Антитела к церамиду

Изобретение относится к области биохимии, в частности к антителу, которое специфически связывается с церамидом. Также раскрыты способы ингибирования апоптоза, ассоциированного с церамидом, и уменьшения отрицательного воздействия указанного апоптоза. Изобретение позволяет эффективно ингибировать апоптоз, ассоциированный с церамидом. 4 н. и 10 з.п. ф-лы, 3 пр., 17 ил., 2 табл.

 

Перекрестная ссылка на Предшествующие заявки

Настоящей заявкой заявляется приоритет предварительной заявки США № 62/034453, поданной 7 августа 2014 года.

ОБЛАСТЬ ТЕХНИКИ

Настоящая заявка, в основном, относится к антителам, которые ингибируют клеточную смерть. В частности, изобретение относится к ингибированию клеточной смерти с помощью антител, направленных на церамид.

УРОВЕНЬ ТЕХНИКИ

Острый Радиационный Синдром (ARS) (который иногда называют радиационной токсичностью или лучевой болезнью) представляет собой острое заболевание, вызванное облучением значительной части тела высокой дозой проникающей радиации; такой как высокоэнергетическое рентгеновское излучение, гамма-излучение и нейтроны; в течение очень короткого периода времени, например, в течение нескольких минут. Основной причиной этого синдрома является истощение незрелых паренхимальных стволовых клеток в определенных тканях. Примерами людей, которые пострадали от ARS, являются выжившие после атомных бомбардировок Хиросимы и Нагасаки, пожарные, которые были первыми, кто отреагировал на аварию Чернобыльской АЭС в 1986 году, а также те, кто подвергся некоторым непреднамеренным воздействиям стерилизующих облучателей. В общем, доза облучения для индукции ARS велика (то есть выше чем 0,7 Грэй (Гр) или 70 рад), хотя умеренные симптомы могут наблюдаться при таких низких дозах, как 0,3 Гр или 30 рад.

Радиационный желудочно-кишечный (ЖК) синдром обычно появляется при дозе выше чем примерно 10 Гр (1000 рад), хотя некоторые симптомы могут проявляться при настолько низкой дозе, как 6 Гр или 600 рад. С этим синдромом выживание крайне маловероятно из-за разрушительных и непоправимых изменений в желудочно-кишечном тракте и в костном мозге. Радиационный ЖК-синдром, как правило, можно разделить на три стадии. Продромальная стадия проявляется в течение нескольких часов после воздействия, и симптомы включают анорексию, тошноту, рвоту, судороги и диарею. Латентная стадия начинается примерно через два дня, и пациенту может казаться, что он чувствует себя хорошо, однако, клетки, выстилающие ЖК-тракт, а также стволовые клетки в костном мозге умирают. Менее чем через неделю после облучения начинается стадия проявления болезни с симптомами, включающими общее недомогание, анорексию, тяжелую диарею, лихорадку, обезвоживание и электролитный дисбаланс. Смерть обычно наступает в течение 2-х недель в результате инфекции, обезвоживания и электролитного дисбаланса.

В дополнение к лечению острого радиационного синдрома, в настоящее время используется трансплантация костного мозга для лечения ряда злокачественных и доброкачественных заболеваний, включающих острые и хронические лейкозы, миеломы, солидные опухоли. Однако трансплантация костного мозга часто вызывает различные иммунные реакции хозяина, что приводит к отторжению трансплантата или к реакции трансплантат-против-хозяина (в дальнейшем именуемом «РТПХ»). Режим кондиционирования, требующийся перед трансплантацией, предназначенный для абляции или подавления иммунной системы пациента, делает восприимчивым пациента к рецидиву неоплазии или инфекции. Недавнее применение несвязанных и неидентичных по HLA доноров, к сожалению, увеличило заболеваемость РТПХ. В то время как удаление Т-клеток из трансплантата костного мозга донора улучшает РТПХ, эта стратегия увеличивает скорость отторжения трансплантата и заметно уменьшает терапевтически полезный эффект трансплантат против опухоли. Таким образом, общая выживаемость не улучшается. Кроме того, несмотря на сильные доклинические данные, попытки улучшить результаты РТПХ путем уменьшения воспалительного действия цитокинов путем добавления антагонистов TNF к кортикостероидам, что является стандартным медицинским лечении при острой РТПХ, обеспечили ограниченную терапевтическую пользу.

Таким образом, существует острая необходимость в разработке альтернативных стратегий для снижения частоты и тяжести радиационного ЖК-синдрома и РТПХ.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Один из аспектов настоящей заявки относится к антителу к церамиду или его антиген-связывающему фрагменту, содержащим: вариабельную область CDR1 тяжелой цепи, состоящую из 10 аминокислот, содержащих Gly в 1-ом положении от N-конца, Tyr или Phe во 2-ом положении от N-конца, Phe или Leu в 4-ом положении от N-конца, и Thr или His в 6-ом положении от N-конца, и His или Asn в 10-ом положении от N-конца; вариабельную область CDR2 тяжелой цепи, состоящую из 16-17 аминокислот, содержащих Asn или Ile во 2-ом положении от N-конца, Phe или Ser в 4-ом положении от N-конца, Thr в 9-ом положении от C-конца, Tyr в 7-ом положении от C-конца, Asn в 6-ом положении от C-конца, Lys или Ала во 2-ом и 4-ом положении от C-конца; вариабельную область CDR3 тяжелой цепи, состоящую из 7-11 аминокислот, содержащих Tyr или Thr в 4-ом положении от N-конца; вариабельную область CDR1 легкой цепи, состоящую из 10-16 аминокислот, содержащих Ala или Ser во 2-ом положении от N-конца, Ser в 3-ем положении от N-конца, Ser или Asp в 5-ом положении от N-конца, и Tyr, Ser или Phe в 3-ем положении от C-конца; вариабельную область CDR2 легкой цепи, состоящую из 7 аминокислот, содержащих Ser или Asn в 3-ем положении от N-конца, Lys или Ser в 5-ом положении от N-конца, и Ser или Asp в 7-ом положении от N-конца; и вариабельную область CDR3 легкой цепи, состоящую из 9 аминокислот, содержащих Gln, Leu или Trp в 1-ом положении от N-конца, Gln во 2-ом положении от N-конца, Pro в 7-ом положении от N-конца, и Thr в 9-ом положении от N-конца.

Другой аспект настоящей заявки относится к одноцепочечному вариабельному фрагменту (ScFv) антитела к церамиду, который связывается с той же антигенной детерминантой, что и антитело к церамиду настоящей заявки. ScFv содержит: вариабельную область CDR1 тяжелой цепи, состоящую из 10 аминокислот, содержащих Gly в 1-ом положении от N-конца, Tyr или Phe во 2-ом положении от N-конца, Phe или Leu в 4-ом положении от N-конца, и Thr или His в 6-ом положении от N-конца, и His или Asn в 10-ом положении от N-конца; вариабельную область CDR2 тяжелой цепи, состоящую из 16-17 аминокислот, содержащих Asn или Ile во 2-ом положении от N-конца, Phe или Ser в 4-ом положении от N-конца, Thr в 9-ом положении от C-конца, Tyr в 7-ом положении от C-конца, Asn в 6-ом положении от C-конца, Lys или Ала во 2-ом и 4-ом положении от C-конца; вариабельную область CDR3 тяжелой цепи, состоящую из 7-11 аминокислот, содержащих Tyr или Thr в 4-ом положении от N-конца; вариабельную область CDR1 легкой цепи, состоящую из 10-16 аминокислот, содержащих Ala или Ser во 2-ом положении от N-конца, Ser в 3-ем положении от N-конца, Ser или Asp в 5-ом положении от N-конца, и Tyr, Ser или Phe в 3-ем положении от C-конца; вариабельную область CDR2 легкой цепи, состоящую из 7 аминокислот, содержащих Ser или Asn в 3-ем положении от N-конца, Lys или Ser в 5-ом положении от N-конца, и Ser или Asp в 7-ом положении от N-конца; и вариабельную область CDR3 легкой цепи, состоящую из 9 аминокислот, содержащих Gln, Leu или Trp в 1-ом положении от N-конца, Gln во 2-ом положении от N-конца, Pro в 7-ом положении от N-конца, и Thr в 9-ом положении от N-конца.

Другой аспект настоящей заявки относится к способу ингибирования клеточной смерти у субъекта, нуждающегося в этом, включающий введение субъекту терапевтически эффективного количества антитела к церамиду или фрагмента антитела к церамиду согласно настоящей заявке.

Еще один аспект настоящей заявки относится к способу лечения радиационного ЖК-синдрома или ослабления симптомов радиационного ЖК-синдрома у субъекта, включающему введение субъекту терапевтически эффективного количества антитела к церамиду или фрагмента антитела к церамиду согласно настоящей заявке.

Еще один аспект настоящей заявки относится к способу уменьшения отрицательного воздействия клеточной смерти при ЖК-синдроме у субъекта, нуждающегося в этом. Способ включает введение эффективного количества антитела к церамиду или его антиген-связывающего фрагмента после воздействия на указанный субъект проникающей радиации.

