на патенты США №№20110225664, 20110091441, 20100229252, 20090271881 и 20090222937, закрепленные за Cellectis, относятся к вариантам CREI, где по меньшей мере один из двух мономеров I-CreI имеет по меньшей мере две замены, по одной в каждом из двух функциональных субдоменов сердцевинного домена LAGLIDADG, расположенных, соответственно, в положениях 26-40 и 44-77 I-CreI, при этом указанный вариант способен расщеплять целевую последовательность ДНК гена гамма-цепи рецептора интерлейкина-2 человека (IL2RG), также называемого геном общей гамма-цепи рецепторов цитокинов или геном гамма-С. Целевые последовательности, указанные в публикациях заявок на патенты США №№20110225664, 20110091441, 20100229252, 20090271881 и 20090222937, можно использовать для системы CRISPR-Cas по настоящему изобретению.

Тяжелый комбинированный иммунодефицит (SCID) возникает в результате нарушения созревания Т-лимфоцитов, во всех случаях ассоциированного с нарушением функционирования В-лимфоцитов (Cavazzana-Calvo et al., Annu. Rev. Med., 2005, 56, 585-602; Fischer et al., Immunol. Rev., 2005, 203, 98-109). Общая заболеваемость по оценкам составляет 1 на 75000 родившихся. Пациенты с нелеченым SCID подвержены множественным инфекциям, вызываемым условно-патогенными микроорганизмами, и живут, как правило, не более одного года. SCID можно лечить путем аллогенного переноса гемопоэтических стволовых клеток от донора-родственника. Степень гистосовместимости с донором может варьировать в широких пределах. В случае аденозиндезаминазной (ADA) недостаточности, одной из форм SCID, пациентов можно лечить с помощью инъекции рекомбинантного фермента аденозиндезаминазы.

Поскольку было показано, что ген ADA у пациентов с SCID является мутантным (Giblett et al., Lancet, 1972, 2, 1067-1069), были идентифицированы некоторые другие гены, вовлеченные в SCID (Cavazzana-Calvo et al., Annu. Rev. Med., 2005, 56, 585-602; Fischer et al., Immunol. Rev., 2005, 203, 98-109). Существуют четыре основные причины SCID. (i) Наиболее часто встречающуюся форму SCID, SCID-X1 (SCID, сцепленный с X-хромосомой, или X-SCID), вызывает мутация в гене IL2RG, которая приводит к отсутствию зрелых Т-лимфоцитов и NK-клеток. IL2RG кодирует белок гамма-С (Noguchi, et al., Cell, 1993, 73, 147-157), общий компонент по меньшей мере пяти рецепторных комплексов интерлейкинов. Данные рецепторы активируют несколько мишеней с помощью киназы JAK3 (Macchi et al., Nature, 1995, 377, 65-68), инактивация которой приводит к возникновению того же синдрома, что и инактивация гамма-С. (ii) Мутация в гене ADA приводит к нарушению метаболизма пуринов, вызывающему гибель предшественников лимфоцитов, что, в свою очередь, приводит к кажущемуся отсутствию В-, Т- и NK-клеток. (iii) V(D)J-рекомбинация является существенным этапом созревания иммуноглобулинов и рецепторов Т-лимфоцитов (TCR). Мутации в генах, активирующих рекомбинацию, 1 и 2 (RAG1 и RAG2) и Artemis, трех генах, участвующих в этом процессе, приводят к отсутствию зрелых Т- и В-лимфоцитов. (iv) Также сообщали о мутациях в других генах, таких как CD45, участвующих в специфичной передаче сигналов в Т-клетках, хотя они представляют меньшинство случаев (Cavazzana-Calvo et al., Annu. Rev. Med., 2005, 56, 585-602; Fischer et al., Immunol. Rev., 2005, 203, 98-109).

С тех пор, как были выявлены их генетические основы, различные формы SCID стали модельными для подходов к генной терапии (Fischer et al., Immunol. Rev., 2005, 203, 98-109) по двум основным причинам. Во-первых, как и при всех заболеваниях крови, может быть предусмотрено лечение ex vivo. Можно выделить гемопоэтические стволовые клетки (HSC) из костного мозга и сохранять их свойства плюрипотентности в течение нескольких клеточных делений. Таким образом, их можно обрабатывать in vitro, а затем повторно инъецировать пациенту, где они повторно заселяют костный мозг. Во-вторых, поскольку созревание лимфоцитов у пациентов с SCID ухудшено, подвергнутые коррекции клетки имеют селективное преимущество. Таким образом, небольшое количество подвергнутых коррекции клеток может восстановить функционирование иммунной системы. Эта гипотеза была неоднократно подтверждена (i) частичным восстановлением иммунных функций, связанным с реверсией мутаций у пациентов с SCID (Hirschhorn et al., Nat. Genet., 1996, 13, 290-295; Stephan et al., N. Engl. J. Med., 1996, 335, 1563-1567; Bousso et al., Proc. Natl., Acad. Sci. USA, 2000, 97, 274-278; Wada et al., Proc. Natl. Acad. Sci. USA, 2001, 98, 8697-8702; Nishikomori et al., Blood, 2004, 103, 4565-4572), (ii) коррекцией форм недостаточности SCID-X1 in vitro в гемопоэтических клетках (Candotti et al., Blood, 1996, 87, 3097-3102; Cavazzana-Calvo et al., Blood, 1996, Blood, 88, 3901-3909; Taylor et al., Blood, 1996, 87, 3103-3107; Hacein-Bey et al., Blood, 1998, 92, 4090-4097), (iii) коррекцией форм недостаточности SCID-X1 (Soudais et al., Blood, 2000, 95, 3071-3077; Tsai et al., Blood, 2002, 100, 72-79), JAK-3 (Bunting et al., Nat. Med., 1998, 4, 58-64; Bunting et al., Hum. Gene Ther., 2000, 11, 2353-2364) и RAG2 (Yates et al., Blood, 2002, 100, 3942-3949) in vivo в животных моделях и (iv) результатом клинических испытаний генной терапии (Cavazzana-Calvo et al., Science, 2000, 288, 669-672; Aiuti et al., Nat. Med., 2002; 8, 423-425; Gaspar et al., Lancet, 2004, 364, 2181-2187).

Публикация заявки на патент США №20110182867, закрепленная за Children’s Medical Center Corporation и президентом и членами управляющего совета Гарвардского университета, относится к способам модулирования экспрессии фетального гемоглобина (HbF) и ее применениям в гемопоэтических клетках-предшественниках с помощью ингибиторов экспрессии или активности BCL11A, таких как средства для RNAi и антитела. На мишени, раскрытые в публикации заявки на патент США №20110182867, такие как BCL11A, можно целенаправленно воздействовать с помощью системы CRISPR-Cas по настоящему изобретению для модулирования экспрессии фетального гемоглобина. См. также Bauer et al. (Science 11 October 2013: Vol. 342 no. 6155 pp. 253-257) и Xu et al. (Science 18 November 2011: Vol. 334 no. 6058 pp. 993-996) в отношении дополнительных мишеней BCL11A.

Подходящие клетки можно идентифицировать путем анализа (например, качественного или количественного) наличия одного или нескольких тканеспецифичных генов. Например, экспрессию гена можно выявить путем выявления белкового продукта одного или нескольких тканеспецифичных генов. Методики выявления белков включают окрашивание белков (например, с использованием клеточных экстрактов или цельных клеток) с помощью антител к соответствующему антигену. В данном случае соответствующий антиген является белковым продуктом экспрессии тканеспецифичного гена. Хотя, в принципе, меченым может быть первое антитело (т.е. антитело, связывающее антиген), более распространенным (и улучшающим визуализацию) является применение второго антитела, направленного против первого (например, антитела к IgG). Данное второе антитело конъюгируют с флуорохромами, или соответствующими ферментами для колориметрических реакций, или гранулами золота (для электронной микроскопии), или с системой биотин-авидин, так что можно определить местоположение первичного антитела и, следовательно, антигена.

В некоторых вариантах осуществления молекулы РНК по настоящему изобретению доставляют в липосомных составах или составах на основе Lipofectin и т.п., и их можно получить с помощью способов, хорошо известных специалистам в данной области. Такие способы описаны, например, в патентах США №№5593972, 5589466 и 5580859, включенных в данный документ посредством ссылки.

Были разработаны системы доставки, специально предназначенные для повышения эффективности и улучшения доставки siRNA в клетки млекопитающих (см., например, Shen et al FEBS Let. 2003, 539: 111-114; Xia et al., Nat. Biotech. 2002, 20: 1006-1010; Reich et al., Mol. Vision. 2003, 9: 210-216; Sorensen et al., J. Mol. Biol. 2003, 327: 761-766; Lewis et al., Nat. Gen. 2002, 32: 107-108 и Simeoni et al., NAR 2003, 31, 11: 2717-2724), и их можно применять в настоящем изобретении. siRNA недавно успешно применяли для ингибирования экспрессии генов у приматов (см., например, Tolentino et al., Retina 24 (4): 660), и их также можно применять в настоящем изобретении.

Почки

Настоящее изобретение также предусматривает доставку системы CRISPR-Cas в почку. Стратегии доставки для индукции поглощения клетками терапевтической нуклеиновой кислоты предусматривают использование физических сил или векторных систем, например, доставку с использованием вирусов, липидов, или комплексов, или наноносителей. Исходя из первоначальных применений, имеющих незначительную возможную клиническую значимость, в случае доставки нуклеиновых кислот в клетки почки при помощи гидродинамической системной инъекции с созданием высокого давления, широкий диапазон вирусных и невирусных носителей для генной терапии уже применяется для целенаправленного воздействия на посттранскрипционные события в различных животных моделях заболевания почек in vivo (Csaba Révész and Péter Hamar (2011). Delivery Methods to Target RNAs in the Kidney, Gene Therapy Applications, Prof. Chunsheng Kang (Ed.), ISBN: 978-953-307-541-9, InTech, доступно на веб-сайте: intecho 1 (1) pen.com/books/gene-therapy-applications/delivery-methods-to-target-rnas-in-the-kidney). Способы доставки в почку обобщены ниже.

Для доставки в печень можно использовать аналогичные способы.

CFTR, хоть и имеет отношение к легким, обеспечивает превосходный пример серьезного моногенного состояния, на которое в данной работе успешно целенаправленно воздействуют с помощью CRISPR. Что касается примера химерной направляющей РНК для CFTR с мутацией дельта-508, см. пример 22, в котором демонстрируется перенос генов или доставка генов системы CRISPR-Cas в дыхательные пути нуждающегося в этом субъекта или пациента, страдающего от муковисцидоза или от связанных с муковисцидозом (CF) симптомов, с использованием частиц аденоассоциированного вируса (AAV). В частности, на примере представлена стратегия репарации для мутации дельта-F508 при муковисцидозе. Этот тип стратегии может применяться у всех организмов. В особенности, что касается CF, подходящие пациенты могут включать следующих: человек, не относящийся к человеку примат, собака, кошка, корова, лошадь и другие домашние животные. В этом случае авторы настоящего изобретения использовали систему CRISPR-Cas, содержащую фермент Cas9, для целенаправленного воздействия на дельта-F508 или другие мутации, индуцирующие CFTR.

Подвергающиеся лечению субъекты в данном случае получали фармацевтически эффективное количество векторной системы на основе AAV в форме аэрозоля на легкое, доставляемое эндобронхиально при непринужденном дыхании. Таким образом, в общем, доставка в форме аэрозоля является предпочтительной для доставки с помощью AAV. Аденовирус или частицу AAV можно использовать для доставки. Подходящие конструкции с генами, каждый из которых функционально связан с одной или несколькими регуляторными последовательностями, можно клонировать в вектор доставки. В этом случае следующие конструкции представлены в качестве примеров: промотор Cbh или EF1a для Cas9, промотор U6 или H1 для химерной направляющей РНК. Предпочтительной схемой является применение химерной направляющей последовательности, целенаправленно воздействующей на CFTR с мутацией дельта-508, матрицы для репарации мутации дельта-Р508 и кодон-оптимизированного фермента Cas9 (предпочтительными Cas9 являются ферменты с нуклеазной или никазной активностью) необязательно с одним или несколькими сигналами или последовательностями ядерной локализации (NLS), например, с двумя (2) NLS. Также предусматриваются конструкции без NLS.

Для идентификации целевого сайта Cas9 авторы настоящего изобретения анализировали локус генома CFTR человека и идентифицировали целевой сайт Cas9. Предпочтительно, как правило и в данном случае CF, РАМ может содержать мотив NGG или NNAGAAW.

Соответственно, в случае CF способ по настоящему изобретению предусматривает манипуляцию с целевой последовательностью в представляющем интерес локусе генома, включающую

доставку не встречающейся в природе или сконструированной композиции, содержащей вирусную векторную систему, содержащую один или несколько вирусных векторов, функционально кодирующих композицию для их экспрессии, где композиция содержит:

не встречающуюся в природе или сконструированную композицию, содержащую векторную систему, содержащую один или несколько векторов, содержащих

I. первый регуляторный элемент, функционально связанный с полинуклеотидной последовательностью химерной РНК (chiRNA) системы CRISPR-CAS, где полинуклеотидная последовательность содержит

(a) направляющую последовательность, способную гибридизироваться с целевой последовательностью, связанной с CF, в подходящей клетке млекопитающего,

(b) парную tracr-последовательность и

(c) tracr-последовательность, и

II. второй регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, содержащий по меньшей мере одну или несколько последовательностей ядерной локализации,

где (a), (b) и (с) расположены в 5'-3' ориентации,

где компоненты I и II находятся в одном и том же или в различных векторах системы,

где при транскрипции парная tracr-последовательность гибридизируется с tracr-последовательностью, а направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью, и

где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с (1) направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, и (2) парной tracr-последовательностью, которая гибридизируется или способна к гибридизации с tracr-последовательностью, Что касается CF, предпочтительные целевые последовательности ДНК содержат CFTR с мутацией дельта-508. Предпочтительный РАМ описан выше. Предпочтительным ферментом CRISPR является любой Cas (описанный в данном документе, но в особенности описанный в примере 22).

Альтернативы CF включают любое наследственное заболевание, и их примеры хорошо известны. Другим предпочтительным способом или применением согласно настоящему изобретению является коррекция дефектов в генах ЕМР2А и ЕМР2В, которые, как было идентифицировано, ассоциированы с болезнью Лафора.

В некоторых вариантах осуществления "направляющая последовательность" может отличаться от "направляющей РНК". Направляющая последовательность может относиться к последовательности, составляющей приблизительно 20 п.о., в пределах направляющей РНК, которая определяет целевой сайт.

В некоторых вариантах осуществления Cas9 представляет собой (или происходит из) SpCas9. В этих вариантах осуществления предпочтительными мутациями являются мутации по любому или всем из положений 10, 762, 840, 854, 863 и/или 986 в SpCas9 или соответствующим положениям в других Cas9 (которые могут быть определены, например, при помощи стандартных инструментов сравнения последовательностей). В частности, любые или все из следующих мутаций являются предпочтительными для SpCas9: D10A, Е762А, Н840А, N854A, N863A и/или D986A; а также предусматривается консервативная замена для любого аминокислотного замещения. То же самое (или консервативные замены по этим мутациям) также является предпочтительным в соответствующих положениях других Cas9. Особенно предпочтительными являются D10 и Н840 в SpCas9. Однако, в других Cas9 остатки, соответствующие D10 и Н840 SpCas9, также являются предпочтительными. Преимущественными являются те, которые обеспечивают никазную активность. Эти мутации можно применять согласно всем аспектам настоящего изобретения, не только для лечения CF.

Schwank и соавт. (Cell Stem Cell, 13: 653-58, 2013) использовали CRISPR/Cas9 для коррекции дефекта, ассоциированного с муковисцидозом, в стволовых клетках человека. Целью исследователей являлся ген ионного канала, рецептора трансмембранной проводимости, связанного с муковисцидозом (CFTR). Делеция в CFTR приводит к неправильной укладке белка у пациентов с муковисцидозом. С использованием культивируемых стволовых клеток кишечника, полученных из образцов клеток от двух детей с муковисцидозом, Schwank и соавт. могли скорректировать дефект с использованием CRISPR вместе с донорной плазмидой, содержащей репаративную последовательность, подлежащую вставке. Исследователи затем вырастили клетки до "органоидов" кишечника или кишок небольшого размера и продемонстрировали, что они нормально функционировали. В этом случае приблизительно половина клональных органоидов подвергалась надлежащей коррекции наследственного материала.

Вирусы гепатита

Настоящее изобретение также можно применять для лечения от вируса гепатита В (HBV). Однако, система CRISPR-Cas должна быть приспособлена для того, чтобы избежать недостатков RNAi, таких как риск перенасыщения эндогенных путей малых РНК, с помощью, например, оптимизации дозы и последовательности (см., например, Grimm et al., Nature vol. 441, 26 May 2006). Например, предусматриваются низкие дозы, такие как приблизительно 1-10×1014 частиц на человека.

В другом варианте осуществления систему CRISPR-Cas, направленную против HBV, можно вводить в липосомах, таких как стабильная частица из нуклеиновой кислоты и липидов (SNALP) (см., например, Morrissey et al., Nature Biotechnology, Vol. 23, No. 8, August 2005). Предусматриваются ежедневные внутривенные инъекции приблизительно 1, 3 или 5 мг/кг/день CRISPR-Cas, целенаправленно воздействующей на РНК HBV, в SNALP. Ежедневное лечение можно осуществлять в течение приблизительно трех дней и затем еженедельно в течение приблизительно пяти недель.

В другом варианте осуществления систему согласно Chen и соавт. (Gene Therapy (2007) 14, 11-19) можно применять в системе CRISPR-Cas согласно настоящему изобретению и/или приспосабливать к ней. Chen и соавт. использовали двухнитевой псевдотипированный вектор на основе аденоассоциированного вируса 8 (dsAAV2/8) для доставки shRNA. Однократное введение вектора dsAAV2/8 (1×1012 векторных геномов на мышь), несущего специфичную к HBV shRNA, эффективно подавляло стабильный уровень белка, мРНК и репликативной ДНК HBV в печени трансгенных мышей с HBV, что приводило к снижению нагрузки HBV в кровотоке на вплоть до 2-3 log10. Значительное подавление HBV продолжалось в течение по меньшей мере 120 дней после введения вектора. Терапевтический эффект shRNA зависел от целевой последовательности и не включал активацию интерферона. В соответствии с настоящим изобретением систему CRISPR-Cas, направленную в отношении HBV, можно клонировать в вектор на основе AAV, например, вектор на основе dsAAV2/8, и вводить человеку, например, в дозе от приблизительно 1×1015 векторных геномов до приблизительно 1×1016 векторных геномов на человека.

В другом варианте осуществления способ согласно Wooddell и соавт.(Molecular Therapy vol. 21 no. 5, 973-985 May 2013) можно применять в системе CRISPR-Cas согласно настоящему изобретению и/или приспосабливать к ней. Woodell и соавт. продемонстрировали, что простая совместная инъекция целенаправленно воздействующего на гепатоциты, конъюгированного с N-ацетилгалактозамином мелиттин-подобного пептида (NAG-MLP) с тропной к печени конъюгированной с холестерином siRNA (chol-siRNA), целенаправленно воздействующей на фактор коагуляции VII (F7), приводит в результате к эффективному нокдауну F7 у мышей и приматов, отличных от человека, без изменений клинических химических показателей или индукции цитокинов. Используя временные и трансгенные мышиные модели инфекции HBV, Wooddell и соавт. продемонстрировали, что однократная совместная инъекция NAG-MLP с активной chol-siRNA, целенаправленно воздействующей на консервативные последовательности HBV, приводила в результате к многократной репрессии вирусной РНК, белков и вирусной ДНК с большой продолжительностью эффекта. Внутривенные совместные инъекции, например, приблизительно 6 мг/кг NAG-MLP и 6 мг/кг специфичной к HBV CRISPR-Cas могут предусматриваться в соответствии с настоящим изобретением. В альтернативном случае приблизительно 3 мг/кг NAG-MLP и 3 мг/кг специфичной к HBV CRISPR-Cas могут доставляться в первый день с последующим введением приблизительно 2-3 мг/кг NAG-MLP и 2-3 мг/кг специфичной к HBV CRISPR-Cas две недели спустя.

Настоящее изобретение также можно применять для лечения от вируса гепатита С (HCV). Способы согласно Roelvinki и соавт.(Molecular Therapy vol. 20 no. 9, 1737-1749 Sep 2012) можно применять по отношению к системе CRISPR-Cas. Например, вектор на основе AAV, такого как AAV8, может быть предполагаемым вектором и может предусматриваться, например, доза от приблизительно 1,25×1011 до 1,25×1013 векторных геномов на килограмм массы тела (vg/кг).

В еще одном варианте осуществления редактирование генома, опосредованное CRISPR-Cas9, можно применять для коррекции и/или фенотипа, связанных с заболеванием. Это редактирование генома, опосредованное CRISPR-Cas9, можно применять для коррекции мутации и/или фенотипа, связанных с заболеванием, в печени и/или гепатоцитах, что проиллюстрировано в рукописи Нао Yin и соавт. под названием "Genome editing with Cas9 in adult mice corrects a disease mutation and phenotype", опубликованной в Nature Biotechnology, опубликованной в режиме онлайн 30 марта 2014 г.; исправленной в режиме онлайн 31 марта 2014 г., доступной на веб-сайте nature.com/doifinder/10.1038/nbt.2884, включенной в данный документ с помощью ссылки во всей своей полноте. Данная статья относится к опосредованной CRISPR-Cas9 коррекции мутации Fah в гепатоцитах в мышиной модели заболевания человека врожденной тирозинемии. Было показано, что доставка компонентов системы CRISPR-Cas9 с помощью гидродинамической инъекции приводила к исходному уровню экспрессии белка Fah дикого типа в ~1/250 клеток печени. Было дополнительно показано, что размножение Fah-положительных гепатоцитов избавляло от фенотипа потери массы тела.

Будет очевидно, что организм-хозяин с другими заболеваниями можно лечить подобным образом. Некоторые примеры наследственных заболеваний, вызванных мутациями, приведены в данном документе, но известно их намного больше. Изложенную выше стратегию можно применять для лечения этих заболеваний.

Нуклеиновые кислоты, аминокислоты и белки

В настоящем изобретении нуклеиновые кислоты используются для связывания целевых последовательностей ДНК. Это является преимущественным, поскольку получать нуклеиновые кислоты намного легче и дешевле, чем белки, и специфичность может варьировать в зависимости от длины фрагмента, если необходима гомология. Например, не требуется сложное 3D-определение положений многочисленных доменов.

Выражения "полинуклеотид", "нуклеотид", "нуклеотидная последовательность", "нуклеиновая кислота" и "олигонуклеотид" используют взаимозаменяемо. Они обозначают полимерную форму нуклеотидов любой длины, как дезоксирибонуклеотидов, так и рибонуклеотидов или их аналогов. Полинуклеотиды могут обладать любой пространственной структурой и могут выполнять любую функцию, известную или неизвестную. Неограничивающими примерами полинуклеотидов являются следующие: кодирующие или некодирующе участки гена или фрагмента гена, локусы (локус), определенные в результате анализа сцепления, экзоны, интроны, матричная РНК (мРНК), транспортная РНК, рибосомная РНК, короткая интерферирующая РНК (siRNA), короткая шпилечная РНК (shRNA), микроРНК (miRNA), рибозимы, кДНК, рекомбинантные полинуклеотиды, разветвленные полинуклеотиды, плазмиды, векторы, выделенные ДНК любой последовательности, выделенные РНК любой последовательности, нуклеиновые кислоты-зонды и праймеры. Выражение также охватывает структуры, подобные нуклеиновым кислотам, с синтетическими остовами, см., например, WO 97/03211; WO 96/39154. Полинуклеотид может содержать один или несколько модифицированных нуклеотидов, как, например, метилированные нуклеотиды и аналоги нуклеотидов. При наличии, модификации в нуклеотидную структуру могут быть внесены до или после сборки полимера. Последовательность нуклеотидов может прерываться отличными от нуклеотидов компонентами. Полинуклеотид можно дополнительно модифицировать после полимеризации, как, например, путем конъюгации с компонентом для мечения.

Используемое в данном документе выражение "дикий тип" является выражением из данной области, понятным специалисту в данной области, и означает типичную форму организма, штамма, гена или характеристики, которые встречаются в природе в отличие от мутантных или вариантных форм.

Используемое в данном документе выражение "вариант" следует понимать как означающее проявление качеств, которые характеризуются паттерном, который отличается от такового, встречающегося в природе.

Выражение "не встречающийся в природе" или "сконструированный" используют взаимозаменяемо, и оно указывает на вмешательство человека. Выражения, в тех случаях, когда они касаются молекул нуклеиновых кислот или полипептидов, означают, что молекула нуклеиновой кислоты или полипептид по меньшей мере практически не содержат по меньшей мере один отличный компонент, с которым они естественным образом связаны в природе и встречаются в природе.

"Комплементарность" означает способность нуклеиновой кислоты образовывать водородную(водородные) связь(связи) с другой последовательностью нуклеиновой кислоты при помощи либо традиционного спаривания оснований по Уотсону-Крику, либо других нетрадиционных типов. Процент комплементарности показывает процентную долю остатков в молекуле нуклеиновой кислоты, которые могут образовывать водородные связи (к примеру, образование пар по Уотсону-Крику) со второй последовательностью нуклеиновой кислоты (к примеру, при этом 5, 6, 7, 8, 9, 10 из 10 будут на 50%, 60%, 70%, 80%, 90% и 100% комплементарны). "Точная комплементарность" означает, что все граничащие остатки последовательности нуклеиновой кислоты будут связаны водородными связями с тем же количеством граничащих остатков во второй последовательности нуклеиновой кислоты. Выражение "практически комплементарный", используемое в данном документе, означает степень комплементарности, которая составляет по меньшей мере 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или 100% в пределах участка из 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50 или более нуклеотидов, или относится к двум нуклеиновым кислотам, которые гибридизируются при жестких условиях.

Используемые в данном документе "жесткие условия" в отношении гибридизации означают условия, при которых нуклеиновая кислота с комплементарностью к целевой последовательности преимущественно гибридизируется с целевой последовательностью и практически не гибридизируется с нецелевыми последовательностями. Жесткие условия, как правило, являются зависимыми от последовательности и изменяются в зависимости от ряда факторов. В общем, чем длиннее последовательность, тем выше температура, при которой последовательность специфично гибридизируется со своей целевой последовательностью. Неограничивающие примеры жестких условий описаны подробно в Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology-Hybridization With Nucleic Acid Probes Part I, Second Chapter "Overview of principles of hybridization and the strategy of nucleic acid probe assay", Elsevier, N.Y. Если предполагается полинуклеотидная последовательность, то также предусматриваются комплементарные или частично комплементарные последовательности. Они предпочтительно способны гибридизироваться с эталонной последовательностью при очень жестких условиях. Как правило, для доведения до максимума скорости гибридизации, выбирают условия гибридизации относительно низкой жесткости: температура на от приблизительно 20 до 25°C ниже температуры точки плавления (Tm). Tm представляет собой температуру, при которой 50% специфичной целевой последовательности гибридизируется с точно комплементарным зондом в растворе при определенной ионной силе и рН. Как правило, если требуется по меньшей мере приблизительно 85% нуклеотидная комплементарность гибридизированных или способных к гибридизации последовательностей, выбирают очень жесткие условия отмывки с температурой на от приблизительно 5 до 15°C ниже, чем Tm. Если требуется по меньшей мере приблизительно 70% нуклеотидная комплементарность гибридизированных или способных к гибридизации последовательностей, выбирают умеренно жесткие условия отмывки с температурой на от приблизительно 15 до 30°C ниже, чем Tm. Высоко пермиссивные (очень низкой жесткости) условия отмывки могут характеризоваться наименьшей температурой на 50°C ниже Tm, что допускает высокий уровень ошибочных совпадений между гибридизированными или способными к гибридизации последовательностями. Специалисты в данной области поймут, что другие физические и химические параметры на стадиях гибридизации и отмывки также можно изменять для того, чтобы повлиять на получаемый в результате выявляемый сигнал гибридизации, исходя из конкретного уровня гомологии между целевой последовательностью и последовательностью зонда. Предпочтительные условия высокой жесткости предусматривают инкубирование в 50% формамиде, 5×SSC и 1% SDS при 42°C или инкубирование в 5×SSC и 1% SDS при 65°C с отмывкой в 0,2×SSC и 0,1% SDS при 65°C.