Еще один аспект настоящего изобретения относится к способу ингибирования апоптоза в РТПХ у субъекта, нуждающегося в этом. Способ включает введение эффективного количества антитела к церамиду или его антиген-связывающего фрагмента перед тем, как указанный субъект получает трансплантат или после того, как указанный субъект получает трансплантат, но до проявления РТПХ. В другом аспекте настоящего изобретения, указанный трансплантат представляет собой трансплантат костного мозга.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Прилагаемые чертежи иллюстрируют одно или несколько воплощений настоящего изобретения и вместе с письменным описанием служат для объяснения принципов примерных воплощений настоящего изобретения.

Фигуры 1А-В демонстрируют: (А) последовательности вариабельной области (VH) тяжелой цепи и вариабельной области (VL) легкой цепи мАт 2А2, и (В) выравнивание аминокислотной последовательности клона 2А2 и человеческой зародышевой последовательности.

Фигуры 2А-В демонстрируют: (А) последовательность тяжелой цепи гуманизированного 2A2, и (B) последовательность тяжелой цепи гуманизированного 2A2.

Фигура 3 представляет собой иллюстрацию биологической активности для h2A2, 9H10, 9H11, 7B10, 9A2, 6B5 и 6C8 in vitro с использованием неочищенной надосадочной жидкости.

Фигура 4 представляет собой иллюстрацию примерного ингибирования с помощью очищенного антитела апоптоза клеток Jurkat, 10 Гр.

Фигура 5 представляет собой иллюстрацию примерного ингибирования летальности крипт с использованием гуманизированного 2A2 и мышиных 7B10, 6c8 и 6b5.

Фигура 6 представляет собой иллюстрацию примерных последовательностей мышиных антител 6B5, 6C8, 7B10, 9H10, 9H11, 2А2 и гуманизированного антитела 2А2 (h2A2), а также изображение консенсусной последовательности антитела к церамиду. Выравнивание и консенсусную последовательность генерировали с использованием компьютерной программы MUSCLE для выравнивания множества последовательностей. Консервативная область визуализируется на выравнивании или на группе последовательностей в виде гистограммы с получением балльной оценки для каждого столбца. Консервативные столбцы обозначены «*» (балльная оценка 11 с параметрами свойств группировки аминокислот по умолчанию), а столбцы с мутациями, где все свойства консервативны, отмечены «+» (балльная оценка 10, что указывает на то, что все свойства консервативны). «-» Означает пропуск.

Фигура 7 представляет собой иллюстрацию in vitro ингибирования апоптоза клеток Jurkat с помощью примерного 6B5 ScFv.

Фигура 8 представляет собой иллюстрацию in vivo защиты от истощения ЖК крипт с помощью примерного 6B5 scFv при его введении до облучения.

Фигура 9 представляет собой иллюстрацию ослабления отрицательного воздействия истощения ЖК крипт in vivo при введении после облучения.

Фигура 10 представляет собой иллюстрацию того, что ScFv к церамиду защищает кишечные крипты дозозависимым образом. Мышам C57BL/6 вводили гуманизированное антитело 2A2 к церамиду (0-1000 микрограмм/на мышь) или рекомбинантный ScFv 6B5 к церамиду (0-100 микрограмм на мышь) с помощью внутривенной инъекции за 15 мин до тотального облучения всего организма (TBI) дозой 15 Гр. Мышей умерщвляли через 3,5 дня после TBI и удаляли секцию проксимального отдела тонкой кишки, разрезали на 3 сегмента 15мм и помещали в 4% параформальдегид. Проксимальные сегменты тонкой кишки поперечно секционировали, фиксировали, и слайды окрашивали Н&Е перед количественной оценкой выживших крипт в соответствии с методом Витерса и Элкинда (Withers and Elkind) (1970). Поскольку кишечные крипты являются местом кишечных стволовых клеток, то анализ микроколоний обычно используют в качестве идентификатора для выживания кишечных стволовых клеток. N=5 мышей на группу.

Фигура 11 представляет собой иллюстрацию того, что ScFv к церамиду сохраняет эффективность при введении с помощью альтернативных инъекций. Мышам C57BL/6 вводили гуманизированное антитело 2A2 к церамиду (50 мг/кг) путем внутривенной (IV), внутрибрюшинной (IP) или подкожной (SC) инъекции за 15 мин до тотального облучения всего организма дозой 15 Гр. В качестве альтернативы, мышам вводили 7,5 мг/кг ScFv 6B5 к церамиду посредством IV, IP, SC или внутримышечной (IM) инъекции за 15 мин до тотального облучения всего организма (TBI) дозой 15 Гр. Мышей умерщвляли через в 3,5 дня после TBI и удаляли секцию проксимального отдела тонкой кишки, разрезали на 3 сегмента 15мм и помещали в 4% параформальдегид. Проксимальные сегменты тонкой кишки подвергали поперечному секционированию, фиксировали, и слайды окрашивали Н&Е перед количественной оценкой выживших крипт в соответствии с методом Витерса и Элкинда (1970). Поскольку кишечные крипты являются местом кишечных стволовых клеток, то анализ микроколоний обычно используют в качестве идентификатора для выживания кишечных стволовых клеток. N=5 мышей на группу.

Фигура 12 представляет собой иллюстрацию того, что антитела h2a2 и ScFv к церамиду защищают и уменьшают отрицательное воздействие летальных последствий радиационного ЖК-синдрома. (левая панель) C57BL6 мышам вводили гуманизированное антитело 2A2 к церамиду (1000 мкг/мышь) посредством внутривенной инъекции или вводили рекомбинантный ScFv 6B5 к церамиду (100 мкг на мышь) посредством подкожной инъекции за 15 мин до тотального облучения всего организма (TBI) дозой 14,5 Гр. Мыши получали 5×106 аутологичных костномозговых клеток через 16 часов после TBI и их отслеживали ежедневно на предмет заболеваемости и смертности. Мышей, которых считали умирающими, немедленно умерщвляли. Данные представляют собой график выживаемости Каплана-Мейера, который анализировали с помощью логрангового критерия. P <0,05 для обоих h2A2 и ScFv групп по сравнению с контролем в виде физиологического раствора. (правая панель). Эксперимент проводили точно так, как показано на левой панели, за исключением введения гуманизированного антитела 2A2 к церамиду (1000 мкг/на мышь) посредством внутривенной инъекции или рекомбинантного ScFv 6B5 к церамиду (100 мкг на мышь) посредством подкожной инъекции через 24 часа после тотального облучения всего организма (TBI) дозой 14,5 Гр. N=5 мышей на группу. P <0,05 для обеих групп, h2A2 и ScFv, по сравнению с контролем в виде физиологического раствора.

Фигура 13 представляет собой иллюстрацию того, что ScFv к церамиду защищает мышей от летального острого криза отторжения трансплантата. Мышам C57BL/6 (MHC гаплотип H2b) вводили PBS или 7,5 мг/кг ScFv 6B5 к церамиду посредством внутривенной инъекции за 15 мин до тотального облучения всего организма (TBI) дробной дозой 1100 сГр. Мыши получали аллогенную трансплантацию костного мозга через 16-20 часов после TBI, состоящую из 5×106 клеток костного мозга (BM) или BM и 2×106 CD5+наивных Т-клеток из донорных мышей B10.BR (MHC гаплотип h2k2). Мыши получали PBS или 7,5 мг/кг ScFv 6B5 к церамиду в дни 4, 8, 12 и 16. Мышей оценивали еженедельно на предмет РТПХ-ассоциированной заболеваемости, включая потерю массы, поражений кожи, гофрирование и потерю меха и кифоз, и отслеживали выживаемость. Данные представляют собой график выживаемости Каплана-Мейера, который анализировали с помощью логрангового критерия. P <0,05 для группы ScFv против контроля в виде физиологического раствора.

Фигура 14 представляет собой иллюстрацию того, что ScFv к церамиду защищает мышиные кишечные стволовые клетки во время летального острого криза отторжения трансплантата. Мышам C57BL/6 (MHC гаплотип H2b) вводили PBS, 50 мг/кг гуманизированного антитела h2A2 или 7,5 мг/кг ScFv 6B5 к церамиду с помощью внутривенной инъекции за 15 мин до тотального облучения всего организма (TBI) дробной дозой 1100 сГр. Мыши получали аллогенную трансплантацию костного мозга через 16-20 часов после TBI, состоящую из 5×106 клеток костного мозга (BM) или BM и 2×106 CD5+наивных Т-клеток из донорных мышей B10.BR (MHC гаплотипа H2k2). Мыши получали PBS или 7,5 мг/кг ScFv 6B5 к церамиду в дни 4 и 8. Мышей умерщвляли на 10-й день после трансплантации, и удаляли секцию проксимального отдела тонкой кишки, разрезали на 3 сегмента 15мм и помещали в 4% параформальдегид. Проксимальные сегменты тонкой кишки подвергали поперечному секционированию, фиксировали, и стекла окрашивали Н&Е перед количественной оценкой выживания крипт в соответствии с методом Витерса и Элкинда (1970). Поскольку кишечные крипты являются местом кишечных стволовых клеток, то анализ микроколоний обычно используется в качестве идентификатора для выживания кишечных стволовых клеток. N=5 мышей на группу.