"Гибридизация" означает реакцию, при которой один или несколько полинуклеотидов реагируют с образованием комплекса, который стабилизируется посредством образования водородных связей между основаниями нуклеотидных остатков. Образование водородных связей может происходить по принципу образования пар по Уотсону-Крику, хугстиновского связывания или любым другим специфичным к последовательности образом. Комплекс может содержать две нити, образующие дуплексную структуру, три или более нитей, образующих многонитевой комплекс, одиночную самогибридизирующуюся нить или любую их комбинацию. Реакция гибридизации может представлять собой стадию в более обширном способе, таком как начальная стадия ПЦР или расщепление полинуклеотида при помощи фермента. Последовательность, способную гибридизироваться с данной последовательностью, называют "комплементарной последовательностью" для данной последовательности.

Используемое в данном документе выражение "локус генома" или "локус" (форма множественного числа локусы) представляет собой конкретное положение гена или последовательности ДНК на хромосоме. "Ген" относится к фрагментам ДНК или РНК, которые кодируют цепь полипептида или РНК, которые играют функциональную роль в организме, и, следовательно, представляют собой молекулярную единицу наследственности в живых организмах. Для цели настоящего изобретения может считаться, что гены содержат участки, которые регулируют образование продукта гена, независимо от того, являются ли регуляторные последовательности смежными с кодирующими и/или транскрибируемыми последовательностями или нет. Соответственно, ген содержит, но без обязательного ограничения, промоторные последовательности, терминаторы, последовательности регуляции трансляции, например, участки связывания рибосомы и участки внутренней посадки рибосомы, энхансеры, сайленсеры, инсуляторы, граничные элементы, точки начала репликации, участки прикрепления к матриксу и регуляторные участки локуса.

Используемое в данном документе выражение "экспрессия локуса генома" или "экспрессия гена" относится к процессу, в ходе которого информация гена используется в синтезе функционального продукта гена. Продукты экспрессии генов часто представляют собой белки, но у генов, не кодирующих белки, например, генов рРНК или генов тРНК, продукт представляет собой функциональную РНК. Процесс экспрессии генов используется всеми известными живыми организмами - эукариотами (в том числе многоклеточными организмами), прокариотами (бактериями и археями) и вирусами - для образования функциональных продуктов, необходимых для выживания. Используемое в данном документе выражение "экспрессия" гена или нуклеиновой кислоты охватывает не только экспрессию генов в клетках, но также транскрипцию и трансляцию нуклеиновой(нуклеиновых) кислоты(кислот) в системах клонирования и в любом другом контексте. Используемое в данном документе выражение "экспрессия" означает процесс, при котором полинуклеотид транскрибируется с ДНК-матрицы (как, например, с образованием мРНК или другого РНК-транскрипта), и/или процесс, при помощи которого транскрибированная мРНК далее транслируется с образованием пептидов, полипептидов или белков. Транскрипты и закодированные полипептиды можно в совокупности называть "продуктом гена". Если полинуклеотид получен из геномной ДНК, то экспрессия может включать сплайсинг мРНК в эукариотической клетке.

Выражения "полипептид", "пептид" и "белок" используют взаимозаменяемо в данном документе для обозначения полимеров из аминокислот любой длины. Полимер может быть линейным или разветвленным, он может содержать модифицированные аминокислоты, и его структура может прерываться отличными от аминокислот компонентами. Выражения также охватывают полимер из аминокислот, который был модифицирован; например, образованием дисульфидных связей, гликозилированием, липидизацией, ацетилированием, фосфорилированием или любой другой манипуляцией, такой как конъюгация с компонентом для мечения. Используемое в данном документе выражение "аминокислота" включает природные и/или неприродные или синтетические аминокислоты, в том числе глицин и как D-, так и L-оптические изомеры, и аналоги аминокислот, и пептидомиметики.

Используемое в данном документе выражение "домен" или "домен белка" относится к части последовательности белка, которая может существовать и функционировать независимо от остальной части белковой цепи.

Как описано в аспектах согласно настоящему изобретению, идентичность последовательности относится к гомологии последовательности. Сравнения гомологии можно проводить на глаз или, что делается чаще, с помощью легко доступных программ для сравнения последовательностей. При помощи этих коммерчески доступных компьютерных программ можно рассчитывать процент (%) гомологии между двумя или более последовательностями и также можно рассчитывать идентичность последовательности между двумя или более аминокислотными последовательностями или последовательностями нуклеиновых кислот. В некоторых предпочтительных вариантах осуществления участок кэпирования dTALE, описанный в данном документе, имеет последовательности, по меньшей мере на 95% идентичные или обладающие идентичностью с участком кэпирования аминокислотных последовательностей, представленных в данном документе.

Значения гомологии последовательности можно получить при помощи любой из ряда компьютерных программ, известных в данной области техники, например, BLAST или FASTA и т.д. Подходящей компьютерной программой для осуществления такого выравнивания является пакет программ GCG Wisconsin Bestfit (Университет Висконсина, США; Devereux et al., 1984, Nucleic Acids Research 12: 387). Примеры другого программного обеспечения, при помощи которого можно осуществлять сравнения последовательностей, включают, без ограничения, пакет программ BLAST (см. Ausubel et al., 1999 ibid - Chapter 18), FASTA (Atschul et al., 1990, J. Mol. Biol., 403-410) и набор инструментов для сравнения GENEWORKS. Как в BLAST, так и в FASTA доступны оффлайн- и онлайн-поиск (см. Ausubel et al., 1999 ibid, pages 7-58 - 7-60). Однако, предпочтительным является использование программы GCG Bestfit.

Процент (%) гомологии последовательности можно рассчитывать для непрерывных последовательностей, т.е. одну последовательность выравнивают с другой последовательностью и каждую аминокислоту или нуклеотид в одной последовательности непосредственно сравнивают с соответствующей аминокислотой или нуклеотидом в другой последовательности, один остаток за один раз. Это называется выравниванием "без гэпов". Как правило, такие выравнивания без гэпов осуществляют только для относительно малого числа остатков.

Несмотря на то что этот способ является очень простым и соответствующим, при его применении не учитывается то, что, например, в паре последовательностей, которые в остальном являются идентичными, одна вставка или делеция может привести к тому, что следующие за ней аминокислотные остатки не будут учитываться при выравнивании, что, таким образом, потенциально приводит в результате к значительному уменьшению % гомологии при осуществлении глобального выравнивания. Следовательно, большинство способов сравнения последовательностей разработаны для получения оптимальных выравниваний, в которых учитываются возможные вставки и делеции без наложения чрезмерного штрафа на общую гомологию или балл идентичности. Это достигается путем вставки "гэпов" в выравнивание последовательностей в попытке доведения до максимума локальной гомологии или идентичности.

Однако в этих более сложных способах назначаются "штрафы за внесения гэпа" для каждого гэпа, который встречается при выравнивании, таким образом, для одинакового количества идентичных аминокислот выравнивание последовательностей с наименьшим количеством гэпов, что отражает высокую степень родства между двумя сравниваемыми последовательностями, может привести в результате к более высокому баллу, чем выравнивание с большим количеством гэпов. Как правило, используют "значения аффинного штрафа за внесение гэпа для родственных последовательностей", с использованием которых начисляют относительно высокое значение за существование гэпа и меньший штраф за каждый последующий остаток в гэпе. Это наиболее часто используемая система оценки гэпов. Высокие штрафы за внесение гэпа, конечно, могут привести к оптимизированным выравниваниям с меньшим количеством гэпов. В большинстве программ выравнивания допускается изменение штрафов за внесение гэпа. Однако предпочтительно использовать значения по умолчанию при использовании такого программного обеспечения для сравнений последовательностей. Например, при использовании пакета программ GCG Wisconsin Bestfit штраф за внесение гэпа по умолчанию для аминокислотной последовательности составляет -12 для гэпа и -4 за каждый остаток его продолжения.

Для расчета максимального % гомологии, следовательно, изначально требуется получение оптимального выравнивания с учетом штрафов за внесение гэпа. Подходящая компьютерная программа для осуществления такого выравнивания представляет собой пакет программ GCG Wisconsin Bestfit (Devereux et al., 1984 Nuc. Acids Research 12 p387). Примеры другого программного обеспечения, при помощи которого можно осуществлять сравнения последовательностей, включают, без ограничения, пакет программ BLAST (см. Ausubel et al., 1999 Short Protocols in Molecular Biology, 4th Ed. - Chapter 18), FASTA (Altschul et al., 1990 J. Mol. Biol. 403-410) и набор инструментов для сравнения GENEWORKS. Как в BLAST, так и в FASTA доступны оффлайн- и онлайн-поиск (см. Ausubel et al., 1999, Short Protocols in Molecular Biology, pages 7-58 - 7-60). Однако для некоторых задач предпочтительно использовать программу GCG Bestfit. Новый инструмент под названием BLAST 2 Sequences также доступен для сравнения белковых и нуклеотидных последовательностей (см. FEMS Microbiol Lett. 1999 174 (2): 247-50; FEMS Microbiol Lett. 1999 177 (1): 187-8 и веб-сайт Национального центра биотехнологической информации на веб-сайте Национального института здравоохранения).

Несмотря на то что конечный % гомологии можно измерять в единицах идентичности, способ выравнивания сам по себе, как правило, не основывается на сравнении пар по типу "все или ничего". Вместо этого, как правило, используется матрица замен со шкалой сходства, с использованием которой назначаются баллы для каждого попарного сравнения на основании химического сходства или эволюционного расстояния. Примером этой матрицы, используемой чаще всего, является матрица BLOSUM62 - матрица по умолчанию для набора программ BLAST. В программах GCG Wisconsin, как правило, используются общедоступные значения по умолчанию или специальные таблицы сравнения символов, если предоставляются (дополнительные подробности см. в руководстве пользователя). Для некоторых задач предпочтительным является применение общедоступных значений по умолчанию для пакета программ GCG или, в случае другого программного обеспечения, матрицы по умолчанию, например, BLOSUM62.

В альтернативном случае процентные значения гомологии можно рассчитывать с использованием функции множественного выравнивания в DNASIS™ (Hitachi Software) с применением алгоритма, аналогичного CLUSTAL (Higgins DG & Sharp РМ (1988), Gene 73 (1), 237-244). После того, как программное обеспечение предоставит оптимальное выравнивание, возможно рассчитать % гомологии, предпочтительно % идентичности последовательности. Программное обеспечение, как правило, осуществляет это в ходе сравнения последовательностей и выдает численный результат.

Последовательности также могут иметь делении, вставки или замены аминокислотных остатков, которые приводят к молчащему изменению и приводят в результате к функционально эквивалентному веществу. Преднамеренные аминокислотные замены могут быть сделаны на основании сходства свойств аминокислот (например, полярности, заряда, растворимости, гидрофобности, гидрофильности и/или амфипатической природы остатков), и, следовательно, они являются применимыми для того, чтобы сгруппировать аминокислоты в функциональные группы. Аминокислоты можно сгруппировать на основании свойств только их боковых цепей. Однако, также более полезно включить данные о мутациях. Группы аминокислот, полученные таким образом, вероятно, будут консервативными по структурным причинам. Эти группы могут быть описаны в форме диаграммы Венна (Livingstone C.D. and Barton G.J. (1993) "Protein sequence alignments: a strategy for the hierarchical analysis of residue conservation" Comput. Appl. Biosci. 9: 745-756) (Taylor W.R. (1986) "The classification of amino acid conservation" J. Theor. Biol. 119; 205-218). Консервативные замены могут быть сделаны, например, в соответствии с таблицей, представленной ниже, в которой описывается общепринятая группировка аминокислот в форме диаграммы Венна.

Варианты осуществления согласно настоящему изобретению охватывают последовательности (как полинуклеотидные, так и полипептидные), которые могут содержать гомологичную замену (используемые в данном документе как замена, так и замещение означают обмен существующего аминокислотного остатка или нуклеотида на альтернативный остаток или нуклеотид), которая может происходить, т.е., в случае аминокислот, замену на аналогичную, например, основной на основную, кислой на кислую, полярной на полярную и т.д. Также может происходить негомологичная замена, т.е. остатка из одного класса на остаток из другого или, в альтернативном случае, связанная с включением аминокислот, отличных от природных, например, орнитина (далее в данном документе называемого Z), орнитиндиаминомасляной кислоты (далее в данном документе называемой В), норлейцинорнитина (далее в данном документе называемого О), пиридилаланина, тиенилаланина, нафтилаланина и фенилглицина.

Вариантные аминокислотные последовательности могут содержать подходящие спейсерные группы, которые могут быть вставлены между любыми двумя аминокислотными остатками последовательности, в том числе алкильные группы, например, метальную, этильную или пропильную группы, в дополнение к аминокислотным спейсерам, таким как глициновые или β-аланиновые остатки. Другая форма вариации, которая включает присутствие одного или нескольких аминокислотных остатков в пептоидной форме, может быть хорошо понятна специалистам в данной области. Для того, чтобы избежать сомнений, "пептоидная форма" используется для обозначения вариантных аминокислотных остатков, где замещающая группа для α-углерода расположена на атоме азота остатка, а не на α-углероде. Способы получения пептидов в пептоидной форме известны из уровня техники, например, Simon RJ et al., PNAS (1992) 89 (20), 9367-9371, и Horwell DC, Trends Biotechnol. (1995) 13 (4), 132-134.

Практическое применение настоящего изобретения предусматривает, если не указано иное, традиционные методики иммунологии, биохимии, химии, молекулярной биологии, микробиологии, клеточной биологии, геномики и технологию рекомбинантной ДНК, которые находятся в пределах квалификации специалиста в данной области. См. Sambrook, Fritsch and Maniatis, MOLECULAR CLONING: A LABORATORY MANUAL, 2nd edition (1989); CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (F.M. Ausubel, et al. eds., (1987)); серия METHODS IN ENZYMOLOGY (Academic Press, Inc.): PCR 2: A PRACTICAL APPROACH (M.J. MacPherson, B.D. Hames and G.R. Taylor eds. (1995)), Harlow and Lane, eds. (1988) ANTIBODIES, A LABORATORY MANUAL и ANIMAL CELL CULTURE (R.I. Freshney, ed. (1987)).

Векторы

В одном аспекте настоящее изобретение предусматривает векторы, которые применяются при конструировании и оптимизации систем CRISPR-Cas.

Как используется в данном документе, "вектор" представляет собой инструмент, который позволяет или облегчает перенос объекта из одной среды в другую. В репликон, такой как плазмида, фаг или космида, может быть встроен другой сегмент ДНК для осуществления, таким образом, репликации встроенного сегмента. Как правило, вектор способен к репликации, если ассоциирован с соответствующими регуляторными элементами. В целом, выражение "вектор" относится к молекуле нуклеиновой кислоты, способной переносить другую нуклеиновую кислоту, с которой она была связана. Векторы включают, без ограничения, молекулы нуклеиновых кислот, которые являются однонитевыми, двухнитевыми или частично двухнитевыми; молекулы нуклеиновых кислот, которые содержат один или несколько свободных концов, не содержат свободных концов (к примеру, кольцевые); молекулы нуклеиновых кислот, которые содержат ДНК, РНК или и ту, и другую; и другие разновидности полинуклеотидов, известных в уровне техники. Одним типом вектора является "плазмида", которая означает кольцевую петлю двухнитевой ДНК, в которую можно встраивать дополнительные сегменты ДНК, как, например, при помощи стандартных технологий молекулярного клонирования. Другим типом вектора является вирусный вектор, где полученные из вируса последовательности ДНК или РНК присутствуют в векторе для упаковки в вирус (к примеру, ретровирусы, ретровирусы с дефектной системой репликации, аденовирусы, аденовирусы с дефектной системой репликации и аденоассоциированные вирусы (AAV)). Вирусные векторы также включают полинуклеотиды, переносимые вирусами для трансфекции клетки-хозяина. Определенные векторы способны к саморегулируемой репликации в клетке-хозяине, в которую они введены (к примеру, бактериальные векторы с бактериальной точкой начала репликации и эписомные векторы для млекопитающих). Другие векторы (к примеру, неэписомные векторы для млекопитающих) интегрируются в геном клетки-хозяина после введения в клетку-хозяина и, таким образом, реплицируются наряду с геномом хозяина. Более того, определенные векторы способны управлять экспрессией генов, с которыми они функционально связаны. Такие векторы в данном документе называют "векторами экспрессии". Общепринятые пригодные в технологиях рекомбинантной ДНК векторы экспрессии часто находятся в форме плазмид.

Рекомбинантные векторы экспрессии могут содержать нуклеиновую кислоту согласно настоящему изобретению в форме, подходящей для экспрессии нуклеиновой кислоты в клетке-хозяине, что означает, что рекомбинантные векторы экспрессии включают один или несколько регуляторных элементов, которые могут быть выбраны с учетом клеток-хозяев, которые предполагается использовать для экспрессии, которые функционально связаны с последовательностью нуклеиновой кислоты, экспрессия которой предполагается. В контексте рекомбинантного вектора экспрессии выражение "функционально связанный" предназначено означать, что представляющая интерес нуклеотидная последовательность связана с регуляторным(регуляторными) элементом(элементами) таким образом, при котором обеспечивается возможность экспрессии нуклеотидной последовательности (к примеру, в in vitro системе транскрипции/трансляции или в клетке-хозяине, когда вектор вводят в клетку-хозяина). Что касается способов рекомбинации и клонирования, следует упомянуть заявку на патент США №10/815730, опубликованную 2 сентября 2004 г. как US 2004-0171156 A1, содержание которой включено в данный документ посредством ссылки во всей полноте.

Аспекты настоящего изобретения относятся к векторам для химерной РНК и Cas9. Бицистронные векторы экспрессии для химерной RNA и Cas9 являются предпочтительными. В общем и конкретно в данном варианте осуществления Cas9 предпочтительно управляется промотором CBh. Химерная РНК предпочтительно может управляться промотором U6. Оптимальным является их сочетание. Химерная направляющая РНК, как правило, состоит из направляющей последовательности (Ns) из 20 п.о., которая может быть соединена с tracr-последовательностью (проходящей от первого "U" в нижней нити к концу транскрипта). В разных указанных положениях tracr-последовательность может быть усечена. Направляющие и tracr-последовательности разделены парной tracr-последовательностью, которая может представлять собой GUUUUAGAGCUA. За ней может следовать показанная последовательность петли GAAA. Обе из них являются предпочтительными примерами. Авторы настоящего изобретения продемонстрировали Cas9-опосредованные вставки/делеции в локусах ЕМХ1 и PVALB человека посредством анализов с помощью SURVEYOR. ChiRNA показаны путем обозначения их "+n", a crRNA относится к гибридной РНК, в которой направляющие и tracr-последовательности экспрессируются в виде раздельных транскриптов. Во всей данной заявке химерная РНК также может называться одиночной направляющей или синтетической направляющей РНК (sgRNA). Петля предпочтительно представляет собой GAAA, но не ограничивается этой последовательностью, или ее длина действительно составляет только 4 п.о. Действительно, предпочтительные петлеобразующие последовательности для использования в "шпилечных" структурах имеют длину четыре нуклеотида и наиболее предпочтительно имеют последовательность GAAA. Однако, можно использовать более короткие или длинные последовательности петли, а также альтернативные последовательности. Последовательности предпочтительно включают нуклеотидный триплет (например, AAA) и дополнительный нуклеотид (например, С или G). Примеры петлеобразующих последовательностей включают СААА и AAAG.

Выражение "регуляторный элемент" предназначено включать промоторы, энхансеры, участки внутренней посадки рибосомы (IRES) и другие контролирующие экспрессию элементы (к примеру, сигналы терминации транскрипции, такие как сигналы полиаденилирования и поли-U-последовательности). Такие регуляторные элементы описаны, например, в Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Регуляторные элементы включают такие, которые управляют конститутивной экспрессией нуклеотидной последовательности во многих типах клеток-хозяев, и такие, которые управляют экспрессией нуклеотидной последовательности только в определенных клетках-хозяевах (к примеру, тканеспецифичные регуляторные последовательности). Тканеспецифичный промотор может управлять экспрессией преимущественно в представляющей интерес целевой ткани, такой как мышца, нейрон, кость, кожа, кровь, конкретных органах (к примеру, печени, поджелудочной железе) или определенных типах клеток (к примеру, лимфоцитах). Регуляторные элементы также могут управлять экспрессией зависимым от времени образом, как, например, зависимым от клеточного цикла или зависимым от стадии развития образом, который может быть или может не быть также тканеспецифичным или специфичным к типу клеток. В некоторых вариантах осуществления вектор содержит один или несколько промоторов для pol III (к примеру, 1, 2, 3, 4, 5 или более промоторов для pol III), один или несколько промоторов для pol II (к примеру, 1, 2, 3, 4, 5 или более промоторов для pol II), один или несколько промоторов для pol I (к примеру, 1, 2, 3, 4, 5 или более промоторов для pol I) или их комбинации. Примеры промоторов для pol III включают, без ограничения, промоторы U6 и H1. Примеры промоторов pol II включают, без ограничения, ретровирусный промотор LTR вируса саркомы Рауса (RSV) (необязательно с энхансером RSV), промотор цитомегаловируса (CMV) (необязательно с энхансером CMV) [см., например, Boshart et al., Cell, 41: 521-530 (1985)], промотор SV40, промотор гена дигидрофолатредуктазы, промотор гена β-актина, промотор гена глицерофосфаткиназы (PGK) и промотор EF1α. Также выражением "регуляторный элемент" охвачены энхансерные элементы, такие как WPRE; энхансеры CMV; сегмент R-U5' в LTR HTLV-I (Mol. Cell. Biol., Vol. 8 (1), p. 466-472, 1988); энхансер SV40 и интронная последовательность между экзонами 2 и 3 Р-глобина кролика (Proc. Natl. Acad. Sci. USA, Vol. 78 (3), p. 1527-31, 1981). Специалистам в данной области будет понятно, что структура вектора экспрессии может зависеть от таких факторов, как выбор клетки-хозяина, подлежащей трансформации, желательный уровень экспрессии и т.п. Вектор можно вводить в клетки-хозяева с получением, таким образом, транскриптов, белков или пептидов, в том числе белков слияния или пептидов, кодируемых нуклеиновыми кислотами, которые описаны в данном документе (к примеру, транскриптов коротких палиндромных повторов, регулярно расположенных группами (CRISPR), белков, ферментов, их мутантных форм, белков слияния на их основе и т.п.). Что касается регуляторных последовательностей, следует упомянуть заявку на патент США №10/491026, содержание которой включено в данный документ посредством ссылки во всей ее полноте. Что касается промоторов, следует упомянуть РСТ-публикацию WO 2011/028929 и заявку на патент США №12/511940, содержание которых включено в данный документ посредством ссылки во всей их полноте.

Векторы могут быть разработаны для экспрессии транскриптов CRISPR (к примеру, транскриптов нуклеиновых кислот, белков или ферментов) в прокариотических или эукариотических клетках. Например, транскрипты CRISPR могут экспрессироваться в клетках бактерий, как, например, Escherichia coli, клетках насекомых (с использованием бакуловирусных векторов экспрессии), клетках дрожжей или клетках млекопитающих. Подходящие клетки-хозяева дополнительно рассматриваются в Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). В качестве альтернативы рекомбинантный вектор экспрессии может транскрибироваться и транслироваться in vitro, например, при помощи регуляторных последовательностей промотора Т7 и полимеразы Т7.

Векторы можно вводить и размножать в прокариоте или прокариотической клетке. В некоторых вариантах осуществления прокариота используют для амплификации копий вектора, который предполагается вводить в эукариотическую клетку, или в качестве промежуточного вектора при получении вектора, который предполагается вводить в эукариотическую клетку (к примеру, путем амплификации плазмиды как части системы упаковки вирусного вектора). В некоторых вариантах осуществления прокариота используют для амплификации копий вектора и экспрессии одной или нескольких нуклеиновых кислот, как, например, для обеспечения источника одного или нескольких белков для доставки в клетку-хозяина или организм-хозяин. Экспрессию белков в прокариотах наиболее часто осуществляют в Escherichia coli с векторами, содержащими конститутивные или индуцируемые промоторы, управляющие экспрессией белков слияния либо белков, не являющихся белками слияния. Векторы слияния добавляют некоторое количество аминокислот к белку, закодированному в них, как, например, к амино-концу рекомбинантного белка. Такие векторы слияния могут служить для одной или нескольких целей, как, например: (i) для повышения экспрессии рекомбинантного белка; (ii) для повышения растворимости рекомбинантного белка и (iii) для содействия очистке рекомбинантного белка путем функционирования в качестве лиганда при аффинной очистке. Часто в векторах слияния для экспрессии сайт протеолитического расщепления вводят в место соединения фрагмента слияния и рекомбинантного белка для облегчения отделения рекомбинантного белка от фрагмента слияния после очистки белка слияния. Такие ферменты и их когнатные распознающие последовательности включают фактор Ха, тромбин и энтерокиназу. Иллюстративные слитые векторы экспрессии включают pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Беверли, Массачусетс) и pRIT5 (Pharmacia, Пискатауэй, Нью-Джерси), в которых глутатион-S-трансфераза (GST), мальтоза-связывающий белок Е или белок А, соответственно, слиты с целевым рекомбинантным белком.

Примеры подходящих индуцируемых не являющихся слитыми векторов экспрессии в Е. coli включают pTrc (Amrann et al., (1988) Gene 69: 301-315) и pET 11d (Studier et al., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).

В некоторых вариантах осуществления вектор является вектором экспрессии для дрожжей. Примеры векторов для экспрессии в дрожжах Saccharomyces cerevisiae включают pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, Сан-Диего, Калифорния) и picZ (InVitrogen Corp, Сан-Диего, Калифорния).

В некоторых вариантах осуществления вектор управляет экспрессией белка в клетках насекомых при помощи бакуловирусных векторов экспрессии. Бакуловирусные векторы, доступные для экспрессии белков в культивируемых клетках насекомых (к примеру, клетках SF9), включают группу рАс (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) и группу pVL (Lucklow and Summers, 1989. Virology 170: 31-39).

В некоторых вариантах осуществления вектор способен управлять экспрессией одной или нескольких последовательностей в клетках млекопитающих при помощи вектора экспрессии для млекопитающих. Примеры векторов экспрессии для млекопитающих включают pCDM8 (Seed, 1987. Nature 329: 840) и рМТ2РС (Kaufman, et al., 1987. EMBO J. 6: 187-195). При использовании клеток млекопитающих функции контроля вектора экспрессии, как правило, обеспечиваются одним или несколькими регуляторными элементами. Например, широко используемые промоторы получают из вируса полиомы, аденовируса 2, цитомегаловируса, вируса обезьян 40 и других, раскрытых в данном документе и известных в уровне техники. Что касается других подходящих систем экспрессии как для прокариотических, так и для эукариотических клеток, см., к примеру, главы 16 и 17 в Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.

В некоторых вариантах осуществления рекомбинантные векторы экспрессии для млекопитающих способны управлять экспрессией нуклеиновой кислоты преимущественно в определенном типе клеток (к примеру, тканеспецифичные регуляторные элементы используют для экспрессии нуклеиновой кислоты). Тканеспецифичные регуляторные элементы известны в уровне техники. Неограничивающие примеры подходящих тканеспецифичных промоторов включают промотор гена альбумина (печеночноспецифический; Pinkert, et al., 1987. Genes Dev. 1: 268-277), специфичные к лимфоидной ткани промоторы (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), в частности, промоторы генов Т-клеточных рецепторов (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) и иммуноглобулинов (Baneiji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), нейрон-специфичные промоторы (к примеру, промотор гена нейрофиламента; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), специфичные к клеткам поджелудочной железы промоторы (Edlund, et al., 1985. Science 230: 912-916) и специфичные к клеткам молочной железы промоторы (к примеру, промотор гена белка молочной сыворотки; патент США №4873316 и публикация европейской заявки №264166). Регулируемые стадией развития промоторы также охвачены, к примеру, промоторы генов hox мыши (Kessel and Grass, 1990. Science 249: 374-379) и промотор гена α-фетопротеина (Campes and Tilghman, 1989. Genes Dev. 3: 537-546). Что касается этих прокариотических и эукариотических векторов, следует упомянуть патент США №6750059, содержание которого включено в данный документ посредством ссылки во всей его полноте. Другие варианты осуществления согласно настоящему изобретению могут относиться к вирусным векторам, которые упоминаются в заявке на патент США №13/092085, содержание которой включено в данный документ посредством ссылки во всей ее полноте. Тканеспецифичные регуляторные элементы известны из уровня техники, и в связи с этим следует упомянуть патент США №7776321, содержание которого включено в данный документ посредством ссылки во всей его полноте.

Регуляторные элементы

В некоторых вариантах осуществления регуляторный элемент является функционально связанным с одним или несколькими элементами системы CRISPR так, чтобы управлять экспрессией одного или нескольких элементов системы CRISPR. В целом, CRISPR (короткие палиндромные повторы, регулярно расположенные группами), также известные как SPIDR (прерываемые спейсерами прямые повторы), составляют семейство локусов ДНК, которые, как правило, специфичны для определенного вида бактерий. Локус CRISPR включает определенный класс чередующихся коротких повторов последовательностей (SSR), которые были обнаружены у Е. coli (Ishino et al., J. Bacterid., 169: 5429-5433 [1987]; и Nakata et al., J. Bacterid., 171: 3553-3556 [1989]), и ассоциированные гены. Подобные чередующиеся SSR были идентифицированы у Haloferax mediterranei, Streptococcus pyogenes, Anabaena и Mycobacterium tuberculosis (см. Groenen et al., Mol. Microbiol., 10: 1057-1065 [1993]; Hoe et al., Emerg. Infect. Dis., 5: 254-263 [1999]; Masepohl et al., Biochim. Biophys. Acta 1307: 26-30 [1996]; и Mojica et al., Mol. Microbiol., 17: 85-93 [1995]). Локусы CRISPR, как правило, отличаются от других SSR по структуре повторов, которые были названы короткими повторами с регулярными интервалами (SRSR) (Janssen et al., OMICS J. Integ. Biol., 6: 23-33 [2002]; и Mojica et al., Mol. Microbiol., 36: 244-246 [2000]). В целом, повторы являются короткими элементами, которые встречаются группами, которые регулярно разделены уникальными вставочными последовательностями с практически постоянной длинной (Mojica et al., [2000], выше). Несмотря на то, что последовательности повторов высоко консервативны между штаммами, некоторое количество чередующихся повторов и последовательностей спейсерных участков, как правило, отличаются от штамма к штамму (van Embden et al., J. Bacterid., 182: 2393-2401 [2000]). Локусы CRISPR были идентифицированы у более чем 40 видов прокариот (см., к примеру, Jansen et al., Mol. Microbiol., 43: 1565-1575 [2002]; и Mojica et al., [2005]), в том числе, без ограничения, Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomonas, Desulfovibrio, Geobacter, Myxococcus, Campylobacter, Wolinella, Acinetobacter, Erwinia, Escherichia, Legionella, Methylococcus, Pasteurella, Photobacterium, Salmonella, Xanthomonas, Yersinia, Treponema и Thermotoga.

В целом, "система CRISPR" означает в совокупности транскрипты и другие элементы, участвующие в экспрессии CRISPR-ассоциированных ("Cas") генов или управлении их активностью, в том числе последовательности, кодирующие ген Cas, tracr-(транс-активируемую CRISPR) последовательность (к примеру, tracrRNA или активную частичную tracrRNA), парную tracr-последовательность (охватывающую "прямой повтор" и tracrRNA-процессированный неполный прямой повтор в контексте эндогенной системы CRISPR), направляющую последовательность (также называемую "спейсером" в контексте эндогенной системы CRISPR) или другие последовательности и транскрипты с локуса CRISPR. В вариантах осуществления согласно настоящему изобретению выражения "направляющая последовательность" и "направляющая РНК" используются взаимозаменяемо. В некоторых вариантах осуществления один или несколько элементов системы CRISPR происходят из системы CRISPR I типа, II типа или III типа. В некоторых вариантах осуществления один или несколько элементов системы CRISPR получены из определенного организма, содержащего эндогенную систему CRISPR, как, например, Streptococcus pyogenes. В целом, система CRISPR характеризуется элементами, которые способствуют образованию комплекса CRISPR в сайте целевой последовательности (также называемом протоспейсером в контексте эндогенной системы CRISPR). В контексте образования комплекса CRISPR "целевая последовательность" означает последовательность, по отношению к которой направляющая последовательность разработана так, чтобы обладать комплементарностью, где гибридизация между целевой последовательностью и направляющей последовательностью способствует образованию комплекса CRISPR. Целевая последовательность может содержать любой полинуклеотид, как, например, ДНК- или РНК-полинуклеотиды. В некоторых вариантах осуществления целевая последовательность расположена в ядре или цитоплазме клетки.

В некоторых вариантах осуществления прямые повторы можно идентифицировать in silico посредством поиска повторяющихся мотивов, которые соответствуют любым или всем из следующих критериев:

1. обнаруживаются в окне размером 2 т.п.о. геномной последовательности, фланкирующей CRISPR типа II;

2. имеют протяженность от 20 до 50 п.о. и

3. расположены с интервалами от 20 до 50 п.о.

В некоторых вариантах осуществления можно использовать 2 из этих критериев, например, 1 и 2, 2 и 3 или 1 и 3. В некоторых вариантах осуществления можно использовать все 3 критерия.

В некоторых вариантах осуществления кандидатные tracrRNA можно впоследствии предсказать с использованием последовательностей, которые соответствуют любым или всем из следующих критериев:

1. гомология последовательности с прямыми повторами (поиск мотивов в Geneious с несовпадениями вплоть до 18 п.о.);

2. наличие предсказанного Rho-независимого терминатора транскрипции по направлению транскрипции и

3. стабильная шпилечная вторичная структура между tracrRNA и прямым повтором.

В некоторых вариантах осуществления можно использовать 2 из этих критериев, например, 1 и 2, 2 и 3 или 1 и 3. В некоторых вариантах осуществления можно использовать все 3 критерия.

В некоторых вариантах осуществления химерные конструкции синтетических направляющих РНК (sgRNA) могут включать по меньшей мере 12 п.о. дуплексной структуры между прямым повтором и tracrRNA.

В предпочтительных вариантах осуществления согласно настоящему изобретению система CRISPR представляет собой систему CRISPR типа II, и фермент Cas представляет собой Cas9, который катализирует расщепление ДНК. Ферментативная активность Cas9, происходящего из Streptococcus pyogenes, или любого близкородственного Cas9 приводит к образованию двухнитевых разрывов в последовательностях целевого сайта, который гибридизируется с 20 нуклеотидами направляющей последовательности и который содержит последовательность мотива, прилегающего к протоспейсеру (РАМ) (примеры включают NGG/NRG или РАМ, который можно определить, как описано в данном документе) после 20 нуклеотидов целевой последовательности. Активность CRISPR посредством Cas9 по отношению к сайт-специфическому распознаванию и расщеплению ДНК определяется направляющей последовательностью, tracr-последовательностью, которая частично гибридизируется с направляющей последовательностью, и последовательностью РАМ. Больше аспектов системы CRISPR описаны в Karginov and Hannon, The CRISPR system: small RNA-guided defence in bacteria and archaea, Mole Cell 2010, January 15; 37 (1): 7.

Локус CRISPR типа II происходит из Streptococcus pyogenes SF370, который содержит кластер из 4 генов Cas9, Cas1, Cas2 и Csn1, а также 2 некодирующих элемента РНК, tracrRNA и характерный массив повторяющихся последовательностей (прямых повторов), чередующихся с короткими фрагментами неповторяющихся последовательностей (спейсерами, приблизительно 30 п.о. каждый). В данной системе целенаправленный двухнитевой разрыв (DSB) целевой ДНК образуется в ходе четырех последовательных стадий (фигура 2А). Во-первых, две некодирующих РНК, массив pre-crRNA и tracrRNA, транскрибируются с локуса CRISPR. Во-вторых, tracrRNA гибридизируется с прямыми повторами pre-crRNA, которая затем процессируется в зрелые crRNA, содержащие индивидуальные спейсерные последовательности. В-третьих, комплекс зрелая crRNA:tracrRNA направляет Cas9 к ДНК-мишени, состоящей из протоспейсера и соответствующего РАМ, посредством образования гетеродуплекса между спейсерным участком crRNA и протоспейсерной ДНК. И наконец, Cas9 опосредует расщепление целевой ДНК выше РАМ с образованием DSB внутри протоспейсера (фигура 2А). На фигуре 2В представлена ядерная локализация кодон-оптимизированной Cas9. Для того, чтобы способствовать точной инициации транскрипции, промотор U6, зависимый от РНК-полимеразы III, выбирали для управления экспрессией tracrRNA (фигура 2С). Подобным образом, конструкцию на основе промотора U6 разработали для экспрессии массива pre-crRNA, состоящей из одного спейсера, фланкированного двумя прямыми повторами (DR, также включены в термин "парные tracr-последовательности"; фигура 2С). Исходный спейсер был сконструирован для нацеливания на целевой сайт размером 33 пары оснований (п.о.) (протоспейсер из 30 п.о., а также последовательность мотива CRISPR (РАМ) из 3 п.о., соответствующую мотиву узнавания NGG у Cas9) в локусе ЕМХ1 человека (фигура 2С), ключевом гене в развитии коры головного мозга.

Как правило, в контексте эндогенной системы CRISPR образование комплекса CRISPR (содержащего направляющую последовательность, которая гибридизируется или способна к гибридизации с целевой последовательностью и образует комплекс с одним или несколькими белками Cas) приводит к расщеплению одной или обеих нитей в целевой последовательности или около нее (к примеру, в пределах 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50 или более пар оснований от нее). Не желая быть связанными теорией, полагают, что tracr-последовательность, которая может содержать всю или часть tracr-последовательности. дикого типа или состоять из нее (к примеру, приблизительно или более чем приблизительно 20, 26, 32, 45, 48, 54, 63, 67, 85 или более нуклеотидов tracr-последовательности дикого типа), может также образовывать часть комплекса CRISPR, как, например, путем гибридизации вдоль по меньшей мере части tracr-последовательности со всей или частью парной tracr-последовательности, которая функционально связана с направляющей последовательностью. В некоторых вариантах осуществления один или несколько векторов, управляющих экспрессией одного или нескольких элементов системы CRISPR, вводят в клетку-хозяина, так что экспрессия элементов системы CRISPR управляет образованием комплекса CRISPR в одном или нескольких целевых сайтах. Например, каждое из фермента Cas, направляющей последовательности, связанной с парной tracr-последовательностью, и tracr-последовательности может быть функционально связано с отдельными регуляторными элементами в отдельных векторах. В качестве альтернативы, два или более элементов, экспрессируемых с одних и тех же или различных регуляторных элементов, можно объединять в одном векторе, при этом один или несколько дополнительных векторов обеспечивают любые компоненты системы CRISPR, не включенные в первый вектор. Элементы системы CRISPR, которые объединены в один вектор, могут быть расположены в любой удобной ориентации, как, например, один элемент, расположенный 5' ("выше") относительно или 3' ("ниже") относительно второго элемента. Кодирующая последовательность одного элемента может быть расположена на той же или противоположной нити кодирующей последовательности второго элемента и направлена в том же или противоположном направлении. В некоторых вариантах осуществления один промотор управляет экспрессией транскрипта, кодирующего фермент CRISPR, и одной или нескольких из направляющей последовательности, парной tracr-последовательности (необязательно функционально связанной с направляющей последовательностью) и tracr-последовательности, встроенных в одну или несколько интронных последовательностей (к примеру, каждая в отдельном интроне, две или более по меньшей мере в одном интроне или все в одном интроне). В некоторых вариантах осуществления фермент CRISPR, направляющая последовательность, парная tracr-последовательность и tracr-последовательность функционально связаны с одним и тем же промотором и экспрессируются с него.

В некоторых вариантах осуществления вектор содержит один или несколько сайтов встраивания, как, например, последовательность узнавания рестрикционной эндонуклеазой (также называемая "сайтом клонирования"). В некоторых вариантах осуществления один или несколько сайтов встраивания (к примеру, приблизительно или более чем приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более сайтов встраивания) расположены выше и/или ниже одного или нескольких элементов последовательности одного или нескольких векторов. В некоторых вариантах осуществления вектор содержит сайт встраивания выше парной tracr-последовательности и необязательно ниже регуляторного элемента, функционально связанного с парной tracr-последовательностью, так что после встраивания направляющей последовательности в сайт встраивания и при экспрессии направляющая последовательность управляет специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью в эукариотической клетке. В некоторых вариантах осуществления вектор содержит два или более сайта встраивания, при этом каждый сайт встраивания расположен между двумя парными tracr-последовательностями с тем, чтобы обеспечить возможность встраивания направляющей последовательности в каждый сайт. В таком расположении две или более направляющие последовательности могут содержать две или более копий одной направляющей последовательности, две или более различных направляющих последовательностей или их комбинации. В тех случаях, когда применяют несколько различных направляющих последовательностей, может быть использована одна экспрессирующая конструкция для целенаправленного воздействия активности CRISPR на несколько различных соответствующих целевых последовательностей в клетке. Например, один вектор может содержать приблизительно или более чем приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 или более направляющих последовательностей. В некоторых вариантах осуществления приблизительно или более чем приблизительно 1,2, 3, 4, 5, 6, 7, 8, 9, 10 или более таких содержащих направляющие последовательности векторов могут быть предусмотрены и необязательно доставлены в клетку.

В некоторых вариантах осуществления вектор содержит регуляторный элемент, функционально связанный с кодирующей фермент последовательностью, кодирующей фермент CRISPR, как, например, белок Cas. Неограничивающие примеры белков Cas включают Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (также известный как Csn1 и Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csxl7, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, их гомологи или их модифицированные варианты. В некоторых вариантах осуществления немодифицированный фермент CRISPR, как, например, Cas9, обладает активностью для расщепления ДНК. В некоторых вариантах осуществления фермент CRISPR управляет расщеплением одной или обеих нитей в определенной точке целевой последовательности, как, например, в пределах целевой последовательности и/или в пределах комплементарной последовательности для целевой последовательности. В некоторых вариантах осуществления фермент CRISPR управляет расщеплением одной или обеих нитей в пределах приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500 или более пар оснований от первого или последнего нуклеотида целевой последовательности. В некоторых вариантах осуществления вектор кодирует фермент CRISPR, который является мутантным по отношению к соответствующему ферменту дикого типа, так что у мутантного фермента CRISPR отсутствует способность расщеплять одну или обе нити целевого полинуклеотида, содержащего целевую последовательность. Например, замена аспартата на аланин (D10A) в каталитическом домене RuvC I Cas9 из S. pyogenes превращает Cas9 из нуклеазы, которая расщепляет обе нити, в никазу (расщепляет одну нить). Другие примеры мутаций, которые делают Cas9 никазой, включают, без ограничения, Н840А, N854A и N863A. В качестве дополнительного примера два или более каталитических доменов Cas9 (RuvC I, RuvC II и RuvC III или домен HNH) можно подвергать мутациям с получением мутантного Cas9, у которого практически полностью отсутствует активность для расщепления ДНК. В некоторых вариантах осуществления мутацию D10A объединяют с одной или несколькими из мутаций Н840А, N854A или N863A с получением фермента Cas9, у которого практически полностью отсутствует активность для расщепления ДНК. В некоторых вариантах осуществления фермент CRISPR рассматривают как такой, у которого практически полностью отсутствует активность для расщепления ДНК, в случаях, когда активность для расщепления ДНК мутантного фермента составляет менее приблизительно 25%, 10%, 5%, 1%, 0,1%, 0,01% или меньше по отношению к его немутантной форме. Если фермент не является SpCas9, мутации можно осуществлять по любому или всем остаткам, соответствующим положениям 10, 762, 840, 854, 863 и/или 986 SpCas9 (которые могут быть определены, например, при помощи стандартных инструментов сравнения последовательностей). В частности, любые или все из следующих мутаций являются предпочтительными для SpCas9: D10A, Е762А, Н840А, N854A, N863A и/или D986A; а также предусматривается консервативная замена для любого аминокислотного замещения. То же самое (или консервативные замены по этим мутациям) также является предпочтительным в соответствующих положениях других Cas9. Особенно предпочтительными являются D10 и Н840 в SpCas9. Однако, в других Cas9 остатки, соответствующие D10 и Н840 SpCas9, также являются предпочтительными.

Замену аспартата на аланин (D10A) в каталитическом домене RuvC I в SpCas9 производили с применением методик генной инженерии для превращения нуклеазы в никазу (SpCas9n) (см., например, Sapranauskas et al., 2011, Nucleic Acids Research, 39: 9275; Gasiunas et al., 2012, Proc. Natl. Acad. Sci. USA, 109: E2579) так, чтобы геномная ДНК с однонитевым разрывом подвергалась высокоточной репарации с участием гомологичной рекомбинации (HDR). Анализ с помощью Surveyor подтвердил, что SpCas9n не создает вставок/делеций в протоспейсере-мишени ЕМХ1. Совместная экспрессия целенаправленно воздействующей на ЕМХ1 химерной crRNA (также содержащей компонент tracrRNA) с SpCas9 приводила к вставкам/делециям в целевом сайте, тогда как совместная экспрессия с SpCas9n не приводила (n=3). Более того, секвенирование 327 ампликонов не обнаружило каких-либо вставок/делеций, индуцированных SpCas9n. Тот же локус выбирали для тестирования опосредованной CRISPR HR при совместной трансфекции клеток НЕК 293FT химерной РНК, целенаправленно воздействующей на ЕМХ1, hSpCas9 или hSpCas9n, а также матрицей для HR для введения пары сайтов рестрикции (HindIII и NheI) возле протоспейсера.

Предпочтительные ортологи описаны в данном документе. Фермент Cas может быть идентифицирован как Cas9, поскольку он может относиться к общему классу ферментов, обладающих гомологией с самой большой нуклеазой с несколькими доменами нуклеаз системы CRISPR типа II. В наиболее предпочтительном случае фермент Cas9 получен или происходит из SpCas9 или SaCas9. Под происходящим заявители подразумевают, что в основе происходящего фермента главным образом лежит фермент дикого типа в том смысле, что он характеризуется высокой степенью гомологии последовательности с этим ферментом, но он был некоторым образом подвергнут мутации (модифицирован), как описано в данном документе.

Следует иметь в виду, что выражения Cas и фермент CRISPR обычно используются в данном документе взаимозаменяемо, если не очевидно иное. Как упоминается выше, большинство нумераций остатков, используемых в данном документе, относятся к ферменту Cas9 из локуса CRISPR типа II Streptococcus pyogenes. Однако, следует иметь в виду, что настоящее изобретение включает многие другие Cas9 из других видов микроорганизмов, такие как SpCas9, SaCa9, St1Cas9 и т.д.

Оптимизация кодонов

Пример кодон-оптимизированной последовательности, в данном случае оптимизированной для человека (т.е. оптимизированной для экспрессии у человека), представлен в данном документе, см. кодон-оптимизированную последовательность SaCas9 для человека. Хотя это является предпочтительным, следует иметь в виду, что возможны другие примеры и что для вида-хозяина известна оптимизация кодонов.

В некоторых вариантах осуществления кодирующая фермент последовательность, кодирующая фермент CRISPR, является кодон-оптимизированной для экспрессии в определенных клетках, как, например, эукариотических клетках. Эукариотические клетки могут быть клетками определенного организма или полученными из него, как, например, млекопитающего, в том числе, без ограничения, человека, мыши, крысы, кролика, собаки или отличного от человека млекопитающего или примата. В некоторых вариантах осуществления могут не допускаться способы модификации генетической идентичности зародышевой линии человека и/или способы модификации генетической идентичности животных, которые, вероятно, могут причинить им страдания без какой-либо значительной медицинской пользы для человека или животных, а также животные, являющиеся результатом таких способов.

В целом, оптимизация кодонов означает способ модификации последовательности нуклеиновой кислоты для повышения экспрессии в представляющих интерес клетках-хозяевах путем замещения по меньшей мере одного кодона (к примеру, приблизительно или более чем приблизительно 1, 2, 3, 4, 5, 10, 15, 20, 25, 50 или более кодонов) нативной последовательности кодонами, которые чаще или наиболее часто используют в генах этой клетки-хозяина, с сохранением в то же время нативной аминокислотной последовательности. Разные виды проявляют определенное "предпочтение" в отношении конкретных кодонов определенной аминокислоты. "Предпочтение" кодонов (различия в частоте использования кодонов между организмами) часто соотносят с эффективностью трансляции матричной РНК (мРНК), которая, в свою очередь, как полагают, зависит, среди прочего, от свойств кодонов, которые транслируются, и доступности конкретных молекул транспортной РНК (тРНК). Преобладание выбранных тРНК в клетке, как правило, является отражением кодонов, используемых наиболее часто при синтезе пептидов. Соответственно, гены могут быть приспособлены для оптимальной экспрессии генов в данном организме с использованием оптимизации кодонов. Таблицы частоты использования кодонов общедоступны, например, в "Базе данных частот использования кодонов", доступной в интернете по адресу www.kazusa.orjp/codon/ (просмотрена 9 июля 2002 г.), и эти таблицы можно адаптировать различными способами. См. Nakamura, Y., et al. "Codon usage tabulated from the international DNA sequence databases: status for the year 2000" Nucl. Acids Res. 28: 292 (2000). Также доступны компьютерные алгоритмы для оптимизации кодонов определенной последовательности для экспрессии в определенной клетке-хозяине, как, например, Gene Forge (Aptagen; Джакобус, Пенсильвания). В некоторых вариантах осуществления один или несколько кодонов (к примеру, 1, 2, 3, 4, 5, 10, 15, 20, 25, 50 или более или все кодоны) в последовательности, кодирующей фермент CRISPR, соответствуют наиболее часто используемому кодону для определенной аминокислоты.

Последовательности ядерной локализации (NLS)

В некоторых вариантах осуществления вектор кодирует фермент CRISPR, содержащий одну или несколько последовательностей ядерной локализации (NLS), как, например, приблизительно или более чем приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более NLS. В некоторых вариантах осуществления фермент CRISPR содержит приблизительно или более чем приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более NLS на амино-конце или рядом с ним, приблизительно или более чем приблизительно 1, 2, 3, 4, 5, 6, 7, 8,9, 10 или более NLS на карбокси-конце или рядом с ним или комбинацию этого (к примеру, одну или несколько NLS на амино-конце и одну или несколько NLS на карбокси-конце). В тех случаях, когда присутствуют несколько NLS, каждая может быть выбрана независимо от других, так что одна NLS может присутствовать в нескольких копиях и/или в комбинации с одной или несколькими другими NLS, присутствующими в одной или нескольких копиях. В предпочтительном варианте осуществления настоящего изобретения фермент CRISPR содержит самое большее 6 NLS. В некоторых вариантах осуществления считают, что NLS находится рядом с N- или С-концом в тех случаях, когда самая близкая аминокислота NLS находится в пределах приблизительно 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50 или более аминокислот вдоль полипептидной цепи от N- или С-конца. Неограничивающие примеры NLS включают NLS-последовательности, полученные из: NLS из большого Т-антигена вируса SV40 с аминокислотной последовательностью PKKKRKV; NLS из нуклеоплазмина (к примеру, двойная NLS из нуклеоплазмина с последовательностью KRPAATKKAGQAKKKK); NLS из с-тус с аминокислотной последовательностью PAAKRVKLD или RQRRNELKRSP; NLS из hRNPA1 М9 с последовательностью NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY; последовательность RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV домена IBB из импортина-альфа; последовательности VSRKRPRP и PPKKARED из Т-белка миомы; последовательность POPKKKPL из р53 человека; последовательность SALIKKKKKMAP из c-abl IV мыши; последовательности DRLRR и PKQKKRK из NS1 вируса гриппа; последовательность RKLKKKIKKL из дельта-антигена вируса гепатита; последовательность REKKKFLKRR из белка M×1 мыши; последовательность KRKGDEVDGVDEVAKKKSKK из поли(АДФ-рибоза)-полимеразы человека и последовательность RKCLQAGMNLEARKTKK из рецепторов стероидных гормонов глюкокортикоидов (человека).

В целом, одна или несколько NLS являются достаточно эффективными, чтобы управлять накоплением фермента CRISPR в обнаруживаемом количестве в ядре эукариотической клетки. В целом, степень проявления активности ядерной локализации может быть обусловлена количеством NLS в ферменте CRISPR, конкретной(конкретными) используемой(используемыми) NLS или комбинацией этих факторов. Обнаружение накопления в ядре можно выполнять при помощи любой подходящей методики. Например, детектируемый маркер может быть слит с ферментом CRISPR, так что расположение в клетке может быть визуализировано, как, например, в комбинации со средствами для обнаружения расположения ядра (к примеру, окрашивающим средством, специфичным к ядру, таким как DAPI). Ядра клеток также можно выделять из клеток, содержимое которых можно затем анализировать при помощи любого подходящего способа для обнаружения белка, как, например, иммуногистохимии, вестерн-блоттинга или анализа на активность фермента. Накопление в ядре также можно определить опосредованно, как, например, при помощи анализа эффекта образования комплекса CRISPR (к примеру, анализа на расщепление ДНК или мутацию в целевой последовательности или анализа на измененную под воздействием образования комплекса CRISPR и/или активности фермента CRISPR активность экспрессии генов) по сравнению с контролем, который не подвергали воздействию фермента или комплекса CRISPR или подвергали воздействию фермента CRISPR, у которого отсутствуют одна или несколько NLS.

Направляющая последовательность

Особенно предпочтительные направляющие последовательности имеют длину в диапазоне 20-22 нт, что обсуждается в данном документе; см. пример 41.

В целом, направляющая последовательность представляет собой любую полинуклеотидную последовательность, обладающую достаточной комплементарностью с целевой полинуклеотидной последовательностью для гибридизации с целевой последовательностью и управления специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью. В некоторых вариантах осуществления степень комплементарности между направляющей последовательностью и ее соответствующей целевой последовательностью при оптимальном выравнивании с использованием подходящего алгоритма выравнивания составляет приблизительно или более чем приблизительно 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97,5%, 99% или более. Оптимальное выравнивание можно определять при помощи любого подходящего алгоритма для выравниваемых последовательностей, неограничивающие примеры которого включают алгоритм Смита-Ватермана, алгоритм Нидлмана-Вунша, алгоритмы, основанные на преобразовании Барроуза-Уилера (к примеру, Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; доступный на www.novocraft.com), ELAND (Illumina, Сан-Диего, Калифорния), SOAP (доступный на soap.genomics.org.cn) и Maq (доступный на maq.sourceforge.net). В некоторых вариантах осуществления направляющая последовательность имеет длину приблизительно или более чем приблизительно 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75 или более нуклеотидов. В некоторых вариантах осуществления направляющая последовательность имеет длину менее чем приблизительно 75, 50, 45, 40, 35, 30, 25, 20, 15, 12 или менее нуклеотидов. Способность направляющей последовательности управлять специфичным к последовательности связыванием комплекса CRISPR с целевой последовательностью можно оценить при помощи любого подходящего анализа. Например, компоненты системы CRISPR, достаточные для образования комплекса CRISPR, в том числе направляющая последовательность, которую необходимо тестировать, могут быть доставлены в клетку-хозяина с соответствующей целевой последовательностью, как, например, при помощи трансфекции векторами, кодирующими компоненты последовательности CRISPR, с последующей оценкой предпочтительного расщепления в пределах целевой последовательности, как, например, при помощи анализа с помощью Surveyor, который описан в данном документе. Подобным образом, расщепление целевой полинуклеотидной последовательности может быть установлено в пробирке путем обеспечения целевой последовательности, компонентов комплекса CRISPR, в том числе направляющей последовательности, которую необходимо исследовать, и контрольной направляющей последовательности, отличной от тестовой направляющей последовательности, и сравнения воздействий тестовой и контрольной направляющей последовательности на связывание или скорость расщепления целевой последовательности. Другие анализы возможны и будут очевидны специалисту в данной области.