Фигура 15 представляет собой иллюстрацию того, что антитела к церамиду, h2A2 и ScFv, увеличивают удержание CD4+ и CD8+ лимфоцитов в лимфатических узлах брыжейки. Мышам C57BL/6 (MHC гаплотипа H2b) вводили PBS, 50 мг/кг гуманизированного антитела h2A2 или 7,5 мг/кг ScFv 6B5 к церамиду с помощью внутривенной инъекции за 15 мин до тотального облучения всего организма (TBI) дробной дозой 1100 сГр. Мыши получали аллогенную трансплантацию костного мозга через 16-20 часов после TBI, состоящую из 5×106 клеток костного мозга (только BM) или BM и 2×106 CD5+ наивных Т-клеток из донорных мышей B10.BR (MHC гаплотипа H2k2). Мыши последовательно получали PBS, h2A2 или ScFv 6B5 в дни 4 и 8. Мышей умерщвляли на 10-й день после трансплантации, и лимфатические узлы брыжейки анализировали с помощью проточной цитометрии. Данные представляют собой общее количество CD4+ и CD8+ клеток из общего донорного пула (положительных по H2k2 гаплотипу) CD45+ лимфоцитов. N=5 мышей на группу.

ПОДРОБНОЕ ОПИСАНИЕ

Следующее подробное описание представлено, чтобы позволить любому специалисту в данной области техники осуществить и применить изобретение. Для целей пояснения представлена конкретная номенклатура, чтобы обеспечить полное понимание настоящего изобретения. Однако специалисту в данной области техники будет очевидно, что эти конкретные подробности не требуются для осуществления изобретения. Описания конкретных приложений представлены только в качестве репрезентативных примеров. Подразумевается, что настоящее изобретение не ограничивается представленными воплощениями, но ему должен соответствовать максимально широкий объем, согласующийся с принципами и признаками, раскрытыми в данном документе.

Термин «терапевтически эффективное количество», используемый в данном описании, относится к количеству соединения, которое представляет собой количество, которое достигает целевого биологического или терапевтического эффекта, а именно количество, которое предотвращает, уменьшает или облегчает один или несколько симптомов перечисленных заболеваний, которые подвергаются лечению или предотвращаются.

Термины «лечить», «лечение (treating)» или «лечение (treatment)», используемые в данном описании, относятся к способу облегчения или устранения расстройства и/или сопутствующих его симптомов. Термины «предотвращать», «предотвращение (preventing)» или «предотвращение (prevention)», используемые в данном описании, относятся к способу недопущения приобретения субъектом расстройства и/или сопутствующих его симптомов. В некоторых воплощениях, термины «предотвращать», «предотвращение (preventing)» или «предотвращение(prevention)» относятся к способу снижения риска приобретения расстройства и/или сопутствующих его симптомов.

Используемые в настоящем описании термины «уменьшить отрицательное воздействие», «уменьшение отрицательного воздействия (mitigation)» и «уменьшение отрицательного воздействия (mitigating)» в отношении лечения, относятся к лечению острого нарушения после проявления указанного нарушения, например, уменьшение отрицательного воздействия радиационных повреждений через 24 часа после облучения.

Точно так же, используемые в данном описании термины «защищать», «защита (protection)» и «защита (protecting)» в отношении лечения, относятся к профилактическому введению терапевтического агента для предотвращения или ингибирования нарушения до проявления указанного нарушения.

Используемый в данном описании термин «антитело» относится к молекулам иммуноглобулинов и к иммунологически активным частям молекул иммуноглобулинов (Ig), т.е. молекул, которые содержат антиген-связывающий сайт, который специфично связывается (иммунореактивен) с антигеном. Термин «антитело» используют в самом широком смысле и конкретно он охватывает моноклональные антитела (включая полноразмерные моноклональные антитела), поликлональные антитела, мультиспецифичные антитела (например, биспецифичные антитела), рекомбинантные антитела, такие как ScFv и фрагменты антител, при условии, что они проявляют целевую биологическую активность. Под термином «специфично связывается» или «иммунореактивен с» понимают, что антитело реагирует с одной или несколькими антигенными детерминантами целевого антигена и не реагирует (то есть не связывается) с другими антигенами, включая полипептиды и липиды, или связывается с другими антигенами с гораздо более низкой аффинностью.

Термин «антитело» также включает фрагменты антител, которые содержат часть полноразмерного антитела, как правило, его антигенсвязывающую или вариабельную область. Примеры фрагментов антител включают фрагменты Fab, Fab', F(аb') 2 и Fv-фрагменты; диатела; линейные антитела; одноцепочечный вариабельный фрагмент (ScFv); и мультиспецифичные антитела, образованные из фрагментов антител. В некоторых воплощениях изобретения, фрагмент антитела, но не интактного антитела, используется для увеличения проницаемости ткани или проникновения опухоли. В других воплощениях, фрагмент антитела дополнительно модифицируют для увеличения времени его полужизни в сыворотке.

Термин «моноклональное антитело», используемый в данном описании, относится к антителу, полученному из популяции по существу гомогенных антител, т.е. индивидуальные антитела, составляющие популяцию, являются идентичными за исключением возможных встречающихся в природе мутаций, которые могут присутствовать в незначительных количествах. Моноклональные антитела в данном описании конкретно включают «химерные» антитела, в которых часть тяжелой и/или легкой цепи идентична или гомологична соответствующим последовательностям в антителах, полученных из конкретного вида или принадлежащих к конкретному классу или подклассу антител, а оставшиеся цепи (цепь) идентичны или гомологичны соответствующим последовательностям в антителах, полученных из другого вида или принадлежащих к другому классу или подклассу антител, а также фрагментам таких антител, при условии, что они проявляют целевую биологическую активность.

«Гуманизированные» формы нечеловеческих антител представляют собой химерные антитела, которые содержат минимальную последовательность, полученную из нечеловеческого иммуноглобулина. По большей части, гуманизированные антитела представляют собой человеческие иммуноглобулины (антитело - реципиент), в которых остатки из гипервариабельной области реципиента заменены остатками из гипервариабельной области вида, отличного от человека (донорное антитело), такого как мышь, крыса, кролик или примат, но не человек, обладающими целевой специфичностью, аффинностью и/или способностью. Способы получения гуманизированных и других химерных антител известны в данной области техники.

«Биспецифичные антитела» представляют собой антитела, которые обладают специфичностью связывания, по меньшей мере, для двух различных антигенов. Способы получения биспецифичных антител известны в данной области техники.

Использование «гетероконъюгатных антител» также находится в пределах объема настоящего изобретения. Гетероконъюгатные антитела состоят из двух ковалентно связанных антител. Такие антитела, например, предложены для нацеливания клеток иммунной системы на нежелательные клетки (патент США. 4676980). Предполагается, что антитела могут быть получены in vitro с использованием известных способов в химии синтетических белков, в том числе с участием агентов для поперечной сшивки.

Используемый в данном описании термин «LD 50» относится к «летальной дозе, 50%» или к «средней летальной дозе» и представляет собой количество вещества, необходимое для уничтожения 50% тестовой популяции.

Внеклеточный церамид необходим для радиационно-индуцированного апоптоза.

Липидные рафты, которые представляют собой отличающиеся микродомены цитоплазматической мембраны, состоящие из холестерина, тесно связанного со сфинголипидами, в частности, со сфингомиелином, создавая жидкий упорядоченный домен внутри жидкой неупорядоченной массы цитоплазматической мембраны. Рафты отличаются от окружающей мембраны по своему белковому и липидному составу, вмещая сигнальные молекулы, в том числе множество гликозилфосфатидилинозитол (GPI)-фиксированных белков, дважды ацилированные тирозинкиназы из Src-семейства и трансмембранные белки. Кроме того, рафты служат в качестве мест, через которые множество рецепторов осуществляют транслокацию вовнутрь или наружу после их активации, в том числе В-клеточный рецептор (BCR) при встрече с антигеном. Имеющиеся данные свидетельствуют, что эти события транслокации имеют решающее значение для множества каскадов сигнальной трансдукции.

Сфинголипиды являются структурными компонентами клеточных мембран и важными регуляторами передачи сигнала через генерирование церамида. C16 церамид играет важную роль в дифференцировке, пролиферации и остановке роста. Он также является важным компонентом апоптотических сигналов. Генерирование церамида было идентифицировано как необходимое условие для множественных апоптотических событий, индуцированных цитокином, вирусом/патогеном, воздействием окружающей среды и химиотерапевтическими средствами. Кроме того, области, богатые церамидом, на плазматической мембране клеток-мишеней являются критическими для чувствительности к клеточной смерти, индуцированной цитотоксическими Т-лимфоцитами (CTL).

Лечение и предотвращение летального ЖК-синдрома

Циркулирующие цилиндрические клетки основания крипты (CBC), локализованные в положениях 1-3 от нижнего отдела крипты Люберкюна, недавно были определены в качестве популяции кишечных стволовых клеток. Эта группа клеток размножается и дифференцируется постоянно, пополняя физиологическую потерю энтероцитов и других дифференцированных эпителиальных клеток из верхушки ворсинки, тем самым сохраняя анатомическую и функциональную целостность слизистой оболочки. Полное или почти полное истощение этого отдела, по-видимому, необходимо для необратимого разрушения блока крипты-ворсинки, в то время как выживающие клоногенные стволовые клетки, пусть даже по одной на крипту, способны регенерировать полностью функциональную крипту.