Направляющая последовательность может быть выбрана для нацеливания на любую целевую последовательность. В некоторых вариантах осуществления целевая последовательность является последовательностью в пределах генома клетки. Иллюстративные целевые последовательности включают те, которые являются уникальными в целевом геноме. Например, для Cas9 S. pyogenes уникальная целевая последовательность в геноме может включать целевой сайт для Cas9 в виде MMMMMMMMNNNNNNNNNNNNXGG, где NNNNNNNNNNNNXGG (N представляет собой A, G, Т или С; и X может быть любым) характеризуется единичным появлением в геноме. Уникальная целевая последовательность в геноме может включать целевой сайт для Cas9 S. pyogenes в виде MMMMMMMMMNNNNNNNNNNNXGG, где NNNNNNNNNNNXGG (N представляет собой A, G, Т или С; и X может быть любым) характеризуется единичным появлением в геноме. Для Cas9 CRISPR1 S. thermophilus уникальная целевая последовательность в геноме может включать целевой сайт для Cas9 в виде MMMMMMMMNNNNNNNNNNNNXXAGAAW, где NNNNNNNNNNNNXXAGAAW (N представляет собой A, G, Т или С; X может быть любым; и W представляет собой А или Т) характеризуется единичным появлением в геноме. Уникальная целевая последовательность в геноме может включать целевой сайт для Cas9 CRISPR1 S. thermophilus в виде MMMMMMMMMNNNNNNNNNNNXXAGAAW, где NNNNNNNNNNNXXAGAAW (N представляет собой A, G, Т или С; X может быть любым; и W представляет собой А или Т) характеризуется единичным появлением в геноме. Для Cas9 S. pyogenes уникальная целевая последовательность в геноме может включать целевой сайт для Cas9 в виде MMMMMMMMNNNNNNNNNNNNXGGXG где NNNNNNNNNNNNXGGXG (N представляет собой A, G, Т или С; и X может быть любым) характеризуется единичным появлением в геноме. Уникальная целевая последовательность в геноме может включать целевой сайт для Cas9 S. pyogenes в виде MMMMMMMMMNNNNNNNNNNNXGGXG, где NNNNNNNNNNNXGGXG (N представляет собой A, G, Т или С; и X может быть любым) характеризуется единичным появлением в геноме. В каждой из этих последовательностей "М" может представлять собой A, G, Т или С и не должен учитываться при идентификации последовательности как уникальной.

В некоторых вариантах осуществления направляющая последовательность выбрана для снижения доли вторичной структуры в направляющей последовательности. В некоторых вариантах осуществления приблизительно или менее приблизительно 75%, 50%), 40%, 30%), 25%, 20%, 15%, 10%, 5%, 1% или меньше нуклеотидов направляющей последовательности участвуют в самокомплементарном спаривании оснований при оптимальном сворачивании. Оптимальное сворачивание можно определить при помощи любого подходящего алгоритма сворачивания полинуклеотида. Некоторые программы основаны на вычислении минимальной свободной энергии Гиббса. Примером одного такого алгоритма является mFold, который описан Zuker и Stiegler (Nucleic Acids Res. 9 (1981), 133-148). Другим примером алгоритма сворачивания является доступный в режиме онлайн веб-сервер RNAfold, разработанный в Институте теоретической химии при Венском университете, использующий алгоритм прогнозирования структуры на основе центроидного метода (см., к примеру, A.R. Gruber et al., 2008, Cell 106 (1): 23-24; и PA Carr and GM Church, 2009, Nature Biotechnology 27 (12): 1151-62).

Парная tracr-последовательность

В общем, парная tracr-последовательность включает любую последовательность, которая характеризуется достаточной комплементарностью с tracr-последовательностью для содействия одному или нескольким из следующих: (1) вырезанию направляющей последовательности, фланкированной парными tracr-последовательностями, в клетке, содержащей соответствующую tracr-последовательность; и (2) образованию комплекса CRISPR в целевой последовательности, где комплекс CRISPR содержит парную tracr-последовательность, которая гибридизируется или способна к гибридизации с tracr-последовательностью. В общем, степень комплементарности указана на основании оптимального выравнивания парной tracr-последовательности и tracr-последовательности по длине более короткой из двух последовательностей. Оптимальное выравнивание можно определить при помощи любого подходящего алгоритма выравнивания и можно дополнительно высчитать для вторичных структур, как, например, самокомплементарность в пределах либо tracr-последовательности, либо парной tracr-последовательности. В некоторых вариантах осуществления степень комплементарности между tracr-последовательностью и парной tracr-последовательностью по длине более короткой из двух при оптимальном выравнивании составляет приблизительно или более чем приблизительно 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97,5%, 99% или более. В некоторых вариантах осуществления tracr-последовательность составляет приблизительно или более чем приблизительно 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50 или более нуклеотидов в длину. В некоторых вариантах осуществления tracr-последовательность и парная tracr-последовательность содержатся в одном транскрипте, так что гибридизация между ними двумя дает транскрипт со вторичной структурой, такой как "шпилька". В одном варианте осуществления настоящего изобретения транскрипт или транскрибированная полинуклеотидная последовательность характеризуются по меньшей мере двумя или более "шпильками". В предпочтительных вариантах осуществления транскрипт характеризуется двумя, тремя, четырьмя или пятью "шпильками". В дополнительном варианте осуществления настоящего изобретения транскрипт характеризуется самое большее пятью "шпильками". В "шпилечной" структуре часть последовательности в 5' направлении по отношению к концевому "N" и выше петли соответствует парной tracr-последовательности, а часть последовательности в 3' направлении по отношению к петле соответствует tracr-последовательности. Дополнительными неограничивающими примерами отдельных полинуклеотидов, содержащих направляющую последовательность, парную tracr-последовательность и tracr-последовательность, являются следующие (перечисленные от 5' к 3'), где "N" представляет собой основание направляющей последовательности, первый блок букв нижнего регистра представляет собой парную tracr-последовательность, а второй блок букв нижнего регистра представляет собой tracr-последовательность, и конечная поли-Т-последовательность представляет собой терминатор транскрипции: (1) . В некоторых вариантах осуществления последовательности (1)-(3) используют в комбинации с Cas9 из CRISPR1 S. thermophilics. В некоторых вариантах осуществления последовательности (4)-(6) используют в комбинации с Cas9 из S. pyogenes. В некоторых вариантах осуществления tracr-последовательность является транскриптом, отдельным от транскрипта, содержащего парную tracr-последовательность.

Матрица для рекомбинации

В некоторых вариантах осуществления также предусмотрена матрица для рекомбинации. Матрица для рекомбинации может быть компонентом другого вектора, который описан в данном документе, может содержаться в отдельном векторе или предусматриваться в качестве отдельного полинуклеотида. В некоторых вариантах осуществления матрица для рекомбинации разработана так, чтобы служить в качестве матрицы при гомологичной рекомбинации, как, например, в пределах целевой последовательности, подвергнутой внесению однонитевого разрыва или расщеплению ферментом CRISPR, или рядом с ней в качестве части комплекса CRISPR. Матричный полинуклеотид может быть любой подходящей длины, как, например, иметь длину приблизительно или более чем приблизительно 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000 или более нуклеотидов. В некоторых вариантах осуществления матричный полинуклеотид комплементарен части полинуклеотида, содержащего целевую последовательность. При оптимальном выравнивании матричный полинуклеотид может перекрываться с одним или несколькими нуклеотидами целевых последовательностей (к примеру, с приблизительно или более чем приблизительно 1, 5, 10, 15, 20 или более нуклеотидами). В некоторых вариантах осуществления при оптимальном выравнивании матричной последовательности и полинуклеотида, содержащего целевую последовательность, наиболее близкий нуклеотид матричного полинуклеотида находится в пределах приблизительно 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000 или более нуклеотидов от целевой последовательности. В данном документе представлено дополнительное обсуждение пути HDR; например, применительно к ‘комплексам CRISPR’.

Белок слияния

В некоторых вариантах осуществления фермент CRISPR является частью белка слияния, содержащего один или несколько доменов гетерологичного белка (к примеру, приблизительно или более чем приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более доменов в дополнение к ферменту CRISPR). Белок слияния, содержащий фермент CRISPR, может содержать любую дополнительную последовательность белка и необязательно линкерную последовательность между любыми двумя доменами. Примеры белковых доменов, которые могут быть слиты с ферментом CRISPR, включают, без ограничения, эпитопные метки, последовательности генов-репортеров и белковые домены с одним или несколькими из следующих видов активности: метилазной активности, деметилазной активности, активности для активации транскрипции, активности для репрессии транскрипции, активности фактора освобождения при транскрипции, активности для модификации гистонов, активности для расщепления ДНК и активности для связывания нуклеиновой кислоты. Неограничивающие примеры эпитопных меток включают гистидиновые (His) метки, V5-метки, FLAG-метки, метки из гемагглютинина вируса гриппа (НА), Myc-метки, VSV-G-метки и тиоредоксиновые (Trx) метки. Примеры генов-репортеров включают, без ограничения, гены глутатион-S-трансферазы (GST), пероксидазы хрена (HRP), хлорамфениколацетилтрансферазы (CAT), бета-галактозидазы, бета-глюкуронидазы, люциферазы, зеленого флуоресцентного белка (GFP), HcRed, DsRed, голубого флуоресцентного белка (CFP), желтого флуоресцентного белка (YFP) и автофлуоресцирующих белков, в том числе синего флуоресцентного белка (BFP). Фермент CRISPR может быть слит с последовательностью гена, кодирующей белок или фрагмент белка, которые связываются с молекулой ДНК или связываются с другими клеточными молекулами, в том числе, без ограничения, связывающий мальтозу белок (МВР), S-метку, продукты слияния Lex А и ДНК-связывающего домена (DBD), продукты слияния GAL4 и ДНК-связывающего домена и продукты слияния белка BP16 вируса простого герпеса (HSV). Дополнительные домены, которые могут образовывать часть белка слияния, содержащего фермент CRISPR, описаны в US 20110059502, включенном в данный документ при помощи ссылки. В некоторых вариантах осуществления меченный фермент CRISPR используют для идентификации расположения целевой последовательности.

Индуцируемая система

В некоторых вариантах осуществления фермент CRISPR может образовывать компонент индуцируемой системы. Индуцируемая природа системы будет обеспечивать возможность пространственно-временного контроля редактирования генов или экспрессии генов с использованием определенной формы энергии. Форма энергии может включать, без ограничения, электромагнитное излучение, звуковую энергию, химическую энергию и тепловую энергию. Примеры индуцируемой системы включают индуцируемые тетрациклином промоторы (Tet-On или Tet-Off), двугибридные системы активации транскрипции с использованием малых молекул (FKBP, ABA и т.д.) или индуцируемые светом системы (фитохром, домены LOV или криптохром). В одном варианте осуществления фермент CRISPR может быть частью индуцируемого светом транскрипционного эффектора (LITE) для управления изменениями транскрипционной активности специфичным к последовательности образом. Компоненты индуцируемой светом системы могут включать фермент CRISPR, чувствительный к свету гетеродимер цитохрома (например, из Arabidopsis thaliana) и домен активации/репрессии транскрипции. Дополнительные примеры индуцируемых ДНК-связывающих белков и способы их применения представлены в US 61/736465 и US 61/721283, которые включены в данный документ посредством ссылки во всей полноте.

Доставка

В некоторых аспектах настоящее изобретение предусматривает способы, включающие доставку одного или нескольких полинуклеотидов, как, например, одного или нескольких векторов, которые описаны в данном документе, одного или нескольких их транскриптов и/или одного или нескольких белков, транскрибируемых с них, в клетку-хозяина. В некоторых аспектах настоящее изобретение дополнительно предусматривает клетки, полученные при помощи таких способов, и животных, содержащих такие клетки или полученных из них. В некоторых вариантах осуществления фермент CRISPR в комбинации с (и необязательно образующий комплекс с) направляющей последовательностью доставляют в клетку. Традиционные способы переноса генов с использованием вирусов и без использования вирусов можно применять для введения нуклеиновых кислот в клетки млекопитающих или целевые ткани. Такие способы можно использовать для введения нуклеиновых кислот, кодирующих компоненты системы CRISPR, в клетки в культуре или в организме-хозяине. Системы доставки на основе невирусных векторов включают плазмидные ДНК, РНК (к примеру, транскрипт вектора, описанного в данном документе), "оголенную" нуклеиновую кислоту и нуклеиновую кислоту, образующую комплекс со средством доставки, как, например, липосомой. Системы доставки на основе вирусного вектора включают ДНК- и РНК-содержащие вирусы, которые имеют либо эписомальный, либо интегрированный геномы после доставки в клетку. В отношении обзора процедур генной терапии см. Anderson, Science 256: 808-813 (1992); Nabel & Feigner, TIBTECH 11: 211-217 (1993); Mitani & Caskey, TIBTECH 11: 162-166 (1993); Dillon, TIBTECH 11: 167-175 (1993); Miller, Nature 357: 455-460 (1992); Van Brunt, Biotechnology 6 (10): 1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8: 35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51 (1): 31-44 (1995); Haddada et al., в Current Topics in Microbiology and Immunology, Doerfler and (eds) (1995); и Yu et al., Gene Therapy 1: 13-26 (1994).

Способы невирусной доставки нуклеиновых кислот включают липофекцию, нуклеофекцию, микроинъекцию, баллистическую трансфекцию, виросомы, липосомы, иммунолипосомы, поликатион или конъюгаты липид: нуклеиновая кислота, "оголенную" ДНК, искусственные вирионы и повышенное при помощи определенного средства поглощение ДНК. Липофекция описана, например, в патентах США №№5049386, 4946787 и 4897355), и реагенты для липофекции продают в промышленных масштабах (к примеру, Transfectam™ и Lipofectin™). Катионные и нейтральные липиды, которые подходят для эффективной липофекции с узнаванием рецепторов полинуклеотидов, включают таковые из Feigner, WO 91/17424; WO 91/16024. Доставка может осуществляться в клетки (к примеру, введение in vitro или ex vivo) или целевые ткани (к примеру, введение in vivo).

Получение комплексов липид: нуклеиновая кислота, в том числе нацеливающих липосом, как, например, иммунолипидньгх комплексов, хорошо известно специалистам в данной области (см., к примеру, Crystal, Science 270: 404-410 (1995); Blaese et al., Cancer Gene Ther. 2: 291-297 (1995); Behr et al., Bioconjugate Chem. 5: 382-389 (1994); Remy et al., Bioconjugate Chem. 5: 647-654 (1994); Gao et al., Gene Therapy 2: 710-722 (1995); Ahmad et al., Cancer Res. 52: 4817-4820 (1992); патенты США №№4186183, 4217344, 4235871, 4261975,4485054, 4501728, 4774085, 4837028 и 4946787).

При применении систем на основе РНК- и ДНК-содержащих вирусов для доставки нуклеиновых кислот используют тщательно разработанные способы обеспечения нацеливания вируса на конкретные клетки в организме и перемещения полезных последовательностей вируса в ядро. Вирусные векторы можно вводить непосредственно пациентам (in vivo), или их можно использовать для обработки клеток in vitro, и модифицированные клетки можно необязательно вводить пациентам (ex vivo). Традиционные системы на основе вирусов могут включать ретровирусные, лентивирусные, аденовирусные векторы, векторы на основе аденоассоциированного вируса и вируса простого герпеса для переноса генов. Интеграция в геном хозяина возможна со способами переноса генов на основе ретровируса, лентивируса и аденоассоциированного вируса, что часто приводит к длительной экспрессии встроенного трансгена. Кроме того, высокие показатели эффективности трансдукции наблюдали у многих различных типов клеток и целевых тканей.

Тропизм ретровирусов может быть изменен путем включения чужеродных белков оболочки с расширением возможной целевой популяции целевых клеток. Лентивирусные векторы являются ретровирусными векторами, которые способны трансдуцировать или инфицировать неделящиеся клетки и, как правило, дают высокие вирусные титры. Выбор системы переноса генов на основе ретровирусов, таким образом, будет зависеть от целевой ткани. Ретровирусные векторы состоят из действующих в цис-положении длинных концевых повторов с упаковывающей способностью до 6-10 п.о. чужеродной последовательности. Минимальных действующих в цис-положении LTR достаточно для репликации и упаковки векторов, которые затем используют для интеграции терапевтического гена в целевую клетку с получением постоянной экспрессии трансгена. Широко применяемые ретровирусные векторы включают такие, основанные на вирусе лейкоза мышей (MuLV), вирусе лейкоза гиббонов (GaLV), вирусе иммунодефицита обезьян (SIV), вирусе иммунодефицита человека (HIV) и их комбинациях (см., к примеру, Buchscher et al., J. Virol. 66: 2731-2739 (1992); Johann et al., J. Virol. 66: 1635-1640 (1992); Sommnerfelt et al., Virol. 176: 58-59 (1990); Wilson et al., J. Virol. 63: 2374-2378 (1989); Miller et al., J. Virol. 65: 2220-2224 (1991); PCT/US94/05700).

В другом варианте осуществления предусматриваются псевдотипированные ретровирусные векторные частицы на основе оболочки везикуловируса Кокал (см., например, публикацию заявки на патент США №20120164118, закрепленной за Онкологическим исследовательским центром Фреда Хатчинсона). Вирус Кокал относится к роду Vesiculovirus и является возбудителем везикулярного стоматита у млекопитающих. Вирус Кокал изначально был выделен из клещей в Тринидаде (Jonkers et al., Am. J. Vet. Res. 25: 236-242 (1964)), и инфекции были идентифицированы в Тринидаде, Бразилии и Аргентине у насекомых, крупного рогатого скота и лошадей. Многие везикуловирусы, которые инфицируют млекопитающих, были выделены у инфицированных в естественных условиях членистоногих, что позволяет предположить, что они являются трансмиссивными. Антитела к везикуловирусам распространены у людей, живущих в сельской местности, где вирусы являются эндемичными и лабораторными; причем инфекции у человека обычно приводят к гриппоподобным симптомам. Гликопротеин оболочки вируса Кокал обладает идентичностью 71,5% на аминокислотном уровне с VSV-G Индиана, и при этом филогенетическое сравнение генов оболочки везикуловирусов продемонстрировало, что вирус Кокал серологически отличается от штаммов VSV-G Индиана, но является наиболее близкородственным с ними среди везикуловирусов. Jonkers et al., Am. J. Vet. Res. 25: 236-242 (1964) и Travassos da Rosa et al., Am. J. Tropical Med. & Hygiene 33: 999-1006 (1984). Псевдотипированные ретровирусные векторные частицы на основе оболочки везикуловируса Кокал могут включать, например, лентивирусные, альфаретровирусные, бетаретровирусные, гаммаретровирусные, дельтаретровирусные и эпсилонретровирусные векторные частицы, которые могут содержать ретровирусный Gag, Pol и/или один или несколько акцессорных белков и белок оболочки везикуловируса Кокал. В некоторых аспектах этих вариантов осуществления Gag, Pol и акцессорные белки являются лентивирусными и/или гаммаретровирусными.

В применениях, в которых транзиентная экспрессия является предпочтительной, можно применять системы на основе аденовирусов. Векторы на основе аденовирусов способны проявлять очень высокую эффективность трансдукции во многих типах клеток и не требуют деления клеток. С такими векторами были получены высокие титры и уровни экспрессии. Такой вектор можно получать в больших количествах в относительно простой системе.

Векторы на основе аденоассоциированного вируса ("AAV") также можно использовать для трансдукции в клетки целевых нуклеиновых кислот, к примеру, при получении in vitro нуклеиновых кислот и пептидов и для процедур генной терапии in vivo и ex vivo (см., к примеру, West et al., Virology 160: 38-47 (1987); патент США №4797368; WO 93/24641; Kotin, Human Gene Therapy 5: 793-801 (1994); Muzyczka, J. Clin. Invest. 94: 1351 (1994). Создание рекомбинантных векторов на основе AAV описано в ряде публикаций, в том числе в патенте США №5173414; Tratschin et al., Mol. Cell. Biol. 5: 3251-3260 (1985); Tratschin, et al., Mol. Cell. Biol. 4: 2072-2081 (1984); Hermonat & Muzyczka, PNAS 81: 6466-6470 (1984); и Samulski et al., J. Virol. 63: 03822-3828 (1989).

Упаковывающие клетки, как правило, используют для получения вирусных частиц, которые способны инфицировать клетку-хозяина. Такие клетки включают клетки 293, которые упаковывают аденовирус, и клетки ψ2 или клетки РА317, которые упаковывают ретровирус. Вирусные векторы, используемые в генной терапии, как правило, создают путем получения линии клеток, которые упаковывают вектор на основе нуклеиновой кислоты в вирусную частицу. Векторы обычно содержат минимальные вирусные последовательности, необходимые для упаковки и последующей интеграции в хозяина, при этом другие вирусные последовательности замещены на кассету экспрессии для экспрессии полинуклеотида(полинуклеотидов). Отсутствующие вирусные функции, как правило, обеспечивают в транс-положении при помощи линии упаковывающих клеток. Например, векторы на основе AAV, применяемые в генной терапии, как правило, имеют только ITR-последовательности из генома AAV, которые необходимы для упаковки и интеграции в геном хозяина. Вирусная ДНК упакована в линию клеток, которая содержит плазмиду-помощника, кодирующую другие гены AAV, а именно rep и cap, но без ITR-последовательностей. Линия клеток также может быть инфицирована аденовирусом в качестве вируса-помощника. Вирус-помощник способствует репликации вектора на основе AAV и экспрессии генов AAV из плазмиды-помощника. Плазмида-помощник не упакована в значительном количестве в связи с отсутствием ITR-последовательностей. Инфицирование аденовирусом может быть снижено, к примеру, при помощи тепловой обработки, к которой аденовирус более чувствителен, чем AAV.

Соответственно, AAV считается оптимальным кандидатом для применения в качестве трансдуцирующего вектора. Такие трансдуцирующие векторы на основе AAV могут содержать достаточные функции, действующие в цис-положении, для репликации в присутствии вспомогательных функций аденовируса, или герпесвируса, или поксвируса (например, вируса осповакцины), предоставленных в транс-положении. Рекомбинантный AAV (rAAV) можно использовать для переноса экзогенных генов в клетки различных клеточных линий. В этих векторах гены cap и/или rep AAV удалены из вирусного генома и замещены выбранным сегментом ДНК. Современные векторы на основе AAV могут вмещать до 4300 оснований встроенной ДНК.

Существует ряд способов получения rAAV, и настоящее изобретение предусматривает rAAV и способы получения rAAV. Например, плазмидой(плазмидами), содержащими необходимую конструкцию или практически состоящими из нее, трансфицируют клетки, инфицированные AAV. Кроме того, эти клетки совместно трансфицируют второй или дополнительной плазмидой-помощником с обеспечением генов rep и/или cap AAV, которые являются обязательными для репликации и упаковки рекомбинантной вирусной конструкции. В этих условиях белки rep и/или cap AAV действуют в транс-положении для стимуляции репликации и упаковки конструкции rAAV. Через два-три дня после трансфекции собирают rAAV. Традиционно, rAAV собирают из клеток вместе с аденовирусом. Контаминирующий аденовирус затем инактивируют при помощи тепловой обработки. В настоящем изобретении rAAV преимущественно собирают не из самих клеток, а из надосадочной жидкости культуры клеток. Соответственно, в первом аспекте настоящего изобретения предусматривается получение rAAV, и в дополнение к вышеупомянутому, rAAV можно получить при помощи способа, который включает следующее или состоит по сути из него: инфицирование восприимчивых клеток rAAV, содержащим экзогенную ДНК, в том числе ДНК для экспрессии, и вирусом-помощником (например, аденовирусом, герпесвирусом, поксвирусом, например, вирусом осповакцины), причем rAAV не содержит функциональный cap и/или rep (и вирус-помощник (например, аденовирус, герпесвирус, поксвирус, например, вирус осповакцины) обеспечивает функцию cap и/или rep, которую не содержит rAAV); или инфицирование восприимчивых клеток rAAV, содержащим экзогенную ДНК, в том числе ДНК для экспрессии, причем рекомбинантная конструкция не содержит функциональный cap и/или rep, и трансфекция указанных клеток плазмидой, предоставляющей функцию cap и/или rep, которую не содержит rAAV; или инфицирование восприимчивых клеток rAAV, содержащим экзогенную ДНК, в том числе ДНК для экспрессии, причем рекомбинантная конструкция не содержит функциональный cap и/или rep, при этом указанные клетки предоставляют функцию cap и/или rep, которую не содержит рекомбинантная конструкция; или трансфекция восприимчивых клеток AAV, не содержащим функциональный cap и/или rep, и плазмидами для встраивания экзогенной ДНК в рекомбинантную конструкцию, так что экзогенная ДНК экспрессируется рекомбинантной конструкцией, и для предоставления функций rep и/или cap, причем трансфекция приводит в результате к rAAV, содержащему экзогенную ДНК, в том числе ДНК для экспрессии, который не содержит функциональный cap и/или rep.

RAAV можно получить из AAV, как описано в данном документе, и преимущественно он может представлять собой rAAV1, rAAV2, AAV5 или rAAV, имеющий гибридную структуру или капсид, что может предусматривать AAV1, AAV2, AAV5 или любую их комбинацию. Можно выбрать AAV из rAAV с учетом клеток, подлежащих нацеливанию с применением rAAV, например, можно выбрать AAV серотипов 1, 2, 5, или гибридную структуру или капсид AAV1, AAV2, AAV5, или любую их комбинацию для нацеливания на головной мозг или нейроны; и при этом можно выбрать AAV4 для нацеливания на сердечную ткань.

Кроме клеток 293, при осуществлении на практике настоящего изобретения можно применять другие клетки, и при этом относительная инфицирующая способность определенных серотипов AAV in vitro по отношению к этим клеткам (см. Grimm, D. et al., J. Virol. 82: 5887-5911 (2008)) представлена ниже.

Настоящее изобретение предусматривает rAAV, который содержит или состоит по сути из экзогенной молекулы нуклеиновой кислоты, кодирующей систему CRISPR (короткие палиндромные повторы, регулярно расположенные группами), например, множество кассет, содержащих или состоящих из первой кассеты, содержащей или состоящей по сути из промотора, молекулы нуклеиновой кислоты, кодирующей CRISPR-ассоциированный (Cas) белок (предполагаемые нуклеазные или хеликазные белки), например, Cas9, и терминатор, и две или более, преимущественно до предела упаковки вектора, например, всего (включая первую кассету) пять кассет, содержащих или состоящих по сути из промотора, молекулы нуклеиновой кислоты, кодирующей направляющую РНК (gRNA), и терминатор (например, каждая кассета схематически представлена как промотор-gRNA1-терминатор, промотор-gRNA2-терминатор… Промотор-gRNA(N)-терминатор (где N относится к тому количеству, которое можно встроить, находящемуся на верхней границе предела упаковки вектора), или два или более отдельных rAAV, причем каждый содержит одну или несколько кассет системы CRISPR, например, первый rAAV, содержащий первую кассету, содержащую или состоящую по сути из промотора, молекулы нуклеиновой кислоты, кодирующей Cas, например, Cas9, и терминатора, и второй rAAV, содержащий множество, а именно четыре кассеты, содержащие или состоящие по сути из промотора, молекулы нуклеиновой кислоты, кодирующей направляющую РНК (gRNA), и терминатора (например, каждая кассета схематически представлена как промотор-gRNA1-терминатор, промотор-gRNA2-терминатор… Промотор-gRNA(N)-терминатор (где N относится к количеству того, что можно встроить, находящемуся на верхней границе предела упаковки вектора). Поскольку rAAV представляет собой ДНК-содержащий вирус, молекулы нуклеиновой кислоты в изложенном в данном документе обсуждении в отношении AAV или rAAV преимущественно представляют собой ДНК. В некоторых вариантах осуществления промотор преимущественно представляет собой промотор гена синапсина I человека (hSyn).

Дополнительные способы доставки нуклеиновых кислот в клетки известны специалистам в данной области. См., например, US 20030087817, включенный в данный документ при помощи ссылки. См. также литературный источник Kanasty, также включенный с помощью ссылки и обсуждаемый в данном документе.

В некоторых вариантах осуществления клетка-хозяин транзиентно или не транзиентно трансфицирована одним или несколькими векторами, описанными в данном документе. В некоторых вариантах осуществления клетка трансфицирована так, как это в естественных условиях происходит у субъекта. В некоторых вариантах осуществления клетка, которую трансфицируют, взята из субъекта. В некоторых вариантах осуществления клетка получена из клеток, взятых из субъекта, как, например, линии клеток. Широкий спектр линий клеток для культуры тканей известен в уровне техники. Примеры линий клеток включают, без ограничения, С8161, CCRF-CEM, MOLT, mIMCD-3, NHDF, HeLa-S3, Huh1, Huh4, Huh7, HUVEC, HASMC, HEKn, HEKa, MiaPaCell, Panc1, PC-3, TF1, CTLL-2, C1R, Rat6, CV1, RPTE, A10, T24, J82, A375, ARH-77, Calu1, SW480, SW620, SKOV3, SK-UT, CaCo2, P388D1, SEM-K2, WEHI-231, HB56, TIB55, Jurkat, J45.01, LRMB, Bcl-1, BC-3, IC21, DLD2, Raw264.7, NRK, NRK-52E, MRC5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1, COS-6, COS-M6A, эпителиальные клетки почки обезьяны BS-C-1, эмбриональные фибробласты мыши BALB/ 3Т3, 3Т3 Swiss, 3T3-L1, фетальные фибробласты человека 132-d5; фибробласты мыши 10.1, 293-Т, 3Т3, 721, 9L, А2780, A2780ADR, A2780cis, А172, А20, А253, А431, А-549, ALC, В16, В35, клетки ВСР-1, BEAS-2B, bEnd.3, ВНК-21, BR 293, ВхРС3, С3Н-10Т1/2, С6/36, Cal-27, СНО, СНО-7, CHO-IR, СНО-К1, СНО-К2, СНО-Т, СНО Dhfr -/-, COR-L23, COR-L23/CPR, COR-L23/5010, COR-L23/R23, COS-7, COV-434, CML T1, СМТ, СТ26, D17, DH82, DU145, DuCaP, EL4, ЕМ2, ЕМ3, EMT6/AR1, EMT6/AR10.0, FM3, Н1299, Н69, НВ54, НВ55, НСА2, НЕК-293, HeLa, Hepa1c1c7, HL-60, НМЕС, НТ-29, Jurkat, клетки JY, клетки К562, Ku812, KCL22, KG1, KYO1, LNCap, Ma-Mel,1-48, МС-38, MCF-7, MCF-10A, MDA-MB-231, MDA-MB-468, MDA-MB-435, MDCK II, MDCK II, MOR/0.2R, MONO-MAC 6, MTD-1A, MyEnd, NCI-H69/CPR, NCI-H69/LX10, NCI-H69/LX20, NCI-H69/LX4, NIH-3T3, NALM-1, NW-145, линии клеток OPCN/OPCT, Peer, PNT-1A/PNT 2, RenCa, RIN-5F, RMA/RMAS, клетки Saos-2, Sf-9, SkBr3, T2, T-47D, T84, линия клеток THP1, U373, U87, U937, VCaP, клетки Vero, WM39, WT-49, X63, YAC-1, YAR и их трансгенные варианты. Линии клеток доступны из ряда источников, известных специалистам в данной области (см., к примеру, Американскую коллекцию типовых культур (АТСС) (Манассас, Вирджиния)). В некоторых вариантах осуществления клетку, трансфицированную одним или несколькими векторами, описанными в данном документе, используют для получения новой линии клеток, содержащей одну или несколько полученных из вектора последовательностей. В некоторых вариантах осуществления клетку, транзиентно трансфицированную компонентами системы CRISPR, которая описана в данном документе (как, например, путем транзиентной трансфекции одним или несколькими векторами или трансфекции РНК), и модифицированную при помощи активности комплекса CRISPR, используют для получения новой линии клеток, содержащей клетки, которые содержат модификацию, но у которых отсутствует любая другая экзогенная последовательность. В некоторых вариантах осуществления клетки, транзиентно или не транзиентно трансфицированные одним или несколькими векторами, описанными в данном документе, или линии клеток, полученные из таких клеток, использовали при оценивании одного или нескольких тестовых соединений.

В некоторых вариантах осуществления один или несколько векторов, описанных в данном документе, используют для получения отличного от человека трансгенного животного или трансгенного растения. В некоторых вариантах осуществления трансгенным животным является млекопитающее, как, например, мышь, крыса или кролик. Способы получения трансгенных животных и растений известны из уровня техники и, как правило, начинаются со способа трансфекции клетки, такого как описанный в данном документе.

В другом варианте осуществления может предусматриваться устройство для доставки жидкости с матрицей игл (см., например, публикацию заявки на патент США №20110230839, закрепленной за Онкологическим исследовательским центром Фреда Хатчинсона), для доставки CRISPR-Cas в плотную ткань. Устройство согласно публикации заявки на патент США №20110230839 для доставки жидкости в плотную ткань может содержать множество игл, расположенных в виде матрицы; множество емкостей, каждая из которых находится в жидкостном соединении с соответствующей одной иглой из множества игл; и множество приводов, функционально связанных с соответствующими емкостями из множества емкостей и выполненных с возможностью регулирования давления жидкости в емкости. В определенных вариантах осуществления каждый из множества приводов может содержать один из множества поршней, причем первая концевая часть каждого из множества поршней находится в соответствующей одной емкости из множества емкостей, и в определенных дополнительных вариантах осуществления поршни из множества поршней функционально связаны вместе по соответствующим вторым концевым частям с обеспечением возможности одновременного нажатия. В определенных других дополнительных вариантах осуществления может предусматриваться управляющий элемент для поршней, сконфигурированный с возможностью выборочного нажатия всех из множества поршней с различной скоростью. В других вариантах осуществления каждый из множества приводов может содержать одну из множества жидкостных поточных линий, имеющих первую и вторую концевые части, причем первая концевая часть каждой из множества жидкостных поточных линий соединена с соответствующей одной емкостью из множества емкостей. В других вариантах осуществления устройство может содержать источник давления жидкости, и при этом каждый из множества приводов предусматривает жидкостное соединение между источником давления жидкости и соответствующей одной емкостью из множества емкостей. В дополнительных вариантах осуществления источник давления жидкости может предусматривать по меньшей мере одно из следующих: компрессор, вакуумный накопитель, перистальтический насос, основной цилиндр, микрожидкостный насос и клапан. В другом варианте осуществления каждая из множества игл может содержать множество отверстий, распределенных вдоль ее длины.

Модификация мишени

В одном аспекте настоящее изобретение предусматривает способы модификации целевого полинуклеотида в эукариотической клетке, что может происходить in vivo, ex vivo или in vitro. В некоторых вариантах осуществления способ включает взятие образца или биопсию клетки или популяции клеток от человека или отличного от человека животного и модификацию клетки или клеток. Культивирование можно осуществлять на любой стадии ex vivo. Клетку или клетки можно даже повторно вводить отличному от человека животному. Что касается повторно вводимых клеток, особенно предпочтительно, чтобы эти клетки являлись стволовыми клетками, хотя первичные гепатоциты также являются предпочтительными.

В некоторых вариантах осуществления способ включает обеспечение связывания комплекса CRISPR с целевым полинуклеотидом для осуществления расщепления указанного целевого полинуклеотида с модификацией, таким образом, целевого полинуклеотида, где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в указанном целевом полинуклеотиде, где указанная направляющая последовательность связана с парной tracr-последовательностью, которая, в свою очередь, гибридизируется с tracr-последовательностью.

В одном аспекте настоящее изобретение предусматривает способ модификации экспрессии полинуклеотида в эукариотической клетке. В некоторых вариантах осуществления способ включает обеспечение связывания комплекса CRISPR с полинуклеотидом так, что указанное связывание приводит к повышенной или пониженной экспрессии указанного полинуклеотида; где комплекс CRISPR содержит фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в указанном целевом полинуклеотиде, где указанная направляющая последовательность связана с парной tracr-последовательностью, которая, в свою очередь, гибридизируется с tracr-последовательностью. Аналогичные факторы и условия распространяются на способы модификации целевого полинуклеотида, как изложено выше. Фактически, эти варианты отбора образцов, культивирования и повторного введения охватывают аспекты настоящего изобретения.

Действительно, в любом аспекте настоящего изобретения комплекс CRISPR может содержать фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью, где указанная направляющая последовательность может быть связана с парной tracr-последовательностью, которая, в свою очередь, может гибридизироваться с tracr-последовательностью. Аналогичные факторы и условия распространяются на способы модификации целевого полинуклеотида, как изложено выше.

Наборы

В одном аспекте настоящее изобретение предусматривает наборы, содержащие любой один или несколько из элементов, раскрытых в приведенных выше способах и композициях. Элементы могут быть предоставлены отдельно или в комбинациях и могут быть предоставлены в любом подходящем контейнере, как, например, ампуле, флаконе или пробирке. В некоторых вариантах осуществления набор включает инструкции на одном или нескольких языках, например, на более чем одном языке.

В некоторых вариантах осуществления набор содержит один или несколько реагентов для применения в способе, в котором используется один или несколько элементов, описанных в данном документе. Реагенты могут быть предоставлены в любом подходящем контейнере. Например, набор может предусматривать один или несколько реакционных буферов или буферов для хранения. Реагенты могут быть предоставлены в форме, которая применима в конкретном анализе, или в форме, которая предусматривает добавление одного или нескольких других компонентов перед применением (к примеру, в форме концентрата или лиофилизированной форме). Буфер может быть любым буфером, в том числе, без ограничения, буфером с карбонатом натрия, буфером с бикарбонатом натрия, боратным буфером, Tris-буфером, буфером MOPS, буфером HEPES и их комбинациями. В некоторых вариантах осуществления буфер является щелочным. В некоторых вариантах осуществления буфер имеет значение рН от приблизительно 7 до приблизительно 10. В некоторых вариантах осуществления набор содержит один или несколько олигонуклеотидов, соответствующих направляющей последовательности, для встраивания в вектор для того, чтобы имела место функциональная связь направляющей последовательности и регуляторного элемента. В некоторых вариантах осуществления набор содержит матричный полинуклеотид для гомологичной рекомбинации. В некоторых вариантах осуществления набор содержит один или несколько векторов и/или один или несколько полинуклеотидов, описанных в данном документе. Преимущественно набор может предоставлять все элементы системы по настоящему изобретению.

Комплекс CRISPR

В одном аспекте настоящее изобретение предусматривает способы применения одного или нескольких элементов системы CRISPR. Комплекс CRISPR по настоящему изобретению обеспечивает эффективное средство модификации целевого полинуклеотида. Комплекс CRISPR по настоящему изобретению характеризуется большим разнообразием полезных свойств, включающих модификацию (например, делецию, вставку, транслокацию, инактивацию, активацию) целевого полинуклеотида во множестве типов клеток. Комплекс CRISPR по настоящему изобретению как таковой имеет широкий спектр применений, к примеру, в генной терапии, скрининге лекарственных средств, диагностике и прогнозировании заболеваний. Иллюстративный комплекс CRISPR содержит фермент CRISPR, образующий комплекс с направляющей последовательностью, которая гибридизируется или способна к гибридизации с целевой последовательностью в целевом полинуклеотиде. Направляющая последовательность связана с парной tracr-последовательностью, которая, в свою очередь, гибридизируется с tracr-последовательностью.

В одном варианте осуществления настоящее изобретение предусматривает способ расщепления целевого полинуклеотида. Способ предусматривает модификацию целевого полинуклеотида с применением комплекса CRISPR, который связывается с целевым полинуклеотидом и осуществляет расщепление указанного целевого полинуклеотида. Как правило, комплекс CRISPR согласно настоящему изобретению при введении в клетку создает разрыв (например, однонитевой или двухнитевой разрыв) в геномной последовательности. Например, способ можно применять для расщепления гена, ответственного за развитие заболевания, в клетке.

Репарация разрыва, созданного комплексом CRISPR, может осуществляться посредством способа репарации, например, путем склонного к ошибкам негомологичного соединения концов (NHEJ) или высокоточной репарации с использованием гомологичной рекомбинации (HDR) (фигура 29). В ходе данного способа репарации в геномную последовательность может быть введен экзогенный матричный полинуклеотид. В некоторых способах способ HDR используют для модификации геномной последовательности. Например, в клетку вводят экзогенный матричный полинуклеотид, содержащий последовательность, подлежащую встраиванию, фланкированную последовательностью, расположенной выше, и последовательностью, расположенной ниже. Последовательности, расположенные выше и ниже, характеризуются сходством последовательности с каждой стороной сайта встраивания в хромосоме.

При необходимости донорный полинуклеотид может представлять собой ДНК, например, плазмидную ДНК, бактериальную искусственную хромосому (ВАС), искусственную хромосому дрожжей (YAC), вирусный вектор, линейный фрагмент ДНК, ПЦР-фрагмент, "оголенную" нуклеиновую кислоту или нуклеиновую кислоту в комплексе со средством доставки, например, липосомой или полоксамером.

Экзогенный матричный полинуклеотид содержит последовательность, подлежащую встраиванию (например, мутантный ген). Последовательность, предназначенная для встраивания, может представлять собой последовательность, эндогенную или экзогенную по отношению к клетке. Примеры последовательности, подлежащей встраиванию, включают полинуклеотиды, кодирующие белок или некодирующую РНК (например, микроРНК). Таким образом, последовательность, предназначенная для встраивания, может быть функционально связанной с соответствующей регуляторной последовательностью или последовательностями. В альтернативном случае последовательность, подлежащая встраиванию, может обеспечивать регуляторную функцию.

Последовательности, расположенные выше и ниже, в экзогенном матричном полинуклеотиде выбраны так, чтобы способствовать рекомбинации между хромосомной последовательностью, представляющей интерес, и донорным полинуклеотидом. Последовательность, расположенная выше, представляет собой последовательность нуклеиновой кислоты, которая обладает сходством последовательности с геномной последовательностью, расположенной выше целевого сайта интеграции. Аналогично, последовательность, расположенная ниже, представляет собой последовательность нуклеиновой кислоты, которая обладает сходством последовательности с хромосомной последовательностью, расположенной ниже целевого сайта интеграции. Последовательности, расположенные выше и ниже, в экзогенном матричном полинуклеотиде могут иметь 75%, 80%), 85%, 90%, 95% или 100%) идентичность последовательности с целевой геномной последовательностью. Предпочтительно, последовательности, расположенные выше и ниже, в экзогенном матричном полинуклеотиде могут иметь приблизительно 95%, 96%, 97%, 98%, 99% или 100% идентичность последовательности с целевой геномной последовательностью. В некоторых способах последовательности, расположенные выше и ниже, в экзогенном матричном полинуклеотиде имеют приблизительно 99% или 100%) идентичность последовательности с целевой геномной последовательностью.

Последовательность, расположенная выше или ниже, может содержать от приблизительно 20 п.о. до приблизительно 2500 п.о., например, приблизительно 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400 или 2500 п.о. В некоторых способах иллюстративная последовательность, расположенная выше или ниже, имеет от приблизительно 200 п.о. до приблизительно 2000 п.о., от приблизительно 600 п.о. до приблизительно 1000 п.о. или, в частности, от приблизительно 700 п.о. до приблизительно 1000 п.о.

В некоторых способах экзогенный матричный полинуклеотид может дополнительно содержать маркер. Такой маркер может облегчать скрининг на предмет целевых интеграции. Примеры подходящих маркеров включают сайты рестрикции, флуоресцентные белки или селектируемые маркеры. Экзогенный матричный полинуклеотид согласно настоящему изобретению можно сконструировать с применением методик рекомбинантной ДНК (см., например, Sambrook et al., 2001 и Ausubel et al., 1996).

В иллюстративном способе модификации целевого полинуклеотида посредством интеграции экзогенного матричного полинуклеотида в геномную последовательность вводят двухнитевой разрыв при помощи комплекса CRISPR, осуществляют репарацию разрыва посредством гомологичной рекомбинации с участием экзогенного матричного полинуклеотида, так что матрица интегрируется в геном. Наличие двухнитевого разрыва обеспечивает интеграцию матрицы.

В других вариантах осуществления настоящее изобретение предусматривает способ модификации экспрессии полинуклеотида в эукариотической клетке. Способ включает повышение или снижение экспрессии целевого полинуклеотида при помощи комплекса CRISPR, который связывается с полинуклеотидом.

В некоторых способах целевой полинуклеотид можно инактивировать для осуществления модификации экспрессии в клетке. Например, при связывании комплекса CRISPR с целевой последовательностью в клетке целевой полинуклеотид инактивируется, вследствие чего последовательность не транскрибируется, кодируемый белок не продуцируется или последовательность не функционирует так, как последовательность дикого типа. Например, последовательность, кодирующую белок или микроРНК, можно инактивировать таким образом, что белок не будет продуцироваться.

В некоторых способах регуляторную последовательность можно инактивировать так что она более не функционирует в качестве регуляторной последовательности. Как используется в данном документе, "регуляторная последовательность" относится к любой последовательности нуклеиновой кислоты, которая оказывает влияние на транскрипцию, трансляцию или доступность последовательности нуклеиновой кислоты. Примеры регуляторной последовательности включают промотор, терминатор транскрипции и энхансер, которые являются регуляторными последовательностями.

Инактивированная целевая последовательность может содержать мутацию по типу делеции (т.е. делецию одного или нескольких нуклеотидов), мутацию по типу вставки (т.е. вставку одного или нескольких нуклеотидов) или нонсенс-мутацию (т.е. замену одного нуклеотида другим нуклеотидом, так что вводится стоп-кодон). В некоторых способах инактивация целевой последовательности приводит в результате к "нокауту" целевой последовательности.

Модели заболеваний

Способ по настоящему изобретению можно применять для создания животного или клетки, которые можно использовать в качестве модели заболевания. Как используется в данном документе, "заболевание" относится к заболеванию, нарушению или симптому у субъекта. Например, способ по настоящему изобретению можно использовать для создания животного или клетки, которые содержат модификацию одной или нескольких последовательностей нуклеиновой кислоты, ассоциированных с заболеванием, или растения, животного или клетки, в которых изменена экспрессия одной или нескольких последовательностей нуклеиновой кислоты, ассоциированных с заболеванием. Такая последовательность нуклеиновой кислоты может кодировать последовательность белка, ассоциированного с заболеванием, или может представлять собой регуляторную последовательность, ассоциированную с заболеванием. Соответственно, подразумевается, что в вариантах осуществления по настоящему изобретению растение, субъект, пациент, организм или клетка могут относиться к субъекту, отличному от человека, пациенту, организму или клетке. Таким образом, настоящее изобретение предусматривает животное или клетку, полученные при помощи способа по настоящему изобретению, или их потомство. Потомство может представлять собой клон полученного животного, или его можно получить при помощи полового размножения посредством скрещивания с другими индивидами того же вида для придания дополнительных желательных признаков его потомкам. Клетка может находиться in vivo или ex vivo в случае многоклеточных организмов, в частности, животных. В случае, если клетка находится в культуре, можно получить линию клеток при выполнении соответствующих условий культивирования, и предпочтительно, если клетка соответствующим образом приспособлена для этой цели (например, стволовая клетка). Следовательно, также предусматриваются линии клеток.

В некоторых способах модель заболевания можно использовать для исследования влияния мутаций на животное или клетку и развитие и/или прогрессирование заболевания с применением показателей, обычно используемых при исследовании заболевания. В альтернативном случае такая модель заболевания является применимой для исследования воздействия фармацевтически активного соединения на заболевание.

В некоторых способах модель заболевания можно использовать для оценки эффективности потенциальной стратегии генной терапии. Таким образом, ген или полинуклеотид, ассоциированный с заболеванием, можно модифицировать, так что развитие и/или прогрессирование заболевания замедляется или уменьшается. В частности, способ предусматривает модификацию гена или полинуклеотида, ассоциированного с заболеванием, так что продуцируется измененный белок, и в результате у животного или клетки наблюдается ответ, связанный с этим изменением. Соответственно, в некоторых способах генетически модифицированное животное можно сравнивать с животным, предрасположенным к развитию заболевания, так что можно оценить эффект осуществления генной терапии.

В другом варианте осуществления настоящее изобретение предусматривает способ получения биологически активного средства, которое модулирует процесс передачи сигнала в клетке, ассоциированный с геном, ответственным за развитие заболевания. Способ предусматривает приведение тестового соединения в контакт с клеткой, содержащей один или несколько векторов, которые управляют экспрессией одного или нескольких из фермента CRISPR, направляющей последовательности, связанной с парной tracr-последовательностью, и tracr-последовательности; и обнаружение изменения при считывании, которое свидетельствует об уменьшении или усилении процесса передачи сигнала в клетке, ассоциированного, например, с мутацией в гене, ответственном за развитие заболевания, который содержится в клетке.

Клеточную модель, в том числе органоид или скопление клеток, описанные в данном документе, или животную модель можно сконструировать в сочетании со способом по настоящему изобретению для скрининга изменения клеточной функции.

Такую модель можно использовать для исследования влияния геномной последовательности, модифицированной при помощи комплекса CRISPR согласно настоящему изобретению, на клеточную функцию, представляющую интерес. Например, модель клеточной функции можно использовать для исследования воздействия модифицированной геномной последовательности на внутриклеточную передачу сигнала или внеклеточную передачу сигнала. В альтернативном случае модель клеточной функции можно использовать для исследования воздействий модифицированной геномной последовательности на сенсорную чувствительность. В некоторых таких моделях одна или несколько геномных последовательностей, ассоциированных с биохимическим путем передачи сигнала, в модели являются модифицированными.

Специально исследовали несколько моделей заболеваний. Они включают гены CHD8, KATNAL2 и SCN2A, связанные с риском развития аутизма de novo; и ген UBE3A, связанный с синдромньгм аутизмом (синдромом Ангельмана). Эти гены и полученные в результате модели аутизма, разумеется, являются предпочтительными, но служат для того, чтобы продемонстрировать широкую применимость настоящего изобретения по отношению к генам и соответствующим моделям.

Измененную экспрессию одной или нескольких геномных последовательностей, ассоциированных с биохимическим путем передачи сигнала, можно определять при помощи анализа различия по уровням мРНК соответствующих генов между клетками тестируемой модели и контрольными клетками, если их приводят в контакт с кандидатным средством. В альтернативном случае различную экспрессию последовательностей, ассоциированных с биохимическим путем передачи сигнала, определяют посредством выявления различия по уровню кодируемого полипептида или продукта гена.

Для анализа индуцированного определенным средством изменения уровня мРНК-транскриптов или соответствующих полинуклеотидов, нуклеиновую кислоту, которая содержится в образце, вначале экстрагируют в соответствии со стандартными способами из уровня техники. Например, мРНК можно выделять с использованием различных литических ферментов или химических растворов в соответствии с методиками, изложенными в Sambrook et al. (1989), или экстрагировать при помощи смол, связывающих нуклеиновые кислоты, в соответствии с прилагаемыми инструкциями, предоставленными производителями. мРНК, которая содержалась в экстрагированном образце нуклеиновой кислоты, затем выявляли при помощи методик амплификации или общепринятых гибридизационных анализов (например, анализа с помощью нозерн-блоттинга) в соответствии со способами, широко известными из уровня техники или основанными на способах, проиллюстрированных в данном документе.

Для целей настоящего изобретения амплификация означает любой способ с использованием праймера и полимеразы, способной обеспечивать репликацию целевой последовательности с достаточной точностью. Амплификацию можно осуществлять при помощи природных или рекомбинантных ДНК-полимераз, таких как TaqGold™, ДНК-полимераза Т7, фрагмент Кленова ДНК-полимеразы Е. coli и обратная транскриптаза. Предпочтительным способом амплификации является ПЦР. В частности, выделенную РНК можно подвергать анализу с обратной транскрипцией, который объединен с количественной полимеразной цепной реакцией (RT-PCR) для количественного определения уровня экспрессии последовательности, ассоциированной с биохимическим путем передачи сигнала.

Выявление уровня экспрессии генов можно осуществлять в анализе амплификации в режиме реального времени. В одном аспекте амплифицированные продукты можно непосредственно визуализировать при помощи флуоресцентных ДНК-связывающих средств, в том числе, без ограничения, ДНК-интеркаляторов и средств, связывающихся с бороздкой спирали ДНК. Поскольку количество интеркаляторов, включенных в двухнитевые молекулы ДНК, как правило, является пропорциональным количеству амплифицированных ДНК-продуктов, специалист в данной области техники может беспрепятственно определить количество амплифицированных продуктов путем количественного определения флуоресценции интеркалирующего красителя с применением общепринятых оптических систем из уровня техники. ДНК-связывающий краситель, подходящий для этой задачи, охватывает SYBR зеленый, SYBR синий, DAPI, йодид пропидия, Hoeste, SYBR золотой, бромид этидия, акридины, профлавин, акридиновый оранжевый, акрифлавин, фторкумарин, эллиптицин, дауномицин, хлорохин, дистамицин D, хромомицин, хомидий, митрамицин, комплексы рутений-полипиридил, антрамицин и т.п.

В другом аспекте можно использовать другие флуоресцентные метки, например, зонды, специфичные по отношению к последовательности, в реакции амплификации для обеспечения выявления и количественного определения амплифицированных продуктов. Количественная амплификация с использованием зонда основана на специфичном по отношению к последовательности выявлении требуемого амплифицированного продукта. Используются флуоресцентные зонды, специфичные по отношению к мишени (например, зонды TaqMan®), что приводит в результате к увеличению специфичности и чувствительности. Способы осуществления количественной амплификации с использованием зонда являются общепринятыми в данной области техники и описаны в патенте США №5210015.

В еще одном аспекте можно осуществлять общепринятый гибридизационный анализ с использованием гибридизационных зондов, которые характеризуются гомологией последовательности с последовательностями, ассоциированными с биохимическим путем передачи сигнала. Как правило, в реакции гибридизации зондам дают возможность образовать стабильные комплексы с последовательностями, ассоциированными с биохимическим путем передачи сигнала, которые содержатся в биологическом образце, полученном от тестируемого субъекта. Специалист в данной области поймет, что если антисмысловая нуклеиновая кислота используется в качестве зонда, то целевые полинуклеотиды, предоставленные в образце, выбирают так, чтобы они были комплементарными последовательностям антисмысловьгх нуклеиновых кислот. Напротив, если нуклеотидный зонд является смысловой нуклеиновой кислотой, то целевой полинуклеотид выбирают так, чтобы он был комплементарным последовательностям смысловой нуклеиновой кислоты.

Гибридизацию можно осуществлять в условиях различной жесткости. Подходящие условия гибридизации для осуществления на практике настоящего изобретения являются такими, что обеспечивающее распознавание взаимодействие зонда с последовательностями, ассоциированными с биохимическим путем передачи сигнала, является как достаточно специфичным, так и достаточно стабильным. Условия, которые приводят к увеличению жесткости реакции гибридизации, хорошо известны и опубликованы в уровне техники. См., например (Sambrook, et al., (1989); Nonradioactive In Situ Hybridization Application Manual, Boehringer Mannheim, second edition). Гибридизационный анализ можно осуществлять с использованием зондов, иммобилизованных на любой твердой подложке, в том числе, без ограничения, нитроцеллюлозной, стеклянной, кремниевой, и ряда ДНК-чипов. Предпочтительный гибридизационный анализ проводят на генных чипах высокой плотности, описанных в патенте США №5445934.