Облучение направленно воздействует как на отделы микроциркуляторного русла желудочно-кишечного тракта, так и на отделы стволовых клеток кишечника. Дисфункция микроциркуляторного русла эндотелия, обнаруженная в виде апоптоза через четыре часа после облучения, представляет собой основное поражение, приводящее к ЖК-синдрому. Эндотелиальная дисфункция преобразует поражения в CBC от сублетальных до летальных, что приводит к потере регенеративных крипт и стимулирует токсичность ЖКТ. Иммуногистохимические исследования и исследования с помощью мечения с использованием [3Н]TdR и BrdUrd показало, что смерть стволовых клеток крипт не происходит внезапно после радиационного облучения. Скорее всего, самый ранний детектируемый ответ реакции является временная дозозависимая задержка в прогрессии через контрольную точку поздней S-фазы и митоза, что, по-видимому, вызвано радиационно-индуцированными двухцепочечными разрывами ДНК (dsb). Быстрая апоптотическая смерть происходит в процессе роста блокированных клеток в течение первых 24 часов после облучения, что при 12 Гр равно 33% от всех причин смерти. В клетках млекопитающих, ДНК dsbs активирует пути распознавания повреждения и репарации ДНК, а также скоординированную регуляцию контрольной точки активности клеточного цикла. Митотический арест кишечных стволовых клеток, по-видимому, представляет собой регулируемое событие в этом пути. Митотическая форма смерти происходит во время этих вторых 24 часов, что составляет 66% от всех причин смерти. Никакие существенные изменения в количестве крипт на кишечный объем не очевидны на данной стадии, хотя размер крипт постепенно снижается из-за продолжения нормальной миграции транзита крипт и дифференцированных клеток из крипты в эпителиальный слой ворсинок и из-за потери верхушки ворсинки. Возобновление митотической активности в течение 12-18 часов связано с быстрым истощением клоногенных стволовых клеток крипт и уменьшением числа крипт на объем.

Летальность клоногенных ЖК стволовых клеток лучше всего оценивать по количеству крипт, выживших через 3,5 дня после радиационного облучения, которое уменьшается в геометрической прогрессии по мере увеличения дозы (C. S. Potten and M. Loeffler, Development 110 (4), 1001 (1990), H. R. Withers, Cancer 28 (1), 75 (1971), and J. G. Maj, F. Paris, A. Haimovitz-Friedman et al., Cancer Res 63, 4338 (2003)). Крипты, которые содержат выжившие стволовые клетки, пролиферируют в ускоренном темпе, создавая типичные регенеративные крипты, которые расщепляются или почкуются с генерацией новых крипт до тех пор, пока слизистая оболочка кишечника не восстановит нормальную структуру. TBI эксперименты на нескольких мышиных моделях продемонстрировали, что количества выживших стволовых клеток крипт после экспонирования 8-12 Гр, как правило, достаточно для поддержания полного восстановления слизистой оболочки. Однако при более высоких дозах массовая гибель клоногенных стволовых клеток может привести к почти полному развалу системы крипта-ворсинки, денудации слизистой оболочки и гибели животного от ЖК-синдрома. Пороговая доза для индукции ЖК-смерти и TBI-доза, приводящая к 50% ЖК-летальности (LD50), по-видимому, является штаммоспецифической. Исследование аутопсии мышей C57BL/6, подвергшихся TBI, обнаружило, что 25% мышей, подвергнутых воздействию 14 Гр, и 100% из тех, кто подвергся 15 Гр, стали жертвами ЖК-синдрома через 6,8 +/- 0,99 дней, прогнозируя LD50 для ЖК-смерти в диапазоне 14 и 15 Гр. В отличие от этого, как сообщалось, LD50D6 (LD50 на 6-й день, выступающей в качестве суррогатного маркера для ЖК-смерти) для BALB/c мышей составляет 8,8 +/- 0,72 Гр, 11,7 +/- 0,22 Гр для мышей BDF1, 12,5 +/- 0,1 Гр для С3Н/He мышей, 14,9 Гр (95% доверительный интервал 13,9-16 Гр) для С3Н/SPF мышей, и 16,4 +/- 0,2 Гр для мышей B6CF1, что указывает на штамм-специфический спектр чувствительности мышей к смерти от ЖК-синдрома. Также сообщалось о вариации штаммов в чувствительности других органов к радиации, таких как костный мозг и легкие.

Классически, проникающее излучение (IR), как считается, убивает клетки путем прямого повреждения геномной ДНК, вызывая нестабильность генома и приводя к смерти репродуктивных клеток. Haimovitz-Friedman et al. (Cancer Res 63, 4338 (2003)) продемонстрировали в безъядерной системе, что апоптотическая сигнальная система может альтернативно генерироваться путем взаимодействия IR с клеточными мембранами. Церамид-опосредованная рафт-кластеризация участвует в IR-индуцированном апоптозе и смерти клоногенных клеток. Давно признано, что клоногенный отдел желудочно-кишечной (ЖК) слизистой является специфической и непосредственной мишенью облучения в индукции ЖК-повреждений.

Один из аспектов настоящей заявки относится к антителу к церамиду или к его антиген-связывающему фрагменту, содержащему: вариабельную область CDR1 тяжелой цепи, состоящую из 10 аминокислот, содержащих Gly в 1-ом положении от N-конца, Tyr или Phe во 2-ом положении от N-конца, Phe или Leu в 4-ом положении от N-конца, и Thr или His в 6-ом положении от N-конца, и His или Asn в 10; вариабельную область CDR2 тяжелой цепи, состоящую из 16-17 аминокислот, содержащую Asn или Ile во 2-ом положении от N-конца, Phe или Ser в 4-ом положении от N-конца, Thr в 9-ом положении от С-конца, Tyr в 7-ом положении от С-конца, Asn в 6-ом положении от С-конца, Lys или Ala во 2-ом и 4-ом положении от С-конца; вариабельную область CDR3 тяжелой цепи, состоящую из 7-11 аминокислот, содержащих Tyr или Thr в 4-ом положении от N-конца; вариабельную область CDR1 легкой цепи, состоящую из 10-16 аминокислот, содержащую Ala или Ser во 2-ом положении от N-конца, Ser в 3-ем положении от N-конца, Ser или Asp в 5-ом положении от N-конца, и Tyr, Ser или Phe в 3-ем положении от C-конца; вариабельную область CDR2 легкой цепи, состоящую из 7 аминокислот, содержащую Ser или Asn в 3-ем положении от N-конца, Lys или Ser в 5-ом положении от N-конца и Ser или Asp в 7-ом положении от N-конца; и вариабельную область CDR3 легкой цепи, состоящую из 9 аминокислот, содержащих Gln, Leu или Trp в 1-ом положении от N-конца, Gln во 2-ом положении от N-конца, Pro в 7-ом положении от N-конца и Thr в 9-ом положении от N-конца.

Используемый в данном описании термин «CDR» относится к «области, определяющей комплементарность» молекулы иммуноглобулина (антитела). CDR представляют собой часть вариабельного домена в антителе, где антитело связывается с его специфическим антигеном. CDR имеют решающее значение для разнообразия антигенных специфичностей, генерируемых лимфоцитами. Существуют три CDR на вариабельный домен (т.е. CDR1, CDR2 и CDR3, в вариабельном домене легкой цепи и CDR1, CDR2 и CDR3, в вариабельном домене тяжелой цепи) в объеме 12 CDR в IgG-молекуле и 60 CDR в IgM-молекуле. В вариабельном домене CDR1 и CDR2 находятся в вариабельной (V) области полипептидной цепи, CDR3 демонстрирует наибольшую вариабельность, поскольку он кодируется посредством рекомбинации VJ в случае области легкой цепи и VDJ в случае областей тяжелой цепи.

В некоторых воплощениях, вариабельная область CDR1 тяжелой цепи антитела к церамиду или его антиген-связывающий фрагмент, содержит аминокислотную последовательность GYTFTDHTIH (SEQ ID NO: 1), причем указанная вариабельная область CDR2 тяжелой цепи содержит последовательность YNYPRDGSTKYNEKFKG (SEQ ID NO: 2), вариабельная область CDR3 тяжелой цепи содержит последовательность GFITTVVPSAY (SEQ ID NO: 3), указанная вариабельная область CDR1 легкой цепи содержит последовательность RASKSISKYLA (SEQ ID NO: 4), вариабельная область CDR2 легкой цепи содержит последовательность SGSTLQS (SEQ ID NO: 5), и указанная вариабельная область CDR3 легкой цепи содержит последовательность QQHNEYPWT (SEQ ID NO: 6).

В других воплощениях, антитело к церамиду или его антиген-связывающий фрагмент содержит: последовательность вариабельной области тяжелой цепи, содержащую последовательность QVQLQQSDAELVKPGASVKISCKVSGYTFTDHTIHWMKQRPEQGLEWIGYNPRDGSTKYNEKFGKATLTDADKSSSTAYMQLNSLTSEDSAVYFCAKGFITTVVPSAYWGQGTLVTVSA (SEQ ID NO: 7), или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области тяжелой цепи, содержащей SEQ ID NO: 7; и/или последовательность вариабельной области легкой цепи, содержащую SEQ ID NO: 8, или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области легкой цепи, содержащей последовательность DVQITQSPSYLAASPGETITINCRASKSISKYLAWYQEKPGKTNKLLIYSGSTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYYCQQHNEYPWTFGGGTKLEIK (SEQ ID NO: 8).