Для удобного выявления комплексов зонд-мишень, образованных в ходе гибридизационного анализа, осуществляют конъюгирование нуклеотидного зонда с детектируемой меткой. Детектируемые метки, подходящие для применения в настоящем изобретении, включают любую композицию, выявляемую при помощи фотохимических, биохимических, спектроскопических, иммунохимических, электрических, оптических или химических средств. Широкий спектр соответствующих детектируемых меток известен из уровня техники, причем он включает флуоресцентные или хемилюминесцентные метки, метки на основе радиоактивных изотопов, ферментные или другие лиганды. В предпочтительных вариантах осуществления, вероятно, предпочтительной будет флуоресцентная метка или ферментная метка, например, дигоксигенин, β-галактозидаза, уреаза, щелочная фосфатаза или пероксидаза, комплекс авидин/биотин.

Способы выявления, применяемые для выявления или количественного определения интенсивности гибридизации, как правило, будут зависеть от метки, выбранной выше. Например, радиоактивные метки можно выявлять с использованием фотографической пленки или фосфовизуализатора. Можно выявлять флуоресцентные маркеры и проводить количественное определение с использованием фотодетектора для выявления излучаемого света. Ферментные метки, как правило, выявляют посредством предоставления субстрата для фермента и измерения количества продукта реакции, образованного при воздействии фермента на субстрат; и при этом, в конечном итоге, колориметрические метки выявляют посредством простой визуализации цветной метки.

Индуцированное определенным средством изменение экспрессии последовательностей, ассоциированных с биохимическим путем передачи сигнала, также можно определять посредством исследования соответствующих продуктов генов. Определение уровня белка, как правило, включает а) приведение белка, содержащегося в биологическом образце, в контакт со средством, которое специфично связывается с белком, ассоциированным с биохимическим путем передачи сигнала; и (b) идентификацию любого комплекса средство: белок, образованного таким образом. В одном аспекте данного варианта осуществления средство, которое специфически связывает белок, ассоциированный с биохимическим путем передачи сигнала, представляет собой антитело, предпочтительно моноклональное антитело.

Реакцию осуществляют посредством приведения средства в контакт с образцом белков, ассоциированных с биохимическим путем передачи сигнала, полученным из тестируемых образцов, при условиях, которые обеспечивают возможность образования комплекса между средством и белками, ассоциированными с биохимическим путем передачи сигнала. Образование комплекса можно выявлять непосредственно или опосредованно в соответствии со стандартными методиками из уровня техники. В способе непосредственного выявления средства предоставляют с детектируемой меткой и из комплекса можно удалять непрореагировавшие средства; причем количество оставшейся метки, таким образом, отражает количество образованного комплекса. Для такого способа предпочтительно выбирать метки, которые остаются прикрепленными к средствам даже при жестких условиях отмывки. Предпочтительно, чтобы метка не препятствовала реакции связывания. В альтернативном случае для методики опосредованного выявления можно использовать средство, которое содержит метку, введенную либо химическим, либо ферментативным путем. Желаемая метка, как правило, не препятствует связыванию или стабильности полученного в результате комплекса средство : полипептид. Однако, метка, как правило, разработана так, чтобы она была доступной для эффективного связывания с антителом и, следовательно, выработки детектируемого сигнала.

Широкий спектр меток, подходящих для выявления уровней белка, известен из уровня техники. Неограничивающие примеры включают радиоактивные изотопы, ферменты, коллоидные металлы, флуоресцентные соединения, биолюминесцентные соединения и хемилюминесцентные соединения.

Количество комплексов средство:полипептид, образованных в ходе реакции связывания, можно количественно определять при помощи стандартных количественных анализов. Как проиллюстрировано выше, образование комплекса средство:полипептид можно измерить непосредственно по количеству метки, оставшейся в участке связывания. В альтернативном случае белок, ассоциированный с биохимическим путем передачи сигнала, тестируют в отношении его способности конкурировать с меченым аналогом за участки связывания на специфическом средстве. В этом конкурентном анализе количество захваченной метки является обратно пропорциональным количеству последовательностей белка, ассоциированного с биохимическим путем передачи сигнала, присутствующих в тестируемом образце.

Ряд методик анализа белка, основанных на общих принципах, изложенных выше, доступен из уровня техники. Они включают, без ограничения, радиоиммунные анализы, ELISA (твердофазные ферментные иммунорадиометрические анализы), "сэндвич"-иммуноанализы, иммунорадиометрические анализы, иммуноанализы in situ (с применением, например, коллоидного золота, фермента или радиоизотопньгх меток), вестерн-блот-анализ, иммунопреципитационные анализы, иммунофлуоресцентные анализы и SDS-PAGE.

Антитела, обеспечивающие специфичное распознавание белков, ассоциированных с биохимическим путем передачи сигнала, или связывающие их, являются предпочтительными для осуществления вышеупомянутых анализов белка. При необходимости можно использовать антитела, которые обеспечивают распознавание конкретного типа посттрансляционных модификаций (например, модификации, индуцируемые биохимическим путем передачи сигнала). Посттрансляционные модификации включают, без ограничения, гликозилирование, липидизацию, ацетилирование и фосфорилирование. Эти антитела можно приобрести у коммерческих поставщиков. Например, антитела к фосфотирозину, которые обеспечивают специфичное распознавание фосфорилированных по тирозину белков, доступны от ряда поставщиков, включая Invitrogen и Perkin Elmer. Антитела к фосфотирозину являются особенно применимыми при выявлении белков, которые различным образом фосфорилируются по их тирозиновым остаткам в ответ на стресс, связанный с ER. Такие белки включают, без ограничения, эукариотический фактор инициации трансляции 2 альфа (eIF-2α). В альтернативном случае эти антитела можно получить при помощи общепринятых методик поликлональных или моноклональных антител посредством иммунизации животного-хозяина или клетки, продуцирующей антитела, целевым белком, который характеризуется необходимой посттрансляционной модификацией.

При осуществлении заявленного способа на практике может быть необходимо определить профиль экспрессии белка, ассоциированного с биохимическим путем передачи сигнала, в различных тканях организма, в различных типах клеток и/или в различных субклеточных структурах. Данные исследования можно проводить с применением тканеспецифичных, специфичных в отношении определенных клеток или специфичных в отношении определенных субклеточных структур антител, способных связываться с белковыми маркерами, которые преимущественно экспрессируются в определенных тканях, типах клеток или субклеточных структурах.

Измененную экспрессию гена, ассоциированного с биохимическим путем передачи сигнала, также можно определять при помощи исследования изменения активности продукта гена по сравнению с контрольной клеткой. Анализ индуцированного определенным средством изменения активности белка, ассоциированного с биохимическим путем передачи сигнала, будет зависеть от биологической активности и/или исследуемого пути передачи сигнала. Например, если белок представляет собой киназу, изменение его способности фосфорилировать субстрат(субстраты) на последующих стадиях можно определять посредством ряда анализов, известных из уровня техники. Типичные анализы включают, без ограничения, иммуноблоттинг и иммунопреципитацию с использованием антител, таких как антитела к фосфотирозину, которые обеспечивают распознавание фосфорилированных белков. Кроме того, активность киназы можно выявлять при помощи высокопроизводительных хемилюминисцентных анализов, например, анализов AlphaScreen™ (доступного от Perkin Elmer) и eTag™ (Chan-Hui, et al. (2003) Clinical Immunology 111: 162-174).

Если белок, ассоциированный с биохимическим путем передачи сигнала, является частью сигнального каскада, который приводит к колебанию внутриклеточных условий рН, молекулы, чувствительные к рН, например, флуоресцентные рН-чувствительные красители, можно использовать в качестве репортерных молекул. В другом примере, если белок, ассоциированный с биохимическим путем передачи сигнала, представляет собой ионный канал, можно отслеживать колебания мембранного потенциала и/или внутриклеточной концентрации ионов. Ряд коммерческих наборов и высокопроизводительных устройств являются особенно подходящими для быстрого и надежного скрининга модуляторов ионных каналов. Типичные инструменты включают FLIPRTM (Molecular Devices, Inc.) и VIPR (Aurora Biosciences). Эти инструменты способны обеспечивать одновременное выявление реакций в более чем 1000 лунках с образцом в микропланшете и обеспечивать измерение в реальном времени и функциональные данные в течение секунды или даже миллисекунды.

При осуществлении на практике любых способов, раскрытых в данном документе, подходящий вектор можно вводить в клетку или эмбрион посредством одного или нескольких способов, известных из уровня техники, в том числе, без ограничения, микроинъекции, электропорации, сонопорации, баллистической трансфекции, трансфекции, опосредованной фосфатом кальция, трансфекции с помощью катионных липидных частиц, липосомной трансфекции, трансфекции при помощи дендримеров, трансфекции посредством теплового шока, трансфекции посредством нуклеофекции, магнитофекции, липофекции, импалефекции, оптической трансфекции, поглощения нуклеиновых кислот, стимулируемого проприетарным средством, и доставки при помощи липосом, иммунолипосом, виросом или искусственных вирионов. В некоторых способах вектор вводят в эмбрион посредством микроинъекции. Можно осуществлять микроинъекцию вектора или векторов в ядро или цитоплазму эмбриона. В некоторых способах вектор или векторы можно вводить в клетку посредством нуклеофекции.

Целевым полинуклеотидом для комплекса CRISPR может быть любой полинуклеотид, эндогенный или экзогенный по отношению к эукариотической клетке. Например, целевой полинуклеотид может быть полинуклеотидом, находящимся в ядре эукариотической клетки. Целевой полинуклеотид может быть последовательностью, кодирующей продукт гена (к примеру, белок), или некодирующей последовательностью (к примеру, регуляторным полинуклеотидом или избыточной ДНК).

Примеры целевых полинуклеотидов включают последовательность, ассоциированную с биохимическим путем передачи сигнала, к примеру, ген или полинуклеотид, ассоциированный с биохимическим путем передачи сигнала. Примеры целевых полинуклеотидов включают ассоциированные с заболеваниями гены или полинуклеотиды. "Ассоциированный с заболеванием" ген или полинуклеотид означает любой ген или полинуклеотид, который обеспечивает продукты транскрипции или трансляции на аномальном уровне или в аномальной форме в клетках, полученных из пораженных заболеванием тканей, по сравнению с тканями или клетками контроля без заболевания. Это может быть ген, который начинает экспрессироваться на аномально высоком уровне; это может быть ген, который начинает экспрессироваться на аномально низком уровне, где измененная экспрессия коррелирует с появлением и/или прогрессированием заболевания. Ассоциированный с заболеванием ген также означает ген, несущий мутацию(мутации) или генетическое изменение, который непосредственно ответственен или находится в неравновесном сцеплении с геном(генами), ответственным(ответственными) за этиологию заболевания. Транскрибируемые или транслируемые продукты могут быть известными или неизвестными и могут быть на нормальном уровне или на аномальном уровне.

Целевым полинуклеотидом для комплекса CRISPR может быть любой полинуклеотид, эндогенный или экзогенный по отношению к эукариотической клетке. Например, целевой полинуклеотид может быть полинуклеотидом, находящимся в ядре эукариотической клетки. Целевой полинуклеотид может быть последовательностью, кодирующей продукт гена (к примеру, белок), или некодирующей последовательностью (к примеру, регуляторным полинуклеотидом или избыточной ДНК). Не желая быть связанными теорией, полагают, что целевая последовательность должна быть ассоциирована с РАМ (мотивом, прилегающим к протоспейсеру); то есть короткой последовательностью, узнаваемой комплексом CRISPR. Определенные требования в отношении последовательности и длины РАМ различаются в зависимости от применяемого фермента CRISPR, но РАМ, как правило, является последовательностью в 2-5 пар оснований, прилегающей к протоспейсеру (то есть целевой последовательности). Примеры последовательностей РАМ приведены в разделе "Примеры" ниже, и специалист в данной области сможет выявить дополнительные последовательности РАМ для применения с данным ферментом CRISPR.

Целевой полинуклеотид для комплекса CRISPR может включать некоторое количество ассоциированных с заболеваниями генов и полинуклеотидов, а также ассоциированных с биохимическим путем передачи сигнала генов и полинуклеотидов, которые перечислены в предварительных заявках на патенты США 61/736527 и 61/748427 с общей ссылкой BI-2011/008/WSGR, номер в реестре 44063-701.101 и BI-2011/008/WSGR, номер в реестре 44063-701.102, соответственно, обе из которых озаглавлены "СИСТЕМЫ, СПОСОБЫ И КОМПОЗИЦИИ ДЛЯ МАНИПУЛЯЦИИ С ПОСЛЕДОВАТЕЛЬНОСТЯМИ", поданных 12 декабря 2012 г. и 2 января 2013 г., соответственно, содержания всех из которых включены в данный документ при помощи ссылки во всей их полноте.

Примеры целевых полинуклеотидов включают последовательность, ассоциированную с биохимическим путем передачи сигнала, к примеру, ген или полинуклеотид, ассоциированный с биохимическим путем передачи сигнала. Примеры целевых полинуклеотидов включают ассоциированные с заболеваниями гены или полинуклеотиды. "Ассоциированный с заболеванием" ген или полинуклеотид означает любой ген или полинуклеотид, который обеспечивает продукты транскрипции или трансляции на аномальном уровне или в аномальной форме в клетках, полученных из пораженных заболеванием тканей, по сравнению с тканями или клетками контроля без заболевания. Это может быть ген, который начинает экспрессироваться на аномально высоком уровне; это может быть ген, который начинает экспрессироваться на аномально низком уровне, где измененная экспрессия коррелирует с появлением и/или прогрессированием заболевания. Ассоциированный с заболеванием ген также означает ген, несущий мутацию(мутации) или генетическое изменение, который непосредственно ответственен или находится в неравновесном сцеплении с геном(генами), ответственным(ответственными) за этиологию заболевания. Транскрибируемые или транслируемые продукты могут быть известными или неизвестными и могут быть на нормальном уровне или на аномальном уровне.

Примеры ассоциированных с заболеваниями генов и полинуклеотидов перечислены в таблицах А и В. Конкретная информация в отношении заболеваний доступна от Института генетической медицины Маккьюсика-Натанса при Университете Джонса Хопкинса (Балтимор, Мэриленд) и Национального центра биотехнологической информации Национальной библиотеки медицины (Бетесда, Мэриленд), доступных во всемирной сети Интернет.Примеры ассоциированных с биохимическим путем передачи сигнала генов и полинуклеотидов перечислены в таблице С.

Мутации в этих генах и путях могут приводить к продуцированию несоответствующих белков или белков в несоответствующих количествах, которые воздействуют на функцию. Дополнительные примеры генов, заболеваний и белков, таким образом, включены при помощи ссылки из предварительной заявки на патент США 61/736527, поданной 12 декабря 2012 г. Такие гены, белки и пути могут быть целевым полинуклеотидом для комплекса CRISPR.

Мишени, связанные с метаболизмом, описанные выше, в особенности выделенные, являются особенно предпочтительными, если они экспрессируются в печени.

Варианты осуществления настоящего изобретения также относятся к способам и композициям, связанным с нокаутом генов, амплификацией генов и репарацией конкретных мутаций, ассоциированных с нестабильностью ДНК-повторов и неврологическими нарушениями (Robert D. Wells, Tetsuo Ashizawa, Genetic Instabilities and Neurological Diseases, Second Edition, Academic Press, Oct 13, 2011 - Medical). Как было обнаружено, определенные аспекты последовательностей тандемных повторов ответственны за более чем двадцать заболеваний человека (New insights into repeat instability: role of RNA⋅DNA hybrids. Mclvor EI, Polak U, Napierala M. RNA Biol. 2010 Sep-Oct; 7(5): 551-8). Система CRISPR-Cas может быть приспособлена для коррекции таких дефектов геномной нестабильности.

Дополнительный аспект настоящего изобретения относится к использованию системы CRISPR-Cas для коррекции дефектов в генах ЕМР2А и ЕМР2 В, которые, как было обнаружено, ассоциированы с болезнью Лафора. Болезнь Лафора представляет собой аутосомно-рецессивное состояние, которое характеризуется прогрессирующей миоклонус-эпилепсией, которая может начинаться в виде эпилептических приступов в подростковом возрасте. Некоторые случаи заболевания могут вызываться мутациями в генах, которые уже были выявлены. Заболевание вызывает приступы, мышечные спазмы, затрудненную ходьбу, слабоумие и, в конечном итоге, смерть. В настоящее время не существует терапии, которая показала эффективность против прогрессирования заболевания. На другие генетические расстройства, ассоциированные с эпилепсией, также можно целенаправленно воздействовать при помощи системы CRISPR-Cas, и лежащие в основе генетические факторы дополнительно описаны в Genetics of Epilepsy and Genetic Epilepsies, edited by Giuliano Avanzini, Jeffrey L. Noebels, Mariani Foundation Paediatric Neurology:20; 2009).

Способы согласно публикации заявки на патент США №20110158957, закрепленной за Sangamo Biosciences, Inc., связанные с инактивацией генов Т-клеточных рецепторов (TCR), также можно модифицировать для применения с системой CRISPR-Cas согласно настоящему изобретению. В другом примере способы согласно публикации заявки на патент США №20100311124, закрепленной за Sangamo Biosciences, Inc., и публикации заявки на патент США №20110225664, закрепленной за Cellectis, оба из которых связаны с инактивацией экспрессии гена глутаминсинтетазы, также можно модифицировать для применения с системой CRISPR-Cas согласно настоящему изобретению.

Некоторые дополнительные аспекты настоящего изобретения касаются коррекции дефектов, ассоциированных с широким спектром наследственных заболеваний, которые дополнительно описаны на веб-сайте Национального института здравоохранения в тематическом подразделе "Наследственные заболевания" ("Genetic Disorders") (веб-сайт по адресу health.nih.gov/topic/GeneticDisorders). Наследственные заболевания головного мозга могут включать, без ограничения, адренолейкодистрофию, агенезию мозолистого тела, синдром Айкарди, синдром Альперса, болезнь Альцгеймера, синдром Барта, болезнь Баттена, CADASIL, мозжечковую дегенерацию, болезнь Фабри, синдром Герстмана-Штраусслера-Шейнкера, болезнь Хантингтона и другие связанные с триплетными повторами нарушения, болезнь Лея, синдром Леша-Найхана, болезнь Менкеса, типы митохондриальной миопатии и кольпоцефалию по критериям NINDS. Такие заболевания дополнительно описаны на веб-сайте Национального института здравоохранения в тематическом подразделе "Наследственные заболевания головного мозга" ("Genetic Brain Disorders").

В некоторых вариантах осуществления состоянием может быть неоплазия. В некоторых вариантах осуществления, где состоянием является неоплазия, гены, на которые целенаправленно воздействуют, являются любыми из перечисленных в таблице А (в данном случае PTEN и так далее). В некоторых вариантах осуществления состоянием может быть возрастная дегенерация желтого пятна. В некоторых вариантах осуществления состоянием может быть шизофреническое нарушение. В некоторых вариантах осуществления состоянием может быть связанное с тринуклеотидными повторами нарушение. В некоторых вариантах осуществления состоянием может быть синдром ломкой Х-хромосомы. В некоторых вариантах осуществления состоянием может быть связанное с секретазой нарушение. В некоторых вариантах осуществления состоянием может быть связанное с прионами нарушение. В некоторых вариантах осуществления состоянием может быть ALS. В некоторых вариантах осуществления состоянием может быть наркомания. В некоторых вариантах осуществления состоянием может быть аутизм. В некоторых вариантах осуществления состоянием может быть болезнь Альцгеймера. В некоторых вариантах осуществления состоянием может быть воспаление. В некоторых вариантах осуществления состоянием может быть болезнь Паркинсона.

Например, в публикации заявки на патент США №20110023145 описывается применение нуклеаз с "цинковыми пальцами" для генетической модификации клеток, животных и белков, ассоциированных с расстройствами аутистического спектра (ASD). Расстройства аутистического спектра (ASD) представляют собой группу расстройств, характеризующихся качественным нарушением социального взаимодействия и коммуникации, а также ограниченными повторяющимися и стереотипными паттернами поведения, интересов и видов деятельности. Три расстройства, аутизм, синдром Аспергера (AS) и неспецифическое первазивное расстройство развития (PDD-NOS), относятся к одному и тому же расстройству с различными степенями тяжести, ассоциированными с умственной деятельностью и медицинскими состояниями. ASD преимущественно являются расстройствами, которые предопределены наследственными факторами, с наследуемостью приблизительно 90%.

В публикации заявки на патент США №20110023145 предусматривается редактирование любых хромосомных последовательностей, которые кодируют белки, ассоциированные с ASD, что можно применять по отношению к системе CRISPR-Cas согласно настоящему изобретению. Белки, ассоциированные с ASD, как правило, выбирают на основании экспериментально установленной ассоциации белка, ассоциированного с ASD, с возникновением или симптомом ASD. Например, скорость образования или концентрация в кровотоке белка, связанного с ASD, может быть повышенной или пониженной в популяции с ASD по сравнению с популяцией без ASD. Различия по уровням белка можно оценить при помощи протеомных методик, в том числе, без ограничения, вестерн-блоттинга, иммуногистохимического окрашивания, твердофазного иммуноферментного анализа (ELISA) и масс-спектрометрии. В альтернативном случае белки, ассоциированные с ASD, можно идентифицировать путем получения профилей экспрессии генов для генов, кодирующих белки, при помощи методик геномного анализа, в том числе, без ограничения, микроматричного анализа ДНК, последовательного анализа экспрессии генов (SAGE) и количественной полимеразной цепной реакции в режиме реального времени (Q-PCR).

Неограничивающие примеры болезненных состояний или расстройств, которые могут быть ассоциированы с белками, ассоциированными с ASD, включают аутизм, синдром Аспергера (AS), неспецифическое первазивное расстройство развития (PDD- NOS), синдром Ретта, туберозный склероз, фенилкетонурию, синдром Смита-Лемли-Опица и синдром ломкой Х-хромосомы. В качестве неограничивающего примера, белки, ассоциированные с ASD, включают, без ограничения, следующие белки: АТР10С - аминофосфолипид-транспортирующую АТФазу (АТР10С), МЕТ - МЕТ-рецепторную тирозинкиназу, BZRAP1, MGLUR5 (GRM5) - метаботропный глутаматный рецептор 5 (MGLUR5), CDH10 - кадгерин-10, MGLUR6 (GRM6) - метаботропный глутаматный рецептор 6 (MGLUR6), CDH9 - кадгерин-9, NLGN1 - нейролигин-1, CNTN4 - контактин-4, NLGN2 - нейролигин-2, CNTNAP2 - белок 2, подобный контактин-ассоциированному белку (CNTNAP2), SEMA5A - нейролигин-3, DHCR7 - 7-дегидрохолестеринредуктазу (DHCR7), NLGN4X - нейролигин-4 Х-связанный, NLGN4Y - нейролигин-4 Y-связанный, DOC2A - альфа-белок, содержащий двойной С2-подобный домен, DPP6 - белок 6, подобный дипептидиламинопептидазе, NLGN5 - нейролигин-5, EN2 - белок 2, кодируемый гомеобоксом (EN2), NRCAM - молекулу адгезии нейронов (NRCAM), MDGA2, ассоциированный с умственной отсталостью, сцепленной с ломкой X-хромосомой (MDGA2), NRXN1 - нейрексин-1, FMR2 (AFF2) - представитель 2 семейства AF4/FMR2, OR4M2 - рецептор обонятельных луковиц 4М2, FOXP2 - белок, кодируемый Forkhead-боксом Р2 (FOXP2), OR4N4 - рецептор обонятельных луковиц 4N4, FXR1 - аутосомный гомолог 1, связанный с умственной отсталостью, сцепленной с ломкой X-хромосомой (FXR1), OXTR - окситоциновый рецептор (OXTR), FXR2 - аутосомный гомолог 2, связанный с умственной отсталостью, сцепленной с ломкой Х-хромосомой (FXR2), РАН - фенилаланингидроксилазу (РАН), GABRA1 - субъединицу альфа-1 рецептора гамма-аминомасляной кислоты (GABRA1), PTEN - гомолог фосфатазы и тензина (PTEN), GABRA5 - субъединицу альфа-5 рецептора GABAA (гамма-аминомасляной кислоты) (GABRA5), PTPRZ1 - протеиновую тирозинфосфатазу-дзета рецепторного типа (PTPRZ1), GABRB1 - субъединицу бета-1 рецептора гамма- аминомасляной кислоты (GABRB1), RELN - рилин, GABRB3 - субъединицу бета-3 рецептора GABAA (гамма-аминомасляной кислоты) (GABRB3), RPL10 - рибосомальный белок 60S L10, GABRG1 - субъединицу гамма-1 рецептора гамма-аминомасляной кислоты (GABRG1), SEMA5A - семафорин-5А (SEMA5A), HIRIP3 - HIRA-взаимодействующий белок 3, SEZ6L2 - белок 2, подобный гомологу белка 6, связанного с приступами (мышь), НОХА1 - белок, кодируемый гомеобоксом Нох-А1 (НОХА1), SHANK3 - белок 3, содержащий SH3 и несколько повторяющихся доменов анкирина (SHANK3), IL6 - интерлейкин-6, SHBZRAP1 - белок 3, содержащий SH3 и несколько повторяющихся доменов анкирина (SHBZRAP1), LAMB1 - ламинин, субъединицу бета-1 (LAMB1), SLC6A4 - серотониновый транспортер (SERT), МАРК3-митоген-активируемую протеинкиназу 3, TAS2R1 - вкусовой рецептор типа 2, представитель 1 (TAS2R1), MAZ - Мус-ассоциированный белок с "цинковыми пальцами", TSC1 - белок 1, ассоциированный с туберозным склерозом, MDGA2 - гликозилфосфатидилинозитол-связанный белок 2, якорная форма 2, содержащий домен МАМ (MDGA2), TSC2 - белок 2, ассоциированный с туберозным склерозом, МЕСР2 - метил-СрО-связывающий белок 2 (МЕСР2), UBE3A - убиквитинпротеинлигазу Е3А (UBE3A), МЕСР2 - метил-CpG-связывающий белок 2 (МЕСР2), WNT2 - сайт интеграции MMTV типа Wingless, представитель 2 семейства (WNT2).

Идентичность белка, ассоциированного с ASD, редактирование хромосомной последовательности которого осуществляют, может и будет варьировать. В предпочтительных вариантах осуществления белки, ассоциированные с ASD, редактирование хромосомной последовательности которых осуществляют, могут представлять собой белок 1, ассоциированный с (периферическим) бензодиазепиновым рецептором (BZRAP1), кодируемый геном BZRAP1, белок-представитель 2 семейства AF4/FMR2 (AFF2), кодируемый геном AFF2 (также называемый MFR2), белок аутосомный гомолог 1, ассоциированный с умственной отсталостью, сцепленной с ломкой Х-хромосомой (FXR1), кодируемый геном FXR1, или белок аутосомный гомолог 2, ассоциированный с умственной отсталостью, сцепленной с ломкой Х-хромосомой (FXR2), кодируемый геном FXR2, гликозилфосфатидилинозитол-связанный белок, содержащий домен МАМ, якорная форма 2 (MDGA2), кодируемый геном MDGA2, метил-CpG- связывающий белок 2 (МЕСР2), кодируемый геном МЕСР2, метаботропный глутаматный рецептор 5 (MGLUR5), кодируемый геном MGLUR5-1 (также называемый GRM5), белок нейрексин 1, кодируемый геном NRXN1, или белок семафорин-5А (SEMA5A), кодируемый геном SEMA5A. В иллюстративном варианте осуществления генетически модифицированное животное представляет собой крысу, и редактируемые хромосомные последовательности, кодирующие белок, ассоциированный с ASD, перечислены ниже: BZRAP1 - белок 1, ассоциированный с (периферическим) бензодиазепиновым рецептором (BZRAP1) - ХМ_002727789, ХМ_213427, ХМ_002724533, ХМ_001081125, AFF2 (FMR2) - представитель 2 семейства AF4/FMR2 (AFF2) - ХМ_219832, ХМ_001054673, FXR1 - аутосомный гомолог 1, ассоциированный с умственной отсталостью, сцепленной с ломкой Х-хромосомой (FXR1) - NM_001012179, FXR2 - аутосомный гомолог 2, ассоциированный с умственной отсталостью, сцепленной с ломкой Х-хромосомой (FXR2) - NM_001100647, MDGA2 - гликозилфосфатидилинозитол-связанный белок, содержащий домен МАМ, якорная форма 2 (MDGA2) - NM_199269, МЕСР2 - метил-CpG-связывающий белок 2 (МЕСР2) - NM_022673, MGLUR5 - метаботропный глутаматный рецептор 5 (GRM5) (MGLUR5) - NM_017012, NRXN1 - нейрексин-1 - NM_021767, SEMA5A - семафорин-5А (SEMA5A) - NM_001107659.