В других воплощениях, вариабельная область CDR1 тяжелой цепи антитела к церамиду или его антиген-связывающего фрагмента содержит последовательность GYAFSSYWMN (SEQ ID NO: 9), причем указанная вариабельная область CDR2 тяжелой цепи содержит последовательность QIYPGDGDTNYNGKFKG (SEQ ID NO: 10), вариабельная область CDR3 тяжелой цепи содержит последовательность RCYYGLYFDV (SEQ ID NO: 11), указанная вариабельная область CDR1 легкой цепи содержит последовательность KASQDINRYLS (SEQ ID NO: 12), вариабельная область CDR2 легкой цепи содержит последовательность RANRLVD (SEQ ID NO: 13), и указанная вариабельная область CDR3 легкой цепи содержит последовательность LQYDEFPYT (SEQ ID NO: 14).

В других воплощениях, антитело к церамиду или его антиген-связывающий фрагмент содержит: последовательность вариабельной области тяжелой цепи, содержащую последовательность QVQLQQSGAELVKPGASVKISCKASGYAFSSYWMNWVKQRPGKGLEWIGQIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCTRRCYYGLYFDVWGTGTTVTVSS (SEQ ID NO: 15), или последовательность, имеющую по меньшей мере, примерно 80%, 85%, 90% или 95% идентичности последовательности с вариабельной областью тяжелой цепи, содержащей SEQ ID NO: 15; и/или последовательность вариабельной области легкой цепи, содержащую последовательность DIKMTQSPSSRYASLGERVTITCKASQDINRYLSWFQQKPGKSPKTLIYRANRLVDGVPSSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEIK (SEQ ID NO: 16), или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области легкой цепи, содержащей SEQ ID NO: 16.

В других воплощениях, вариабельная область CDR1 тяжелой цепи антитела к церамиду или его антиген-связывающий фрагмент содержит последовательность GYTFTSYWMH (SEQ ID NO: 17), причем указанная вариабельная область CDR2 тяжелой цепи содержит последовательность YINPSSGYTKYNQFKD (SEQ ID NO: 18), вариабельная область CDR3 тяжелой цепи содержит последовательность GGYYGFAY (SEQ ID NO: 19), указанная вариабельная область CDR1 легкой цепи содержит последовательность SASSSVSYMY (SEQ ID NO: 20), вариабельная область CDR2 легкой цепи содержит последовательность LTSNLAS (SEQ ID NO: 21), и указанная вариабельная область CDR3 легкой цепи содержит последовательность QQWSSNPLT (SEQ ID NO: 22).

В других воплощениях, антитело к церамиду или его антиген-связывающий фрагмент содержит: последовательность вариабельной области тяжелой цепи, содержащую последовательность QVQLQQSGAELAKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGYINPSSGYTKYNQKFKDKATLTADKSSSTAYMQLSSLTYEDSAVYYCARGGYYGFAYWGQGTLVTVSA (SEQ ID NO: 23), или последовательность, имеющую по меньшей мере, примерно 80%, 85%, 90% или 95% идентичности последовательности с вариабельной областью тяжелой цепи, содержащей SEQ ID NO: 23; и/или последовательность вариабельной области легкой цепи, содержащую последовательность QIVLTQSPALMSASPGEKVTMTCSASSSVSYMYWYQQKPRSSPKPWIYLTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK (SEQ ID NO: 24), или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области легкой цепи, содержащей SEQ ID NO: 24.

В других воплощениях, вариабельная область CDR1 тяжелой цепи антитела к церамиду или его антиген-связывающего фрагмента содержит последовательность GFSLTGYGVH (SEQ ID NO: 25), причем указанная вариабельная область CDR2 тяжелой цепи содержит последовательность VIWSGGSTDYNAAFIS (SEQ ID NO: 26), вариабельная область CDR3 тяжелой цепи содержит последовательность NYGYDYAMDY (SEQ ID NO: 27), указанная вариабельная область CDR1 легкой цепи содержит последовательность RASQSIGTSIH (SEQ ID NO: 28), вариабельная область CDR2 легкой цепи содержит последовательность YASESIS (SEQ ID NO: 29), и указанная вариабельная область CDR3 легкой цепи содержит последовательность QQSNSWPFT (SEQ ID NO: 30).

В других воплощениях, антитело к церамиду или его антиген-связывающий фрагмент содержит: последовательность вариабельной области тяжелой цепи, содержащую SEQ ID NO: 31, или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с вариабельной областью тяжелой цепи, содержащей последовательность QVQLKQSGPGVQPSSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCARNYGYDYAMDYWGQGTSVTVSS (SEQ ID NO: 31); и/или последовательность вариабельной области легкой цепи, содержащую последовательность DILLTQSPAILSVSPGERVSF SCRASQSIGTSIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNSWPFTFGSGTKLEIK (SEQ ID NO: 32), или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области легкой цепи, содержащей SEQ ID NO: 32.

Еще в других воплощениях, вариабельная область CDR1 тяжелой цепи антитела к церамиду или его антиген-связывающего фрагмента содержит последовательность GYTFTNYWMH (SEQ ID NO: 33), причем указанная вариабельная область CDR2 тяжелой цепи содержит последовательность AIYPGDSDTSYNQKFKG (SEQ ID нЕТ: 34), вариабельная область CDR3 тяжелой цепи содержит последовательность GLYYGYD (SEQ ID NO: 35), указанная вариабельная область CDR1 легкой цепи содержит последовательность KSSQSLIDSDGKTFLN (SEQ ID NO: 36), вариабельная область CDR2 легкой цепи содержит последовательность LVSKLDS (SEQ ID NO: 37), и указанная вариабельная область CDR3 легкой цепи содержит последовательность WQGTHFPYT (SEQ ID NO: 38).

В других воплощениях, антитело к церамиду или его антиген-связывающий фрагмент содержит: последовательность вариабельной области тяжелой цепи, содержащую последовательность EVQLQQSGTVLARPGASVKMSCKASGYTFTNYWMHWVKQRPVQGLEWIGAIYPGDSDTSYNQKFKGKAKLTAVTSTSTAFMELSSLTNEDSAVYYCTGLYYGYDWGQGTTLTVSS (SEQ ID NO: 39), или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области тяжелой цепи, содержащей SEQ ID NO: 39; и/или последовательность вариабельной области легкой цепи, содержащей SEQ ID NO: 40, или последовательность, имеющую по меньшей мере примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области легкой цепи, содержащей последовательность DVLMTQTPLTLSVTIGQPASISCKSSQSLIDSDGKTFLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGLYYCWQGTHFPYTFGGGTKLEIK (SEQ ID NO: 40).

Еще в других воплощениях, антитело к церамиду или его антиген-связывающий фрагмент содержит: а) последовательность вариабельной области тяжелой цепи, содержащую последовательность, выбранную из группы, состоящей из SEQ ID NO: 7, 15, 23, 31 и 39, или последовательность, имеющую по меньшей мере, примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области тяжелой цепи, содержащей последовательность, выбранную из группы, состоящей из SEQ ID NO: 7, 15, 23, 31 и 39; и/или а) последовательность вариабельной области легкой цепи, содержащую последовательность, выбранную из группы, состоящей из SEQ ID NO: 8, 16, 24, 32 и 40, или последовательность, имеющую по меньшей мере, примерно 80%, 85%, 90% или 95% идентичности последовательности с последовательностью вариабельной области легкой цепи, содержащей последовательность, выбранную из группы, состоящей из SEQ ID NO: 8, 16, 24, 32 и 40.

В конкретных воплощениях, антитело к церамиду выбрано из группы, состоящей из моноклонального антитела, химерного антитела, гуманизированного антитела, человеческого антитела, рекомбинантного антитела и ScFv.

Другой аспект настоящего изобретения относится к одноцепочечному вариабельному фрагменту (ScFv) антитела к церамиду, который связывается с той же антигенной детерминантой, что и антитело к церамиду настоящего изобретения. ScFv содержит: вариабельную область CDR1 тяжелой цепи, состоящую из 10 аминокислот, содержащих Gly в 1, Tyr или Phe во 2-ом положении от N-конца, Phe или Leu в 4-ом положении от N-конца и Thr или His в 6-ом положении от N-конца и His или Asn в 10-ом положении от N-конца; вариабельную область CDR2 тяжелой цепи, состоящую из 16-17 аминокислот, содержащую Asn или Ile во 2-ом положении от N-конца, Phe или Ser в 4-ом положении от N-конца, Thr в 9-ом положении от С-конца, Tyr в 7-ом положении от С-конца, Asn в 6-ом положении от С-конца, Lys или Ala во 2-ом и 4-ом положении от С-конца; вариабельную область CDR3 тяжелой цепи, состоящую из 7-11 аминокислот, содержащих Tyr или Thr в 4-ом положении от N-конца; вариабельную область CDR1 легкой цепи, состоящую из 10-16 аминокислот, содержащую Ala или Ser во 2-ом положении от N-конца, Ser в 3-ем положении от N-конца, Ser или Asp в 5-ом положении от N-конца, и Tyr, Ser или Phe в 3-ем положении от C-конца; вариабельную область CDR2 легкой цепи, состоящую из 7 аминокислот, содержащую Ser или Asn в 3-ем положении от N-конца, Lys или Ser в 5-ом положении от N-конца и Ser или Asp в 7-ом положении от N-конца; и вариабельную область CDR3 легкой цепи, состоящую из 9 аминокислот, содержащих Gln, Leu или Trp в 1-ом положении от N-конца, Gln во 2-ом положении от N-конца, Pro в 7-ом положении от N-конца и Thr в 9-ом положении от N-конца.