Иллюстративные животные или клетки могут содержать одну, две, три, четыре, пять, шесть, семь, восемь, или девять, или более инактивированных хромосомных последовательностей, кодирующих белок, ассоциированный с ASD, и ноль, одну, две, три, четыре, пять, шесть, семь, восемь, или девять, или более интегрированных в хромосому последовательностей, кодирующих белки, ассоциированные с ASD. Отредактированную или интегрированную хромосомную последовательность можно модифицировать так, чтобы она кодировала измененный белок, ассоциированный с ASD. Неограничивающие примеры мутаций в белках, ассоциированных с ASD, включают мутацию L18Q в нейрексине 1, где лейцин в положении 18 замещен глутамином, мутацию R451C в нейролигине 3, где аргинин в положении 451 замещен цистеином, мутацию R87W в нейролигине 4, где аргинин в положении 87 замещен триптофаном, и мутацию I425V в серотониновом транспортере, где изолейцин в положении 425 замещен валином. Ряд других мутаций и хромосомных перестроек в связанных с ASD хромосомных последовательностях ассоциирован с ASD, и они известны из уровня техники. См., например, Freitag et al. (2010) Eur. Child. Adolesc. Psychiatry 19: 169-178 и Bucan et al. (2009) PLoS Genetics 5: e1000536, раскрытие которых включено в данный документ посредством ссылки во всей их полноте.

Примеры белков, ассоциированных с болезнью Паркинсона, включают, без ограничения, α-синуклеин, DJ-1, LRRK2, PINK1, паркин, UCHL1, синфилин-1 и NURR1.

Примеры связанных с привыканием белков могут включать, например, АВАТ.

Примеры связанных с воспалением белков могут включать, например, моноцитарный хемоаттрактантный белок-1 (МСР1), кодируемый геном Ccr2, С-С- рецептор хемокина 5 типа (CCR5), кодируемый геном Ccr5, рецептор IgG IIB (FCGR2b, также называемый CD32), кодируемый геном Fcgr2b, или белок Fc-эпсилон-R1g (FCER1g), кодируемый геном Fcerlg.

Примеры ассоциированных с заболеваниями сердечно-сосудистой системы белков могут включать, например, IL1B (интерлейкин 1, бета), XDH (ксантиндегидрогеназу), ТР53 (опухолевый белок р53), PTGIS (простагландин-I2(простациклин)-синтазу), MB (миоглобин), IL4 (интерлейкин 4), ANGPT1 (ангиопоэтин 1), ABCG8 (АТФ-связывающую кассету, подсемейство G (WHITE), представитель 8) или CTSK (катепсин K).

Например, в публикации заявки на патент США №20110023153 описывается применение нуклеаз с "цинковыми пальцами" для генетической модификации клеток, животных и белков, ассоциированных с болезнью Альцгеймера. В случае модификации клетки и животных можно дополнительно тестировать с применением известных способов для изучения воздействия целенаправленных мутаций на развитие и/или прогрессирование AD с использованием показателей, обычно применяемых в изучении AD - таких как, без ограничения, обучение и память, тревожность, депрессия, привыкание и сенсомоторные функции, а также анализов, при помощи которых измеряют поведенческие, функциональные, патологические, метаболические и биохимические характеристики.

Настоящее раскрытие предусматривает редактирование любых хромосомных последовательностей, которые кодируют белки, ассоциированные с AD. Белки, связанные с AD, обычно выбирают на основании экспериментально подтвержденной ассоциации белка, связанного с AD, с заболеванием AD. Например, скорость образования или концентрация в кровотоке белка, связанного с AD, может быть повышенной или пониженной в популяции с заболеванием AD по сравнению с популяцией без заболевания AD. Различия по уровням белка можно оценить при помощи протеомных методик, в том числе, без ограничения, вестерн-блоттинга, иммуногистохимического окрашивания, твердофазного иммуноферментного анализа (ELISA) и масс-спектрометрии. В альтернативном случае белки, связанные с AD, можно идентифицировать путем получения профилей экспрессии генов для генов, кодирующих белки, при помощи методик геномного анализа, в том числе, без ограничения, микроматричного анализа ДНК, последовательного анализа экспрессии генов (SAGE) и количественной полимеразной цепной реакции в режиме реального времени (Q-PCR).

Примеры ассоциированных с болезнью Альцгеймера белков могут включать, например, белок-рецептор липопротеинов очень низкой плотности (VLDLR), кодируемый геном VLDLR, фермент 1, активирующий убиквитин-подобный модификатор (UBA1), кодируемый геном UBA1, или белок, являющийся каталитической субъединицей NEDD8- активирующего фермента E1 (UBE1C), кодируемый геном UBA3.

В качестве неограничивающего примера, белки, ассоциированные с AD, включают, без ограничения, белки, перечисленные ниже: кодируемый хромосомной последовательностью белок ALAS2, дельта-аминолевулинатсинтазу 2 (ALAS2), АВСА1 - АТФ-связывающий кассетный транспортер (АВСА1), АСЕ - ангиотензин I- превращающий фермент (АСЕ), АРОЕ - предшественник аполипопротеина Е (АРОЕ), АРР - белок-предшественник амилоида (АРР), AQP1 - белок акватории 1 (AQP1), BIN1 - Мус-бокс-зависимый взаимодействующий белок 1 или адаптерный белок-интегратор 1 (BIN1), BDNF - нейротрофический фактор головного мозга (BDNF), BTNL8 - белок 8, подобный бутирофилину (BTNL8), C10RF49 - белок, кодируемый открытой рамкой считывания 49 хромосомы 1, CDH4 - кадгерин-4, CHRNB2 - нейрональный ацетилхолиновый рецептор, субъединицу бета-2, CKLFSF2 - CKLF-подобный белок 2, содержащий трансмембранный домен MARVEL (CKLFSF2), CLEC4E - лектиновый домен С-типа, семейство 4, представитель е (CLEC4E), CLU - кластериновый белок (также известный как аполипопротеин J) CR1 - эритроцитарный рецептор комплемента 1 (CR1, также известный как CD35, рецептор C3b/C4b и рецептор иммунной адгезии), CR1L - эритроцитарный рецептор комплемента 1 (CR1L), CSF3R - рецептор гранулоцитарного колониестимулирующего фактора 3 (CSF3R), CST3 - цистатин С или цистатин 3, CYP2C - цитохром Р450 2С, DAPK1 - ассоциированную с клеточной гибелью протеинкиназу 1 (DAPK1), ESR1 - эстрогеновый рецептор 1, FCAR - Fc-фрагмент рецептора для IgA (FCAR, также известный как CD89), FCGR3B - Fc-фрагмент рецептора IIIb для IgG, с низким сродством (FCGR3B или CD16b), FFA2 - рецептор 2 свободных жирных кислот (FFA2), FGA - фибриноген (фактор I), GAB2 - GRB2-ассоциированный связывающий белок 2 (GAB2), GAB2 - GRB2-ассоциированный связывающий белок 2 (GAB2), GALP - галанин-подобный пептид, GAPDHS - глицеральдегид-3-фосфатдегидрогеназу сперматогенных клеток (GAPDHS), GMPB - GMBP, HP - гаптоглобин (HP), HTR7 - 5-гидрокситриптаминовый (серотониновый) рецептор 7 (сопряженный с аденилатциклазой), IDE - фермент, разрушающий инсулин IF 127 IF 127, IFI6 - интерферон альфа- индуцируемый белок 6 (IFI6), IFIT2 - интерферон-индуцируемый белок с тетратрикопептидными повторами 2 (IFIT2), IL1RN - антагонист рецептора интерлейкина-1 (IL-1RA), IL8RA - рецептор интерлейкина 8, альфа (IL8RA или CD181), IL8RB - рецептор интерлейкина 8, бета (IL8RB), JAG1 - белок Jagged 1 (JAG1), KCNJ15 - входящий калиевый канал, подсемейство J, представитель 15 (KCNJ15), LRP6 - белок 6, родственный рецептору липопротеинов низкой плотности (LRP6), МАРТ - белок tau, ассоциированный с микротрубочками (МАРТ), MARK4 - киназу 4 МАР/регулирующую сродство к микротрубочкам (MARK4), MPHOSPH1 - фосфобелок 1 М-фазы, MTHFR - 5,10-метилентетрагидрофолатредуктазу, МХ2 - интерферон-индуцируемый GTP-связьгвающий белок Мх2, NBN - нибрин, также известный как NBN, NCSTN - никастрин, NIACR2 - рецептор 2 ниацина (NIACR2, также известный как GPR109B), NMNAT3 - никотинамиднуклеотидаденилилтрансферазу 3, NTM - нейротримин (или HNT), ORM1 - орозомукоид 1 (ORM1) или альфа-1-кислый гликопротеин 1, P2RY13 - пуринергический рецептор P2Y 13 (P2RY13), PBEF1 - никотинамидфосфорибозилтрансферазу (NAmPRТазу или Nampt), также известную как колониестимулирующий фактор 1 пре-В-клеток (PBEF1) или висфатин, PCK1 - -фосфоенолпируваткарбоксикиназу, PICALM - фосфатидилинозит- связывающий белок, вовлеченный в формирование клатриновых комплексов (PICALM), PLAU - активатор плазминогена урокиназного типа (PLAU), PLXNC1 - плексин С1 (PLXNC1), PRNP - прионный белок, PSEN1 - белок пресенилин 1 (PSEN1), PSEN2 - белок пресенилин 2 (PSEN2), PTPRA - белок, представляющий собой рецепторную протеинтирозинфосфатазу типа A (PTPRA), RALGPS2 - Ral GEF с доменом РН и SH3-связывающим мотивом 2 (RALGPS2), RGSL2 - белок 2, подобный регулятору передачи сигнала при помощи G-белка (RGSL2), SELENBP1 - селенсвязывающий белок 1 (SELNBP1), SLC25A37 - митоферрин-1, SORL1 - родственный сортилину рецептор L (класс DLR), белок, содержащий повторы A (SORL1), TF - трансферрин, TFAM - митохондриальный транскрипционный фактор A, TNF - фактор некроза опухоли, TNFRSF10C - суперсемейство рецепторов фактора некроза опухоли, представитель 10С (TNFRSF10C), TNFSF10 - суперсемейство рецепторов фактора некроза опухоли (TRAIL), представитель 10а (TNFSF10), UBA1 - фермент 1, активирующий убиквитин-подобный модификатор (UBA1), UBA3 - белок, являющийся каталитической субъединицей NEDD8- активирующего фермента E1 (UBE1C), UBB - белок убиквитин В (UBB), UBQLN1 - убиквилин-1, UCHL1 - белок эстеразу карбокси-конца убиквитина L1 (UCHL1), UCHL3 - белок-изофермент L3 гидролазы карбокси-конца убиквитина (UCHL3), VLDLR - белок- рецептор липопротеинов очень низкой плотности (VLDLR).

В иллюстративных вариантах осуществления белки, ассоциированные с AD, редактирование хромосомной последовательности которых осуществляют, могут представлять собой белок-рецептор липопротеинов очень низкой плотности (VLDLR), кодируемый геном VLDLR, фермент 1, активирующий убиквитин-подобный модификатор (UBA1), кодируемый геном UBA1, белок, являющийся каталитической субъединицей МЕ008-активирующего фермента El (UBE1C), кодируемый геном UBA3, белок аквапорин 1 (AQP1), кодируемый геном AQP1, белок эстеразу карбокси-конца убиквитина L1 (UCHL1), кодируемый геном UCHL1, белок-изофермент L3 гидролазы карбокси-конца убиквитина (UCHL3), кодируемый геном UCHL3, белок убиквитин В (UBB), кодируемый геном UBB, белок tau, ассоциированный с микротрубочками (МАРТ), кодируемый геном МАРТ, белок, представляющий собой рецепторную протеинтирозинфосфатазу типа А (PTPRA), кодируемый геном PTPRA, фосфатидилинозит-связывающий белок, вовлеченный в формирование клатриновых комплексов (PICALM), кодируемый геном PICALM, кластериновый белок (также известный как аполипопротеин J), кодируемый геном CLU, белок пресенилин 1, кодируемый геном PSEN1, белок пресенилин 2, кодируемый геном PSEN2, родственный сортилину рецептор L (класс DLR), белок, содержащий повторы A (SORL1), кодируемый геном SORL1, белок-предшественник амилоида (АРР), кодируемый геном АРР, предшественник аполипопротеина Е (АРОЕ), кодируемый геном АРОЕ, или нейротрофический фактор головного мозга (BDNF), кодируемый геном BDNF. В иллюстративном варианте осуществления генетически модифицированное животное представляет собой крысу, и редактируемые хромосомные последовательности, кодирующие белок, ассоциированный с AD, являются следующими: АРР - белок-предшественник амилоида (АРР) - NM_019288, AQP1 - белок аквапорин 1 (AQP1) - NM_012778, BDNF - нейротрофический фактор головного мозга - NM_012513, CLU - кластериновый белок (также известный как аполипопротеин J) - NM_053021, МАРТ - белок tau, ассоциированный с микротрубочками (МАРТ) - NM_017212, PICALM - фосфатидилинозит-связывающий белок, вовлеченный в формирование клатриновых комплексов (PICALM) - NM_053554, PSEN1 - белок пресенилин 1 (PSEN1) - NM_019163, PSEN2 - белок пресенилин 2 (PSEN2) - NM_031087, PTPRA - белок, представляющий собой рецепторную протеинтирозинфосфатазу типа A (PTPRA) - NM_012763, SORL1 - родственный сортилину рецептор L (класс DLR), белок, содержащий повторы A (SORL1) - NM_053519, ХМ_001065506, ХМ_217115, UBA1 - фермент 1, активирующий убиквитин-подобный модификатор (UBA1) - NM_001014080, UBA3 - белок, являющийся каталитической субъединицей NEDD 8-активирующего фермента E1 (UBE1C) - NM_057205, UBB - белок убиквитин В (UBB) - NM_138895, UCHL1 - белок эстераза карбокси-конца убиквитина L1 (UCHL1) - NM_017237, UCHL3 - белок-изофермент L3 гидролазы карбокси-конца убиквитина (UCHL3) - NM_001110165, VLDLR – белок - рецептор липопротеинов очень низкой плотности (VLDLR) - NM_013155.

Животное или клетка может содержать 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 или более хромосомных последовательностей с нарушенной структурой, кодирующих белок, ассоциированный с AD, и ноль, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 или более интегрированных в хромосомы последовательностей, кодирующих белок, ассоциированный с AD.

Отредактированную или интегрированную хромосомную последовательность можно модифицировать так, чтобы она кодировала измененный белок, ассоциированный с AD. Ряд мутаций в хромосомных последовательностях, связанных с AD, были ассоциированы с AD. Например, миссенс-мутация V7171 (т.е. валин в положении 717 заменен изолейцином) в АРР приводит к семейной форме AD. Несколько мутаций в белке пресенилине-1, например, H163R (т.е. гистидин в положении 163 заменен аргинином), А246Е (т.е. аланин в положении 246 заменен глутаматом), L286V (т.е. лейцин в положении 286 заменен валином) и C410Y (т.е. цистеин в положении 410 заменен тирозином), приводят к семейной форме болезни Альцгеймера типа 3. Мутации в белке пресенилине-2, например, N141I (т.е. аспарагин в положении 141 заменен изолейцином), M239V (т.е. метионин в положении 239 заменен валином) и D439A (т.е. аспартат в положении 439 заменен аланином), приводят к семейной форме болезни Альцгеймера типа 4. Другие ассоциации генных вариантов генов, ассоциированных с AD, и заболевания известны из уровня техники. См., например, Waring et al. (2008) Arch. Neurol. 65: 329-334, раскрытие которого включено в данный документ посредством ссылки во всей своей полноте.

Примеры белков, ассоциированных с расстройствами аутистического спектра, могут включать, например, белок 1, ассоциированный с (периферическим) бензодиазепиновым рецептором (BZRAP1), кодируемый геном BZRAP1, белок-представитель 2 семейства AF4/FMR2 (AFF2), кодируемый геном AFF2 (также называемый MFR2), белок аутосомный гомолог 1, ассоциированный с умственной отсталостью, сцепленной с ломкой Х-хромосомой (FXR1), кодируемый геном FXR1, или белок аутосомный гомолог 2, ассоциированный с умственной отсталостью, сцепленной с ломкой Х-хромосомой (FXR2), кодируемый геном FXR2.

Примеры белков, ассоциированных с дегенерацией желтого пятна, могут включать, например, АТФ-связывающую кассету, белок-представитель 4 подсемейства А (АВС1) (АВСА4), кодируемый геном ABCR, белок аполипопр"отеин Е (АРОЕ), кодируемый геном АРОЕ, или белок хемокиновый лиганд 2 (мотив С-С) (CCL2), кодируемый геном CCL2.

Примеры белков, ассоциированных с шизофренией, могут включать NRG1, ErbВ4, CPLX1, ТРН1, ТРН2, NRXN1, GSK3A, BDNF, DISC1, GSK3B и их комбинации.

Примеры белков, вовлеченных в подавление опухоли, могут включать, например, ATM (мутантный при атаксии-телеангиэктазии), ATR (родственный мутантному при атаксии-телеангиэктазии и Rad3), EGFR (рецептор эпидермального фактора роста), ERBB2 (гомолог 2 онкогена v-erb-b2 вируса эритробластического лейкоза), ERBB3 (гомолог 3 онкогена v-erb-b2 вируса эритробластического лейкоза), ERBB4 (гомолог 4 онкогена v-erb-b2 вируса эритробластического лейкоза), Notch 1, Notch2, Notch 3 или Notch 4.

Примеры белков, ассоциированных с нарушением, связанным с активностью секретазы, могут включать, например, PSENEN (гомолог усилителя 2 пресенилина (С.elegans)), CTSB (катепсин В), PSEN1 (пресенилин 1), АРР (белок-предшественник бета-амилоида (А4)), АРН1В (гомолог В дефектного белка 1 переднего отдела глотки (С.elegans)), PSEN2 (пресенилин 2 (болезнь Альцгеймера 4)) или ВАСЕ1 (фермент 1, расщепляющий АРР по бета-сайту).

Например, в публикации заявки на патент США №20110023146 описывается применение нуклеаз с "цинковыми пальцами" для генетической модификации клеток, животных и белков, ассоциированных с нарушением, связанным с активностью секретазы. Секретазы необходимы для процессинга белков-предшественников с образованием их биологически активных форм. Дефекты различных компонентов секретазных путей связаны со многими нарушениями, в особенности с характерным амилоидогенезом или амилоидными бляшками, например, при болезни Альцгеймера (AD).

Что касается нарушения, связанного с активностью секретазы, белки, ассоциированные с этими нарушениями, представляют собой разнородную группу белков, которые оказывают влияние на восприимчивость ко многим нарушениям, наличие нарушения, тяжесть нарушения или любую их комбинацию. Настоящее раскрытие предусматривает редактирование любых хромосомных последовательностей, которые кодируют белки, ассоциированные с нарушением, связанным с активностью секретазы. Белки, ассоциированные с нарушением, связанным с активностью секретазы, как правило, выбирают на основании экспериментально установленной ассоциации белков, родственных секретазе, с развитием нарушения, связанного с активностью секретазы. Например, скорость образования или концентрация в кровотоке белка, ассоциированного с нарушением, связанным с активностью секретазьд, может быть повышенной или пониженной в популяции с нарушением, связанным с активностью секретазы, по сравнению с популяцией без нарушения, связанного с активностью секретазы. Различия по уровням белка можно оценить при помощи протеомных методик, в том числе, без ограничения, вестерн-блоттинга, иммуногистохимического окрашивания, твердофазного иммуноферментного анализа (ELISA) и масс-спектрометрии. В альтернативном случае белок, ассоциированный с нарушением, связанным с активностью секретазы, можно идентифицировать путем получения профилей экспрессии генов для генов, кодирующих белки, при помощи методик геномного анализа, в том числе, без ограничения, микроматричного анализа ДНК, последовательного анализа экспрессии генов (SAGE) и количественной полимеразной цепной реакции в режиме реального времени (Q-PCR).

В качестве неограничивающего примера, белки, ассоциированные с нарушением, связанным с активностью секретазы, включают PSENEN (гомолог усилителя пресенилина 2 (С.elegans)), CTSB (катепсин В), PSEN1 (пресенилин 1), АРР (белок-предшественник бета-амилоида (А4)), АРН1В (гомолог В дефектного белка 1 переднего отдела глотки (С.elegans)), PSEN2 (пресенилин 2 (болезнь Альцгеймера 4 типа)), ВАСЕ1 (фермент 1, расщепляющий АРР по бета-сайту), ITM2B (интегральный мембранный белок 2В), CTSD (катепсин D), NOTCH1 (гомолог Notch 1, ассоциированный с транслокацией (Drosophila)), TNF (фактор некроза опухоли (суперсемейство TNF, представитель 2)), INS (инсулин), DYT10 (белок 10, связанный с дистонией), ADAM17 (ADAM, металлопептидазный домен 17), АРОЕ (аполипопротеин Е), АСЕ (ангиотензин I-превращающий фермент (пептидилдипептидазу А) 1), STN (статин), ТР53 (опухолевый белок р53), IL6 (интерлейкин 6 (интерферон, бета 2)), NGFR (рецептор фактора роста нервов (суперсемейство TNFR, представитель 16)), IL1B (интерлейкин 1, бета), ACHE (ацетилхолинэстеразу (группа крови Yt)), CTNNB1 (катенин (кадгерин-ассоциированный белок), бета 1, 88 кДа), IGF1 (инсулиноподобный фактор роста 1 (соматомедин С)), IFNG (интерферон, гамма), NRG1 (нейрегулин 1), CASP3 (каспазу 3, связанную с апоптозом цистеиновую пептидазу), MAPK1 (митоген-активируемую протеинкиназу 1), CDH1 (кадгерин 1, тип 1, Е-кадгерин (эпителиальные клетки)), АРВВ1 (белок, связывающий предшественник бета-амилоида (А4), семейство В, представитель 1 (Fe65)), HMGCR (редуктазу 3-гидрокси-3-метилглутарилкофермента A), CREB1 (белок 1, связывающий сАМР-чувствительный элемент), PTGS2 (простагландинэндопероксидсинтазу 2 (простагландин-G/Н-синтазу и циклооксигеназу)), HES1 (белок 1 Hairy and enhancer of split (Drosophila)), CAT (каталазу), TGFB1 (трансформирующий фактор роста, бета 1), ENO2 (енолазу 2 (гамма, нейрональную), ERBB4 (гомолог 4 онкогена v-erb-a вируса эритробластического лейкоза (птичий)), TRAPPC10 (комплекс 10 транспортного белка частиц), МАОВ (моноаминоксидазу В), NGF (фактор роста нервов (бета-полипептид)), ММР12 (матриксную металлопептидазу 12 (эластазу макрофагов)), JAG1 (белок Jagged 1 (синдром Алажиля)), CD40LG (лиганд CD40), PPARG (гамма-рецептор, активируемый пролифератором пероксисом), FGF2 (фактор 2 роста фибробластов (основный)), IL3 (интерлейкин 3 (колониестимулирующий фактор, множественный)), LRP1 (белок 1, родственный рецептору липопротеинов низкой плотности), NOTCH4 (гомолог Notch 4 (Drosophila)), MAPK8 (митоген-активируемую протеинкиназу 8), PREP (пролилэндопептидазу), NOTCH3 (гомолог Notch 3 (Drosophila)), PRNP (прионный белок), CTSG (катепсин G), EGF (эпидермальный фактор роста (бета-урогастрон)), REN (ренин), CD44 (молекулу CD44 (система групп крови Indian)), SELP (селектин Р (гранулярный мембранный белок на 140 кДа, антиген CD62)), GHR (рецептор гормона роста), ADCYAP1 (полипептид 1, активирующий аденилатциклазу (гипофиз)), INSR (инсулиновый рецептор), GFAP (глиальный фибриллярный кислый белок), ММР3 (матриксную металлопептидазу 3 (стромелизин 1, прожелатиназу)), MAPK10 (митоген-активируемую протеинкиназу 10), SP1 (транскрипционный фактор Sp1), MYC (гомолог онкогена v-myc вируса миелоцитоматоза (птичий)), CTSE (катепсин Е), PPARA (альфа-рецептор, активируемый пролифератором пероксисом), JUN (онкоген jun), TIMP1 (ингибитор 1 металлопептидазы TIMP), IL5 (интерлейкин 5 (колониестимулирующий фактор, эозинофилы)), ILIA (интерлейкин 1, альфа), ММР9 (матриксную металлопептидазу 9 (желатиназу В, желатиназу на 92 кДа, коллагеназу IV типа на 92 кДа)), HTR4 (5-гидрокситриптаминовый (серотониновый) рецептор 4), HSPG2 (гепарансульфат-протеогликан 2), KRAS (гомолог онкогена v-Ki-ras2 вируса саркомы Кирстена крысы), CYCS (цитохром с, соматические клетки), SMG1 (гомолог SMG1, киназу, родственную фосфатидилинозитол-3-киназе (С.elegans)), IL1R1 (рецептор интерлейкина 1, I типа), PROK1 (прокинетицин 1), MAPK3 (митоген-активируемую протеинкиназу 3), NTRK1 (нейротрофическую тирозинкиназу, рецепторную, тип 1), IL13 (интерлейкин 13), MME (мембранную металлоэндопептидазу), TKT (транскетолазу), CXCR2 (рецептор 2 хемокина (мотив С-Х-С)), IGF1R (рецептор 1 инсулиноподобного фактора роста), RARA (рецептор ретиноевой кислоты, альфа), CREBBP (CREB-связывающий белок), PTGS1 (простагландинэндопероксидсинтазу 1 (простагландин-G/H-синтазу и циклооксигеназу)), GALT (галактозо-1-фосфатуридилтрансферазу), CHRM1 (холинергический рецептор, мускариновый 1), ATXN1 (атаксин 1), PAWR (PRKC, связанный с апоптозом, WT1, регулятор), NOTCH2 (гомолог Notch 2 (Drosophila)), M6PR (рецептор маннозо-6-фосфата (катион-зависимый)), CYP46A1 (цитохром Р450, семейство 46, подсемейство А, полипептид 1), CSNK1 D (казеинкиназу 1, дельта), MAPK14 (митоген-активируемую протеинкиназу 14), PRG2 (протеогликан 2, костный мозг (активатор натуральных клеток-киллеров, главный основный белок гранул эозинофилов)), PRKCA (протеинкиназу С, альфа), L1 САМ (молекулу клеточной адгезии LI), CD40 (молекулу CD40, представителя 5 суперсемейства рецепторов TNF), NR1I2 (ядерный рецептор, подсемейство 1, I группа, представитель 2), JAG2 (белок Jagged 2), CTNND1 (катенин (кадгерин-ассоциированный белок), дельта 1), CDH2 (кадгерин 2, тип 1, N- кадгерин (нейрональный)), СМА1 (химазу 1, тучная клетка), SORT1 (сортилин 1), DLK1 (гомолог Delta-подобного белка 1 (Drosophila)), ТНЕМ4 (представителя 4 суперсемейства тиоэстераз), JUP (плакоглобин адгезионных контактов), CD46 (молекулу CD46, регуляторный белок комплемента), CCL11 (хемокиновый лиганд 11 (мотив С-С)), CAV3 (кавеолин 3), RNASE3 (рибонуклеазу 3, семейство РНКазы А (катионный белок эозинофилов)), HSPA8 (белок 8 теплового шока на 70 кДа), CASP9 (каспазу 9, связанную с апоптозом цистеиновую пептидазу), CYP3A4 (цитохром Р450, семейство 3, подсемейство А, полипептид 4), CCR3 (рецептор 3 хемокина (мотив С-С)), TFAP2A (транскрипционный фактор АР-2 альфа (активирующий энхансер-связывающий белок 2 альфа)), SCP2 (стерол-переносящий белок 2), CDK4 (циклин-зависимую киназу 4), HIF1A (фактор 1, индуцируемый гипоксией, альфа-субъединицу (транскрипционный фактор с основным доменом типа спираль-петля-спираль)), TCF7L2 (белок 2, подобный транскрипционному фактору 7 (специфический по отношению к Т-клеткам, HMG-бокс)), IL1R2 (рецептор интерлейкина 1, II типа), B3GALTL (белок, подобный бета-1,3-галактозилтрансферазе), MDM2 (гомолог Mdm2 белка, связывающего р53 (мышь)), RELA (гомолог А онкогена v-rel вируса ретикулоэндотелиоза (птичий)), CASP7 (каспазу 7, связанную с апоптозом цистеиновую пептидазу), IDE (фермент, разрушающий инсулин), FABP4 (белок 4, связывающий жирные кислоты, адипоцитарный), CASK (кальций/кальмодулин-зависимую сериновую протеинкиназу (семейство MAGUK)), ADCYAP1R1 (рецептор I типа полипептида 1, активирующего аденилатциклазу (гипофиз)), ATF4 (активирующий транскрипционный фактор 4 (tax-чувствительный энхансерный элемент В67)), PDGFA (полипептидный тромбоцитарный фактор роста альфа), С21 или f33 (белок, кодируемый открытой рамкой считывания 33 хромосомы 21), SCG5 (секретогранин V (белок 7 В2)), RNF123 (белок 123 с доменом ring), NFKB1 (ядерный фактор 1 энхансера гена полипептидной легкой каппа-цепи иммуноглобулина в В-клетках), ERBB2 (гомолог 2 онкогена v-erb-b2 вируса эритробластического лейкоза, гомолог онкогена, полученный из нейро/глиобластомы (птичий)), CAV1 (кавеолин 1, кавеолярный белок, 22 кДа), ММР7 (матриксную металлопептидазу 7 (матрилизин, маточный)), TGFA (трансформирующий фактор роста, альфа), RXRA (рецептор ретиноида X, альфа), STX1A (синтаксин 1А (головной мозг)), PSMC4 (26S субъедийицу протеасомы (просомы, макропаина), АТФазу 4), P2RY2 (пуринергический рецептор P2Y, связанный с G-белком, 2), TNFRSF21 (суперсемейство рецепторов фактора некроза опухоли, представитель 21), DLG1 (гомолог 1 discs large (Drosophila)), NUMBL (белок, подобный гомологу numb (Drosophila)), SPN (сиалофорин), PLSCR1 (фосфолипидскрамблазу 1), UBQLN2 (убиквилин 2), UBQLN1 (убиквилин 1), PCSK7 (пропротеинконвертазу субтилизин/кексин типа 7), SPON1 (спондин 1, белок внеклеточного матрикса), SILV (гомолог silver (мышь)), QPCT (глутаминилпептидциклотрансферазу), HESS (белок 5 hairy and enhancer of split (Drosophila)), GCC1 (белок 1, содержащий GRIP и суперспиральный домены) и любую их комбинацию.