Одноцепочечный вариабельный фрагмент (ScFv) не является фактическим фрагментом антитела, но вместо этого представляет собой слитый белок, состоящий из вариабельных областей тяжелой (VH) и легкой (VL) цепи иммуноглобулина, связанных посредством короткого линкерного пептида, состоящего примерно из 10-25 аминокислот. Линкер, как правило, богат глицином для гибкости, а также серином или треонином для растворимости, и может либо связывать N-конец VH с С-концом VL, или наоборот. ScFv сохраняет специфичность исходного иммуноглобулина, несмотря на удаление константных областей и введение линкера.

В некоторых воплощениях, антитела к церамиду, их антиген-связывающие фрагменты, или ScFv получают с использованием технологий рекомбинантной ДНК. Процедуры для экспрессии и очистки рекомбинантных белков хорошо известны в данной области техники.

Для того чтобы проэкспрессировать антитело к церамиду, его антиген-связывающий фрагмент или ScFv по настоящему изобретению в биологической системе, конструируют полинуклеотид, который кодирует антитело к церамиду, его антиген-связывающий фрагмент, или ScFv. В некоторых воплощениях, рекомбинантный полинуклеотид оптимизирован по кодонам для экспрессии в выбранной прокариотической или эукариотической клетке-хозяине, такой как бактериальная, клетка млекопитающих, клетка растений или клетка насекомых. Для облегчения репликации и экспрессии, полинуклеотид может быть включен в вектор, такой как прокариотической или эукариотической экспрессирующий вектор. Хотя полинуклеотид, раскрытый в настоящем описании, может быть включен в любой из множества векторов (включающих, например, бактериальные плазмиды; фаговую ДНК; бакуловирус; дрожжевые плазмиды, векторы, полученные из комбинаций плазмидной и фаговой ДНК, вирусную ДНК, такую как ДНК осповакцины, аденовируса, вируса оспы, псевдобешенства, аденовируса, адено-ассоциированного вируса, ретровирусов и многих других), чаще всего вектор будет представлять собой экспрессирующий вектор, подходящий для создания полипептидного продукта экспрессии. В экспрессирующем векторе, полинуклеотид, кодирующий антитело к церамиду, его антиген-связывающий фрагмент, или ScFv, как правило, расположен в непосредственной близости и в ориентации к соответствующей последовательности контроля транскрипции (промотор и, необязательно, один или несколько энхансеров) для направления синтеза мРНК. То есть, представляющая интерес полинуклеотидная последовательность функционально связана с соответствующей последовательностью контроля транскрипции. Примеры таких промоторов включают: немедленный ранний промотор CMV, LTR или SV40 промотор, промотор полиэдрина бакуловируса, E.coli lac или trp промотор, промотор фага Т7 и лямбда PL и другие промотеры, которые, как известно, контролируют экспрессию генов в прокариотических или эукариотических клетках или в их вирусах. Экспрессирующий вектор, как правило, также содержит сайт связывания рибосом для инициации трансляции и терминатор транскрипции. Вектор необязательно включает соответствующие последовательности для усиления экспрессии. Кроме того, экспрессирующие векторы, необязательно, содержат один или несколько генов маркеров селекции для обеспечения фенотипического признака для селекции трансформированных клеток-хозяев, таких генов, как ген дигидрофолатредуктазы или устойчивости к неомицину для эукариотической клеточной культуры, или таких как тетрациклин или ген устойчивости к ампициллину в E.coli.

Экспрессирующий вектор также может включать дополнительные элементы экспрессии, например, для повышения эффективности трансляции. Эти сигналы могут включать, например, инициирующий кодон ATG и смежные последовательности. В некоторых случаях, например, кодон инициации трансляции и связанные с ними элементы последовательности встраивают в соответствующий экспрессирующий вектор одновременно с полинуклеотидной последовательностью, представляющей интерес (например, с нативным старт-кодоном). В таких случаях не требуются дополнительные сигналы контроля трансляции. Однако, в тех случаях, когда встроена только последовательность, кодирующая полипептид, или его часть, тогда для экспрессии антитела к церамиду или ScFv обеспечиваются экзогенные сигналы контроля трансляции, включающие инициирующий кодон ATG. Инициирующий кодон помещают в корректной рамке считывания, чтобы гарантировать трансляцию полинуклеотидной последовательности, представляющей интерес. Экзогенные транскрипционные элементы и инициирующие кодоны могут иметь различное происхождение, как природное, так и синтетическое. Если необходимо, эффективность экспрессии может быть дополнительно увеличена за счет включения энхансеров, подходящих для использующихся систем клеток.

Экспрессирующие векторы, несущие антитело к церамиду или ScFv по настоящему изобретению, могут быть введены в клетки-хозяева с помощью любой из множества хорошо известных процедур, таких как электропорация, трансфекция, опосредованная липосомами, кальций-фосфатное осаждение, инфекция, трансфекция и тому подобное, в зависимости от выбора векторов и клеток-хозяев.

Таким образом, клетки-хозяева, содержащие антитело к церамиду, его антиген-связывающий фрагмент или ScFv-кодирующие нуклеиновые кислоты, также являются признаками настоящего изобретения. Подходящие клетки-хозяева включают прокариотические (т.е., бактериальные) клетки-хозяева, такие как E.coli, а также многочисленные эукариотические клетки-хозяева, включающие грибные клетки (например, дрожжи, такие как Saccharomyces cerevisiae и Picchia pastoris), клетки насекомых, клетки растений, и клетки млекопитающих (например, клетки СНО).

Клетки-хозяева могут культивироваться в стандартных питательных средах, модифицированных соответствующим образом для активации промоторов, селекции трансформантов или амплификации встроенных полинуклеотидных последовательностей. Условия культивирования, такие как температура, рН и т.п., как правило, такие, которые ранее использовались для клеток-хозяев, выбранных для экспрессии, и они будут очевидны специалистам в данной области. Клетку-хозяина необязательно выбирают по ее способности модулировать экспрессию встроенных последовательностей или процессировать экспрессированный белок в желаемой форме. Такие модификации белка включают, но не ограничиваются этим, гликозилирование, (а также, например, ацетилирование, карбоксилирование, фосфорилирование, липидирование и ацилирование). Посттрансляционный процессинг, например, который расщепляет форму предшественника до зрелой формы белка (например, с помощью в фуринпротеазы), необязательно выполняется в контексте клетки-хозяина. Различные клетки-хозяева, такие как 3Т3, COS, CHO, HeLa, BHK, MDCK, 293, WI38 и т.д. имеют специфический клеточный аппарат и характерные механизмы для таких посттрансляционных активностей, и могут быть выбраны для обеспечения корректной модификации и процессирования введенного чужеродного белка.

Для продолжительного продуцирования с высоким выходом рекомбинантного антитела к церамиду, его антиген-связывающего фрагмента или ScFv-полипептида, как правило, используют системы стабильной экспрессии. Например, полинуклеотиды, кодирующие антитело к церамиду, его антиген-связывающий фрагмент, или ScFv, вводят в клетку-хозяина с использованием экспрессирующих векторов, которые содержат вирусные сайты инициации репликации или эндогенные элементы экспрессии и ген маркера селекции. После введения вектора клетки могут расти в течение 1-2 дней в обогащенной среде, прежде чем их переключают на селективную среду. Целью маркера селекции является придание устойчивости к селекции, и его присутствие дает возможность роста и выделения клеток, которые успешно экспрессируют введенные последовательности. Например, устойчивые группы или колонии стабильно трансформированных клеток могут быть подвергнуты пролиферации методами культивирования клеточных культур, которые соответствуют типу клеток. Клетки-хозяева, трансформированные нуклеиновой кислотой, кодирующей антитело к церамиду, его антиген-связывающий фрагмент, или ScFv необязательно культивируют в условиях, подходящих для экспрессии и выделения кодируемого белка из клеточной культуры.

После трансдукции подходящей линии клеток-хозяев и их роста до соответствующей плотности клеток выбранный промотор индуцируют с помощью соответствующих средств (например, сдвигом температуры или химической индукцией), и клетки культивируют в течение дополнительного периода времени. Секретированный полипептидный продукт затем извлекают из культуральной среды. Альтернативно, клетки могут быть собраны центрифугированием, разрушены физическими или химическими средствами, и полученный неочищенный экстракт может быть сохранен для дальнейшей очистки. Эукариотические или микробные клетки, используемые для экспрессии белков, могут быть разрушены любым удобным способом, включая замораживание-оттаивание, обработку ультразвуком, механическое разрушение или использование агентов, лизирующих клетки, или другими методами, которые хорошо известны специалистам в данной области.

Экспрессированное антитело к церамиду, его антиген-связывающая фрагмент или ScFv могут быть выделены и очищены из рекомбинантных клеточных культур с помощью любого из ряда методов, хорошо известных в данной области, включая осаждение сульфатом аммония или этанолом, экстракцию кислотой, анионообменную или катионообменную хроматографию, фосфоцеллюлозную хроматографию, гидрофобную хроматографию, аффинную хроматографию (например, с использованием любой из систем маркировки, отмеченной в настоящем документе), гидроксилаппатитную хроматографию и хроматографию с лектином. Стадии рефолдинга белка могут быть использованы по желанию для завершения конфигурации зрелого белка. И, наконец, на заключительных стадиях очистки может быть использована высокоэффективная жидкостная хроматография (ВЭЖХ).