Генетически модифицированные животное или клетка может содержать 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более хромосомных последовательностей с нарушенной структурой, кодирующих белок, ассоциированный с нарушением, связанным с активностью секретазы, и ноль, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более интегрированных в хромосомы последовательностей, кодирующих белок с нарушенной структурой, ассоциированный с нарушением, связанным с активностью секретазы.

Примеры белков, ассоциированных с боковым амиотрофическим склерозом, могут включать, например, SOD1 (супероксиддисмутазу 1), ALS2 (белок 2, ассоциированный с боковым амиотрофическим склерозом), FUS (белок слияния при саркоме), TARDBP (ДНК-связывающий белок TAR), VAGFA (фактор роста эндотелия сосудов A), VAGFB (фактор роста эндотелия сосудов В) и VAGFC (фактор роста эндотелия сосудов С) и любую их комбинацию.

Например, в публикации заявки на патент США №20110023144 описывается применение нуклеаз с "цинковыми пальцами" для генетической модификации клеток, животных и белков, ассоциированных с заболеванием боковым амиотрофическим склерозом (ALS). ALS характеризуется постепенной прогрессирующей дегенерацией определенных нервных клеток в коре головного мозга, стволе головного мозга и спинном мозге, связанных с произвольными движениями.

Что касается нарушения, связанного с двигательными нейронами, белки, ассоциированные с этими нарушениями, представляют собой разнородную группу белков, которые оказывают влияние на восприимчивость к развитию нарушения, связанного с двигательными нейронами, наличие нарушения, связанного с двигательными нейронами, тяжесть нарушения, связанного с двигательными нейронами, или любую их комбинацию. Настоящее раскрытие предусматривает редактирование любых хромосомных последовательностей, которые кодируют белки, ассоциированные с заболеванием ALS, специфическим нарушением, связанным с двигательными нейронами. Белки, ассоциированные с ALS, как правило, выбирают на основании экспериментально установленной ассоциации белков, связанных с ALS, с ALS. Например, скорость образования или концентрация в кровотоке белка, ассоциированного с ALS, может быть повышенной или пониженной в популяции с ALS по сравнению с популяцией без ALS. Различия по уровням белка можно оценить при помощи протеомных методик, в том числе, без ограничения, вестерн-блоттинга, иммуногистохимического окрашивания, твердофазного иммуноферментного анализа (ELISA) и масс-спектрометрии. В альтернативном случае белки, ассоциированные с ALS, можно идентифицировать путем получения профилей экспрессии генов для генов, кодирующих белки, при помощи методик геномного анализа, в том числе, без ограничения, микроматричного анализа ДНК, последовательного анализа экспрессии генов (SAGE) и количественной полимеразной цепной реакции в режиме реального времени (Q-PCR).

В качестве неограничивающего примера, белки, ассоциированные с ALS, включают, без ограничения, следующие белки: SOD1 - растворимую супероксиддисмутазу 1, ALS3 - белок 3, ассоциированный с боковым амиотрофическим склерозом, SETX - сенатаксин, ALS5 - белок 5, ассоциированный с боковым амиотрофическим склерозом, FUS - белок слияния при саркоме, ALS7 - белок 7, ассоциированный с боковым амиотрофическим склерозом, ALS2 - белок 2, ассоциированный с боковым амиотрофическим склерозом, DPP6 - дипептидилпептидазу 6, NEFH - тяжелый полипептид нейрофиламента, PTGS1 - простагландинэндопероксидсинтазу 1, SLC1A2 - семейство 1 переносчиков растворенных веществ (глутаматный транспортер глиальных клеток с высоким сродством), представитель 2, TNFRSF10B - фактор некроза опухоли, суперсемейство рецепторов, представитель 10b, PRPH - периферии, HSP90AA1 - белок теплового шока альфа на 90 кДа (цитозольный), класс А, представитель 1, GRIA2 - рецептор глутамата, ионотропный, AMPA 2, IFNG - интерферон, гамма, S100B - S100, кальций-связывающий белок В, FGF2 - фактор 2 роста фибробластов, АОХ1 - альдегидоксидазу 1, CS - цитратсинтазу, TARDBP - ДНК-связывающий белок TAR, TXN - тиоредоксин, RAPH1 - Ras-ассоциированный белок 1 (RaIGDS/AF-6), содержащий домены плекстриновой гомологии, MAP3K5 - митоген-активируемую протеинкиназу 5, NBEAL1 - белок 1, подобный нейробичину, GPX1 - глутатионпероксидазу 1, ICA1L - белок, подобный аутоантигену островковых клеток на 1,69 кДа, RAC1 - Ras-родственный белок 1, являющийся субстратом ботулинического токсина С3, MAPT - бедок tau, ассоциированный с микротрубочками, ITPR2 - рецептор инозитол-1,4,5-трифосфата, тип 2, ALS2CR4 - кандидатный участок 4 хромосомы для белка 2, ассоциированного с боковым амиотрофическим склерозом (ювенильным), GLS - глутаминазу, ALS2CR8 - кандидатный участок 8 хромосомы для белка 2, связанного с амиотрофическим латеральным склерозом (ювенильным), CNTFR - рецептор для цилиарного нейротрофического фактора, ALS2CR11 - кандидатный участок 11 хромосомы для белка 2, ассоциированного с боковым амиотрофическим склерозом (ювенильным), FOLH1 - фолатгидролазу 1, FAM117B - семейство белков со сходством последовательности с белком 117, представитель В, Р4НВ - пролил-4-гидроксилазу, полипептид бета, CNTF - цилиарный нейротрофический фактор, SQSTM1 - секвестосому 1, STRADB - 8ТЕ20-родственную киназу, бета-адаптерную, NAIP - семейство NLR, связанный с апоптозом ингибиторный белок, YWHAQ - белок-активатор тирозин-3-монооксигеназы/триптофан-5-монооксигеназы, полипептид тета, SLC33A1 - семейство 33 переносчиков растворенных веществ (ацетил-СоА-транспортеры), представитель 1, TRAK2 - транспортный белок, кинезин-связывающий 2, FIG 4 - гомолог FIG4, содержащий домен фосфатазы липидов SAC1, NIF3L1 - белок 1, подобный NGG1-взаимодействующему фактору 3 NIF3, INA - интернексин, нейрональный промежуточный филаментный белок, альфа, PARD3B - гомолог В par-3 (белка 3 при дефектном разделении), СОХ8А - цитохром с-оксидазу, субъединицу VIIIA, CDK15 - циклин-зависимую киназу, HECW1 - убиквитинпротеинлигазу Е3, содержащую домены НЕСТ, С2 и WW, NOS1 - синтазу 1 оксида азота, МЕТ - протоонкоген met, SOD2 - митохондриальную супероксиддисмутазу 2, HSPB1 - белок 1 теплового шока на 27 кДа, NEFL - легкий полипептид нейрофиламента, CTSB - катепсин В, ANG - ангиогенин, рибонуклеазу, семейство РНКазы A, HSPA8 - белок теплового шока 8 на 70 кДа, VAPB - белки В и С, ассоциированные с VAMP (ассоциированным с везикулами мембранным белком), ESR1 - эстрогеновый рецептор 1, SNCA - синуклеин, альфа, HGF - фактор роста гепатоцитов, CAE - каталазу, ACTB - актин, бета, NEFM - средний полипептид нейрофиламента, ТН - тирозингидроксилазу, BCL2 - белок 2, ассоциированный с В-клеточными CLL/лимфомой, FAS - Fas (суперсемейство рецепторов TNF, представитель 6), CASP3 - каспазу 3, связанную с апоптозом цистеиновую пептидазу, CLU - кластерин, SMN1 - фактор выживания мотонейронов 1, теломерный, G6PD - глюкозо-6-фосфатдегидрогеназу, BAX BCL2-ассоциированный белок X, HSF1 - транскрипционный фактор 1 белков теплового шока, RNF19A - белок 19А с доменом ring, JUN - онкоген jun, ALS2CR12 - кандидатами участок 12 хромосомы для белка 2, ассоциированного с боковым амиотрофическим склерозом (ювенильным), HSPA5 - белок 5 теплового шока на 70 кДа, MAPK14 - митоген-активируемую протеинкиназу 14, IL10 - интерлейкин 10, APEX1 - APEX-нуклеазу 1 (полифункциональный фермент репарации ДНК), TXNRD1 - тиоредоксинредуктазу 1, NOS2 - индуцируемую синтазу 2 оксида азота, TIMP1 - TIMP- ингибитор 1 металлопептидаз, CASP9 - каспазу 9, связанную с апоптозом цистеиновую пептидазу, XIAP - Х-сцепленный ингибитор апоптоза, GLG1 - гликопротеин 1 комплекса Гольджи, EPO - эритропоэтин, VEGFA - фактор роста эндотелия сосудов A, ELN - эластин, GDNF - нейротрофический фактор, полученный из глиальных клеток, NFE2L2 - белок 2, подобный (эритроидному) ядерному фактору 2, SLC6A3 - представитель 3 семейства 6 переносчиков растворенных веществ (транспортер нейротрансмиттеров, дофаминовый), HSPA4 - белок 4 теплового шока на 70 кДа, АРОЕ - аполипопротеин Е, PSMB8 - субъединицу 8 бета-типа протеасомы (просомы, макропаина), DCTN1 - динактин 1, TIMP3 - TIMP-ингибитор 3 металлопептидаз, KIFAP3 - кинезин- ассоциированный белок 3, SLC1A1 - представитель 1 семейства 1 переносчиков растворенных веществ (глутаматный транспортер нейронов/эпителиальных клеток с высоким сродством, система Xag), SMN2 - фактор выживания мотонейронов 2, центромерный, CCNC - циклин С, МРР4 - пальмитоилированный мембранный белок 4, STUB1 - белок 1, гомологичный STIP1 и содержащий U-бокс, ALS2 - белок-предшественник бета-амилоида (А4), PRDX6 - пероксиредоксин 6, SYP - синаптофизин, CABIN 1 - кальциневрин-связывающий белок 1, CASP1 - каспазу 1, связанную с апоптозом цистеиновую пептидазу, GART - фосфорибозилглицинамидформилтрансферазу, фосфорибозилглицинамидсинтетазу, фосфорибозиламиноимидазолсинтетазу, CDK5 - циклин-зависимую киназу 5, ATXN3 - атаксин 3, RTN4 - ретикулон 4, C1QB - компонент комплемента 1, субкомпонент q, цепь В, VEGFC - рецептор фактора роста нервов, НТТ - хантингтин, PARK7 - белок 7, ассоциированный с болезнью Паркинсона, XDH - ксантиндегидрогеназу, GFAP - глиальный фибриллярный кислый белок, МАР2 - белок 2, ассоциированный с микротрубочками, CYCS - цитохром с, соматические клетки, FCGR3B - Fc-фрагмент рецепторов IIIb для IgG с низким сродством, CCS - медь-содержащий шаперон супероксиддисмутазы, UBL5 - белок 5, подобный убиквитину, ММР9 - матриксную металлопептидазу 9, SLC18A3 - представитель 3 семейства 18 переносчиков растворенных веществ (везикулярный, ацетилхолиновый), TRPM7 - катионный канал транзиентного рецепторного потенциала, подсемейство М, представитель 7, HSPB2 - белок 2 теплового шока на 27 кДа, AKT1 - гомолог 1 онкогена v-akt вируса тимомы мышей, DERL1- представитель 1 семейства белков с Der1-подобным доменом, CCL2 - хемокиновый лиганд 2 (мотив С--С), NGRN - неугрин, ассоциированный с ростом аксонов, GSR - глутатионредуктазу, ТРРР3-представитель 3 семейства белков, способствующих полимеризации тубулина, APAF1 - фактор 1, активирующий апоптическую пептидазу, BTBD10 - белок 10, содержащий домен ВТВ (POZ), GLUD1 - глутаматдегидрогеназу 1, CXCR4 - рецептор 4 хемокина (мотив С--Х--С), SLC1A3 - представитель 3 семейства 1 переносчиков растворенных веществ (глутаматный транспортер глиальных клеток с высоким сродством), FLT1 - тирозинкиназу 1, родственную frns, PON1 - параоксоназу 1, AR - андрогенный рецептор, LIF - фактор, ингибирующий лейкоз, ERBB3 - гомолог 3 онкогена v-erb-b2 вируса эритробластического лейкоза, LGALS1 - лектин, галактозид-связывающий растворимый белок 1, CD44 - молекулу CD44, ТР53 - опухолевый белок р53, TLR3 - Toll-подобный рецептор 3, GRIA1 - глутаматный рецептор, ионотропный, АМРА 1, GAPDH - глицеральдегид-3- фосфатдегидрогеназу, GRIK1 - глутаматный ионотропный каинатный рецептор 1, DES - десмин, CHAT - холинацетилтрансферазу, FLT4 - тирозинкиназу 4, родственную fms, СНМР2 В - белок 2В, модифицирующий хроматин, BAG1 - BCL2-ассоциированный атаноген, МТ3-металлотионеин 3, CHRNA4 - холинергический рецептор, никотиновый, альфа 4, GSS - глутатионсинтетазу, BAK1 - BCL2-гомологичный антагонист/киллер 1, KDR - рецептор с киназным вставочным доменом (рецепторную тирозинкиназу III типа), GSTP1 - глутатион-8-трансферазу пи 1, OGG1 - 8-оксогуанин-ДНК-гликозилазу, IL6 - интерлейкин 6 (интерферон, бета 2).

Животное или клетка может содержать 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более хромосомных последовательностей с нарушенной структурой, кодирующих белок, ассоциированный с ALS, и ноль, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более интегрированных в хромосомы последовательностей, кодирующих белок с нарушенной структурой, ассоциированный с ALS. Предпочтительные белки, ассоциированные с ALS, включают SOD1 (супероксиддисмутазу 1), ALS2 (белок 2, ассоциированный с боковым амиотрофическим склерозом), FUS (белок слияния при саркоме), TARDBP (ДНК-связывающий белок TAR), VAGFA (фактор роста эндотелия сосудов A), VAGFB (фактор роста эндотелия сосудов В) и VAGFC (фактор роста эндотелия сосудов С) и любую их комбинацию.

Примеры белков, ассоциированных с прионными болезнями, могут включать SOD1 (супероксиддисмутазу 1), ALS2 (белок 2, ассоциированный с боковым амиотрофическим склерозом), FUS (белок слияния при саркоме), TARDBP (ДНК-связывающий белок TAR), VAGFA (фактор роста эндотелия сосудов A), VAGFB (фактор роста эндотелия сосудов В) и VAGFC (фактор роста эндотелия сосудов С) и любую их комбинацию.

Примеры белков, связанных с нейродегенеративными состояниями при прионных болезнях, могут включать, например, А2М (альфа-2-макроглобулин), AATF (транскрипционный фактор, противодействующий апоптозу), АСРР (простатоспецифическую кислую фосфатазу), АСТА2 (альфа-актин 2 гладкой мускулатуры аорты), ADAM22 (ADAM с металлопептидазным доменом), ADORA3 (аденозиновый рецептор A3-типа) или ADRA1D (альфа-1D-адренергический рецептор или альфа-1D-адренорецептор).

Примеры белков, ассоциированных с иммунодефицитом, могут включать, например, А2М [альфа-2-макроглобулин]; AANAT [арилалкиламин-N-ацетилтрансферазу]; АВСА1 [АТФ-связывающую кассету, подсемейство А (АВС1), представитель 1]; АВСА2 [АТФ-связывающую кассету, подсемейство А (АВС1), представитель 2] или ABCA3 [АТФ-связывающую кассету, подсемейство А (АВС1), представитель 3].

Примеры белков, ассоциированных с нарушениями, связанными с экспансией тринуклеотидных повторов, включают, например, AR (андрогенный рецептор), FMR1 (белок 1, ассоциированный с умственной отсталостью, сцепленной с ломкой X-хромосомой), НТТ (хантингтин) или DMPK (миотонинпротеинкиназу), FXN (фратаксин), ATXN2 (атаксин 2).

Примеры белков, ассоциированных с нарушениями передачи нервных импульсов, включают, например, SST (соматостатин), NOS1 (синтазу оксида азота 1 (нейрональную)), ADRA2A (адренергический, альфа-2А-, рецептор), ADRA2C (адренергический, альфа-2С-, рецептор), TACR1 (тахикининовый рецептор 1) или HTR2c (5-гидрокситриптаминовый (серотониновый) рецептор 2С).

Примеры последовательностей, ассоциированных с неврологическим развитием, включают, например, А2 ВР1 [атаксин-2-связывающий белок 1], AADAT [аминоадипатаминотрансферазу], AANAT [арилалкиламин-N-ацетилтрансферазу], АВАТ [4-аминобутиратаминотрансферазу], АВСА1 [АТФ-связывающую кассету, подсемейство А (АВС1), представитель 1] или АВСА13 [АТФ-связывающую кассету, подсемейство А (АВС1), представитель 13].

Дополнительные примеры предпочтительных состояний, которые подлежат лечению с помощью данной системы, включают те, которые могут быть выбраны из синдрома Айкарди-Гутьерес; болезни Александера; синдрома Аллана-Херндона-Дадли; связанных с геном POLG нарушений; альфа-маннозидоза (II и III типа); синдрома Альстрема; синдрома Ангельмана; атаксии-телеангиэктазии; восковидных липофусцинозов нейронов; бета-талассемии; двусторонней атрофии зрительного нерва и (инфантильной) атрофии зрительного нерва 1 типа; ретинобластомы (двусторонней); болезни Канавана; церебро-окуло-фацио-скелетного синдрома 1 [COFS1]; церебротендинального ксантоматоза; синдрома Корнелии де Ланге; связанных с геном МАРТ нарушений; наследственных прионньгх болезней; синдрома Драве; семейной болезни Альцгеймера с ранним началом; атаксии Фридрейха [FRDA]; синдрома Фринса; фукозидоза; врожденной мышечной дистрофии Фукуямы; галактосиалидоза; болезни Гоше; органической ацидемии; гемофагоцитарного лимфогистиоцитоза; синдрома прогерии Хатчинсона-Гилфорда; муколипидоза II; инфантильной болезни накопления свободной сиаловой кислоты; ассоциированной с геном PLA2G6 нейродегенерации; синдрома Джервелла-Ланге-Нильсена; узелкового врожденного буллезного эпидермолиза; болезни Хантингтона; болезни Краббе (инфантильной); ассоциированного с митохондриальной ДНК синдрома Ли и NARP; синдрома Леша-Найхана; ассоциированной с геном LIS1 лиссэнцефалии; синдрома Лоу; болезни "кленового сиропа"; синдрома дупликации МЕСР2; связанных с геном АТР7А нарушений обмена меди; связанной с геном LAMA2 мышечной дистрофии; недостаточности арилсульфатазы А; мукополисахаридоза I, II или III типов; нарушений биогенеза пероксисом, спектра синдрома Цельвегера; нарушений по типу нейродегенерации с накоплением железа в головном мозге; недостаточности кислой сфингомиелиназы; болезни Ниманна-Пика типа С; глициновой энцефалопатии; связанных с геном ARX нарушений; нарушений орнитинового цикла; связанного с геном COL1A1/2 несовершенного остеогенеза; синдромов делеции митохондриальной ДНК; связанных с геном PLP1 нарушений; синдрома Перри; синдрома Фелана-МакДермида; болезни накопления гликогена II типа (болезни Помпе) (инфантильной); связанных с геном МАРТ нарушений; связанных с геном МЕСР2 нарушений; эпифизарной точечной хондродисплазии 1 типа костей верхних конечностей или бедренной кости; синдрома Робертса; болезни Сандхоффа; болезни Шиндлера - 1 типа; недостаточности аденозиндезаминазы; синдрома Смита-Лемли-Опица; спинальной мышечной атрофии; спинально-церебеллярной атаксии с возникновением в младенческом возрасте; недостаточности гексозаминидазы; танатофорной дисплазии 1 типа; связанных с геном коллагена VI типа нарушений; синдрома Ашера I типа; врожденной мышечной дистрофии; синдрома Вольфа-Хиршхорна; недостаточности лизосомной кислой липазы и пигментной ксеродермы.

Как будет понятно, предусматривается, что настоящую систему можно использовать для целенаправленного воздействия на любую представляющую интерес полинуклеотидную последовательность. Некоторые состояния или заболевания, которые можно эффективно лечить с использованием настоящей системы, включены в таблицы выше, и примеры известных на данный момент генов, ассоциированных с такими состояниями, также предоставлены в них. Тем не менее, гены, приведенные в качестве примеров, не являются исчерпывающими.

Например, "StCas9 дикого типа" относится к Cas9 дикого типа из S. thermophilus, при этом последовательность его белка представлена в базе данных SwissProt под номером доступа G3ECR1. Аналогично, Cas9 S. pyogenes включен в SwissProt под номером доступа Q99ZW2.

ПРИМЕРЫ

Следующие примеры приведены с целью иллюстрации различных вариантов осуществления настоящего изобретения и не предназначены для ограничения настоящего изобретения каким-либо образом. Данные примеры совместно со способами, описанными в данном документе, в настоящее время отражают предпочтительные варианты осуществления, являются иллюстративными и не предназначены для ограничения объема настоящего изобретения. Изменения в данном документе и другие применения, которые охватываются сущностью настоящего изобретения, как определено объемом формулы изобретения, будут очевидны специалистам в данной области.

Пример 1. Активность комплекса CRISPR в ядре эукариотической клетки

Примером системы CRISPR типа II является локус CRISPR типа II из Streptococcus pyogenes SF370, который содержит кластер из 4 генов Cas9, Cas1, Cas2 и Csn1, а также два некодирующих элемента РНК, tracrRNA и характерный массив повторяющихся последовательностей (прямых повторов), чередующихся с короткими фрагментами неповторяющихся последовательностей (спейсерами, примерно 30 п.о. каждый). В данной системе целенаправленный двухнитевой разрыв (DSB) ДНК образуется в ходе четырех последовательных стадий (фигура 2А). Во-первых, две некодирующих РНК, массив pre-crRNA и tracrRNA, транскрибируются с локуса CRISPR. Во-вторых, tracrRNA гибридизируется с прямыми повторами pre-crRNA, которая затем процессируется в зрелые crRNA, содержащие отдельные спейсерные последовательности. В-третьих, комплекс зрелая crRNA:tracrRNA направляет Cas9 к ДНК-мишени, состоящей из протоспейсера и соответствующего РАМ, посредством образования гетеродуплекса между спейсерным участком crRNA и протоспейсерной ДНК. И наконец, Cas9 опосредует расщепление целевой ДНК выше РАМ с образованием DSB внутри протоспейсера (фигура 2А). В этом примере описывается иллюстративный способ приспособления этой РНК-программируемой нуклеазной системы к управлению активностью комплекса CRISPR в ядрах эукариотических клеток. Культура клеток и трансфекция

Линию клеток почки человеческого эмбриона (HEK), HEK 293FT (Life Technologies), поддерживали в среде Игла в модификации Дульбекко (DMEM), дополненной 10% фетальной бычьей сывороткой (HyClone), 2 мМ GlutaMAX (Life Technologies), 100 ед./мл пенициллина и 100 мкг/мл стрептомицина, при 37°C с инкубированием при 5% СО2. Линию мышиных клеток neuro2A (N2A) (АТСС) поддерживали в DMEM, дополненной 5% фетальной бычьей сывороткой (HyClone), 2 мМ GlutaMAX (Life Technologies), 100 ед./мл пенициллина и 100 мкг/мл стрептомицина, при 37°C с 5% CO2.

Клетки HEK 293FT или N2A высевали в 24-луночные планшеты (Corning) за один день до трансфекции с плотностью 200000 клеток на лунку. Клетки трансфицировали с применением Lipofectamine 2000 (Life Technologies), следуя рекомендованному производителем протоколу. Для каждой лунки 24-луночного планшета использовали в общей сложности 800 нг плазмид.

Анализ с помощью Surveyor и секвенирующий анализ на предмет наличия модификации генома

Клетки HEK 293 FT или N2A трансфицировали плазмидной ДНК, как описано выше. После трансфекции клетки инкубировали при 37°C в течение 72 часов перед экстракцией геномной ДНК. Геномную ДНК экстрагировали с помощью на