В некоторых примерах нуклеиновые кислоты вводят в векторы, подходящие для введения и экспрессии в прокариотических клетках, например, в клетках E.coli. В некоторых воплощениях настоящего изобретения, экспрессирующий вектор вводят (например, путем электропорации) в подходящий бактериальный хозяин. В другом примере, полинуклеотидную последовательность, которая кодирует антитело к церамиду или ScFv, вводят в клетки насекомых с использованием экспрессирующего вектора бакуловирусной системы экспресси (BEVS). Аналогично, могут быть использованы альтернативные клетки насекомых, такие как SF21, которые тесно связаны с SF9, и клеточная линия High Five (Hi5), полученная из капустной совки, Trichoplusia Ni.

В других воплощениях, антитело к церамиду, его антиген-связывающий фрагмент, или ScFv экспрессируются in vivo с помощью плазмидного вектора или вирусного вектора.

В некоторых воплощениях, антитела к церамиду, их антиген-связывающие фрагменты и ScFv получают путем химического синтеза. Вкратце, антитело к церамиду, его антиген-связывающий фрагмент, или ScFv могут быть синтезированы путем конденсации карбоксильной группы или С-конца одной аминокислоты с аминогруппой или N-концом другой аминокислоты. Из-за возможных непреднамеренных реакций, могут быть необходимы защитные группы. Химический синтез пептидов начинается на С-конце пептида и заканчивается на N-конце. В отличие от биосинтеза белка, который начинается на N-конце.

В некоторых воплощениях, антитела к церамиду, их антиген-связывающие фрагменты, и ScFv могут быть синтезированы с использованием традиционного жидкостного или твердофазного синтеза. Fmoc и трет-Вос твердофазный пептидный синтез (SPPS) может быть использован для наращивания пептидов от C- к N-концу. В некоторых воплощениях, последняя добавляемая в реакционную смесь «аминокислота» пегилирована. Эта последняя аминокислота часто упоминается как карбоксил-ПЭГ-амин, карбоксил-ПЭО-амин или амин-PEG-кислота, в результате чего амин блокируется для защиты от реакции, и кислота может свободно реагировать с аминогруппой аминокислоты, ранее добавленной в реакционную смесь. ПЭГ (полиэтиленгликоль) и ПЭО (полиэтиленоксид) представляют собой полимеры, состоящие из повторяющихся субъединиц этиленгликоля и мономеров этиленоксида. В одном воплощении, пегилированное антитело к церамиду, его антиген-связывающие фрагменты, и ScFv будут содержать компонент ПЭГ, связанный с остатком гистидина (Н) на амино-конце полипептида. В одном воплощении компонент ПЭГ составляет по размеру от 5 до 30 кДа. В другом воплощении, компонент ПЭГ составляет по размеру от 10 до 20 кДа.

В дополнение к использованию пэгилированной концевой аминокислоты в процессе синтеза, антитело к церамиду, его антиген-связывающий фрагмент или ScFv может быть пэгилирован путем присоединения ПЭГ. Пэгилирование представляет собой процесс ковалентного присоединения полимерных цепей полиэтиленгликоля к другой молекуле, как правило, к лекарственному средству или терапевтическому белку. Пегилирование может быть выполнено путем инкубирования реактивного производного ПЭГ с целевым антителом к церамидум или ScFv. Ковалентное присоединение ПЭГ к антителу к церамиду или ScFv может «замаскировать» антитело к церамиду, его антиген-связывающий фрагмент или ScFv от иммунной системы хозяина (снижение иммуногенности и антигенности), увеличить гидродинамический размер (размер в растворе) антитела к церамиду, его антиген-связывающего фрагмента или ScFv, что продлевает время его циркуляции за счет снижения почечного клиренса. Пегилирование также может обеспечить растворимость в воде гидрофобных белков.

Способ ингибирования апоптоза

Еще один аспект настоящего изобретения относится к способу ингибирования клеточной смерти у субъекта, нуждающегося в этом, включающий введение указанному субъекту терапевтически эффективного количества антитела к церамиду или его антиген-связывающего фрагмента по настоящему изобретению. В некоторых воплощениях, антитело к церамиду представляет собой ScFv к церамиду.

В некоторых воплощениях, клеточная смерть связана с заболеванием, выбранным из группы, состоящей из реакции трансплантат против хозяина, лучевой болезни, ЖК-синдрома и аутоиммунного заболевания. В некоторых других воплощениях, заболевание представляет собой лучевую болезнь или ЖК-синдром, и антитело к церамиду или его антиген-связывающий фрагмент вводят до того, как субъект подвергается воздействию радиации.

Другой аспект настоящего изобретения относится к способу уменьшения отрицательного воздействия клеточной смерти при ЖК-синдроме у субъекта, нуждающегося в этом. Способ включает в себя введение эффективного количества антитела к церамиду. В некоторых воплощениях, способ включает введение указанного антитела к церамиду указанному субъекту сразу же после воздействия на указанный субъект проникающей радиации. В других воплощениях, способ включает введение указанного антитела к церамиду указанному субъекту в течение одного часа после воздействия на указанный субъект проникающей радиации. В других воплощениях, способ включает введение указанного антитела к церамиду указанному субъекту в течение 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 или 18 часов после воздействия на указанный субъект проникающей радиации. В конкретном воплощении, способ включает введение указанного антитела к церамиду указанному субъекту в течение 24 часов после воздействия на указанный субъект проникающей радиации. В других воплощениях, способ включает введение указанного антитела к церамиду указанному субъекту в течение 30, 36, 42, 48, 54, 60, 66 или 72 часов после воздействия на указанный субъект проникающей радиации. В других воплощениях, способ включает введение указанного антитела к церамиду указанному субъекту в течение 48, 36, 24, 18, 12, 10, 8, 6, 4, 2 или 1 часа(ов), или в течение 45, 30 или 15 минут до воздействия на указанный субъект проникающей радиации.

В других дополнительных воплощениях, заболевание представляет собой реакцию трансплантат против хозяина, и антитело к церамиду или его антиген-связывающий фрагмент вводят до того, как пациент получает трансплантат. В некоторых воплощениях, трансплантат представляет собой трансплантат костного мозга. В других дополнительных воплощениях, антитело к церамиду или его антиген-связывающий фрагмент, вводят после того, как субъект получает трансплантат, но до начала реакции трансплантат против хозяина. Еще в других дополнительных воплощениях, антитело к церамиду или его антиген-связывающий фрагмент вводят субъекту, нуждающемуся в этом, после начала реакции трансплантат против хозяина в количестве, эффективном для уменьшения отрицательного воздействия апоптоза при реакции трансплантат против хозяина.

Введение антитела

Антитело или его антиген-связывающий фрагмент могут вводиться субъекту известными способами, такими как внутривенное введение в виде болюса или путем непрерывной инфузии в течение некоторого периода времени, путем внутримышечного, внутрибрюшинного, интрацереброспинального, подкожного, внутрисуставного, внутрисиновиального, интратекального, перорального, местного или ингаляционного пути введения.

Антитела и их антиген-связывающие фрагменты могут вводиться в общепринятых фармацевтически приемлемых носителях. Приемлемые носители включают, но не ограничиваются ими, физиологический раствор, буферный физиологический раствор, глюкозу в физиологическом растворе. Твердые подложки, липосомы, наночастицы, микрочастицы, наносферы или микросферы также могут быть использованы в качестве носителей для введения антител или их антиген-связывающих фрагментов.

Подходящая доза («терапевтически эффективное количество») антитела или его антиген-связывающего фрагмента будет зависеть, например, от заболевания, подлежащего лечению, тяжести и течения заболевания, от того, вводят антитело для профилактики или для терапевтических целей, от предшествующей терапии, истории болезни пациента и реакции на антитело, типа используемого антитела или его антиген-связывающего фрагмента, и от решения лечащего врача. Антитело или его антиген-связывающий фрагмент соответствующим образом вводят пациенту за одну или в течение нескольких обработок и могу вводиться пациенту в любое время с момента постановки диагноза и после этого. Антитело или его антиген-связывающий фрагмент можно вводить в качестве единственного лечения или в сочетании с другими лекарственными средствами или терапиями, пригодными для лечения заболевания, о котором идет речь.

В качестве общего предложения, терапевтически эффективное количество вводимого антитела или его антиген-связывающего фрагмента будет находиться в диапазоне примерно от 1 нг/кг массы тела/сутки примерно до 100 мг/кг массы тела/сутки либо с помощью одного, либо нескольких введений. В конкретных воплощениях, диапазон вводимого антитела составляет примерно от 1 нг/кг массы тела/сутки примерно до 1 мкг/кг массы тела/сутки, от 1 нг/кг массы тела/сутки примерно до 100 нг/кг массы тела/сутки, от 1 нг/кг массы тела/сутки примерно до 10 нг/кг массы тела/сутки, от 10 нг/кг массы тела/сутки примерно до 1 мкг/кг массы тела/сутки, от 10 нг/кг массы тела/сутки примерно до 100 нг/кг массы тела/сутки, от 100 нг/кг массы тела/сутки примерно до 1 мкг/кг массы тела/сутки, от 100 нг/кг массы тела/сутки примерно до 10 мкг/кг веса тела/сутки, от 1 мкг/кг массы тела/сутки примерно до 10 мкг/кг массы тела/сутки, от 1 мкг/кг массы тела/сутки примерно до 100 мкг/кг массы тела/сутки, от 10 мг/кг массы тела/сутки примерно до 100 мкг/кг массы тела/сутки, от 10 мг/кг массы тела/сутки примерно до 1 мг/кг массы тела/сутки, от 100 мкг/кг массы тела/сутки примерно до 10 мг/кг массы тела/сутки, от 1 мг/кг массы тела/сутки примерно до 100 мг/кг массы тела/сутки и от 10 мг/кг массы тела/сутки примерно до 100 мг/кг массы тела/сутки.

В другом воплощении, антитело или его антиген-связывающий фрагмент вводят в интервале доз 1 нг-10 нг на инъекцию, 10 нг-100 нг на инъекцию, 100 нг-1 мкг на инъекцию, 1 мкг-10 мкг на инъекцию, 10 мкг-100 мкг на инъекцию, 100 мкг -1 мг на инъекцию, 1 мг-10 мг на инъекцию, 10 мг-100 мг на инъекцию, и 100 мг-1000 мг на инъекцию.

В другом конкретном воплощении, диапазон доз вводимого антитела или его антиген-связывающего фрагмента составляет примерно от 1 нг/кг примерно до 100 мг/кг. Еще одном конкретном воплощении, диапазон вводимого антитела составляет примерно от 1 нг/кг примерно до 10 нг/кг, примерно от 10 нг/кг примерно до 100 нг/кг, примерно от 100 нг/кг примерно до 1 мкг/кг, примерно от 1 мкг/кг примерно до 10 мкг/кг, примерно от 10 мкг/кг примерно до 100 мкг/кг, примерно от 100 мкг/кг примерно до 1 мг/кг, примерно от 1 мг/кг примерно до 10 мг/кг, примерно от 10 мг/кг примерно до 100 мг/кг, примерно от 0,5 мг/кг примерно до 30 мг/кг, и примерно от 1 мг/кг примерно до 15 мг/кг.

В других конкретных воплощениях, количество вводимого антитела или его антиген-связывающего фрагмента составляет или примерно составляет 0,0006, 0,001, 0,003, 0,006, 0,01, 0,03, 0,06, 0,1, 0,3, 0,6, 1, 3, 6, 10, 30, 60, 100, 300, 600 и 1000 мг/сутки. Как и следовало ожидать, дозировка будет зависеть от заболевания, размера, возраста и состояния пациента.

Антитело или его антиген-связывающий фрагмент могут быть введены в соответствующих случаях или как указано с помощью разовой дозы в виде болюса или путем непрерывной инфузии, или в виде нескольких доз с помощью болюсного введения или непрерывной инфузии. Несколько доз могут вводиться, например, несколько раз в день, один раз в день, каждые 2, 3, 4, 5, 6 или 7 дней, еженедельно, каждые 2, 3, 4, 5 или 6 недель или ежемесячно. Однако могут быть полезны другие схемы приема лекарственных средств. Прогресс этой терапии легко контролировать обычными методами.

Настоящее изобретение далее иллюстрируется следующими примерами, которые не следует рассматривать как его ограничение. Содержание всех ссылок, патентов и опубликованных патентных заявок, цитируемых в данной заявке, а также Фигуры и Таблицы включены в настоящее описание в качестве ссылки.

Пример 1: ГУМАНИЗАЦИЯ И ПОЛУЧЕНИЕ Ат 2A2

Клонирование вариабельной области легкой и тяжелой цепи 2А2 из гибридомы

Клетки гибридомы 2A2 собирали центрифугированием и суммарную РНК экстрагировали из клеток с использованием набора для очистки РНК. Эту суммарную РНК использовали для синтеза кДНК и, наконец, гены V-области 2А2 выделяли с использованием наборов праймеров, опубликованных в «Phage display manual». ФИГ. 1А демонстрирует вариабельные последовательности тяжелой (VH) и легкой цепи (VL) из 2А2.

Гуманизация вариабельной области 2А2

Как правило, антитела грызунов могут быть иммуногенными для человека и вызывать очень серьезные побочные эффекты, в том числе HAMA (человеческие антитела против мышиных белков) реакцию или анафилактический шок. Чтобы преодолеть эту проблему, использовали генетическую инженерию антитела для гуманизации антител, отличных от человеческих. Таким образом, метод пересадки CDR был использован для гуманизации VL и VH из 2А2.

Пересадка CDR в настоящее время представляет собой наиболее часто используемую стратегию гуманизации мАт грызунов. При таком подходе, CDR-петли, которые составляют антиген-связывающий сайт мАт грызуна, прививают на соответствующие каркасные области человека.

Для идентификации человеческих VL и VH, гомологичной таковым в 2А2, вариабельные области 2А2 сравнивали с вариабельными областями последовательностей человеческой зародышевой линии, используя он-лайн базу данных VBASE (vbase.mrc-cpe.cam.ac.uk). В результате были найдены две человеческие зародышевые последовательности VL и VH. Выравнивание аминокислотных последовательностей клонов 2A2 и человеческой зародышевой последовательности показано на ФИГ. 1B.

Выбранная последовательность 2A2 VH, как было установлено, наиболее гомологична человеческому V-гену 1-46 из семейства VH1 и человеческому J-гену JH6. Выбранная последовательность VL 2A2, как было установлено, наиболее гомологична человеческому V-гену A1 из семейства Vk2 и человеческому J-гену Jk2. Таким образом, синтезированные VL и VH, каждая из которых содержала три мышиных CDR последовательности, пересаживали на выбранные человеческие каркасные последовательности для гуманизации мАт 2A2.

Конструирование вектора для экспрессии гуманизированных 2A2 IgG1 в клетках млекопитающих

мАт 2A2 изначально представляет собой мышиный IgM. IgM-антитела преобразуются в формат IgG1, поскольку IgG1 является наиболее распространенным в сыворотке (9 мг/мл), период его полужизни (21 день) больше, чем у любых других антител, и, в настоящее время, большинство коммерческих терапевтических антител имеет IgG1 формат. Для конструирования гуманизированного 2A2 IgG1 в экспрессирующем векторе млекопитающих использовали векторы pOptiVEC и pcDNA 3.3 (Invitrogen).

Вектор для экспрессии гуманизированных 2A2 IgG1 в клетках млекопитающих

Иллюстративный вектор содержит немедленный ранний промотор/энхансер человеческого цитомегаловируса (CMV) для высокого уровня экспрессии рекомбинантных белков в широком диапазоне клеток млекопитающих. Для конструирования гуманизированного 2A2 IgG1 синтезировали вариабельную область легкой цепи человека и вариабельную область тяжелой цепи человека, каждую с тремя CDR мышиного 2А2, и эти два фрагмента ДНК связывали с человеческой константной областью легкой и тяжелой цепи с помощью ПЦР. И, наконец, легкую цепь гуманизированного 2A2 клонировали в вектор pcDNA3.3 TOPO, а тяжелую цепь гуманизированного 2А2 клонировали в вектор pOptiVEC TOPO для экспрессии антитела. Последовательности человеческого 2A2 IgG1 показаны на ФИГ. 2А-В, на которых показано, что первая аминокислота (аргинин, затенение красным цветом) константной области человеческой легкой цепи была пропущена во время конструирования всей гуманизированной легкой цепи. После конструирования этих векторов, экспрессирующих человеческие 2A2, плазмидную ДНК котрансфицировали в полученные из CHO DHFR-отрицательные клетки DG44 для создания стабильной клеточной линии, которая продуцирует 2A2 hIgG1 антитело.

Развитие стабильных клеточных линий для продуцирования антител

Для получения клеточных линий, которые продуцируют высокий уровень антител отбирали пул стабильно трансфецированных клеток путем проведения двух циклов селекции с использованием среды CD-OptiCHO и CD-OptiCHO среду с 500 мкг/мл Женетицина, с последующей геномной амплификацией селекции с MTX и с проведением двух раундов одноклеточной клональной селекции в полутвердой среде в 96-луночном планшете. Уровни экспрессии антител подвергали скринингу с помощью тИФА-анализа для количественного определения, и селектированные клеточные линии h2A2IgG1-CHO (G3A10, C5G6 и D5F11) медленно наращивали.

ПРИМЕР 2: ПОЛУЧЕНИЕ ДОПОЛНИТЕЛЬНЫХ АНТИТЕЛ К ЦЕРАМИДУ

Панель моноклональных антител генерировали для использования в исследованиях повторного введения на мышах для изучения иммуногенности. Скрининг гибридом для селекции МАт к церамиду проводили методом тИФА с использованием антигена (Омега-СООН С16-церамид, конденсированный с альбумином). Положительные случаи скринировали против обоих, БСА и Омега-COOH С16-дигидроцерамида в сочетании с альбумином. Затем проводили биологическое тестирование МАт (in vitro ингибирование апоптоза клеток Jurkat, in vivo ингибирование радиационного ЖК-синдрома). Клоны, обозначенные 9H10, 9H11, 9A2, 7B10, 6B5 и 6C8, были отобраны для тестирования, и все, кроме 9A2, продемонстрировали биологическую активность in vitro. Как показано в Таблице 1, панель клонов преимущественно связываются С16:0 карбоксицерамид-БСА. Ag1 представляет собой С16:0 карбоксицерамид-БСА с покрытием @ 300 нг/на лунку, Ag2 С-16:0 дигидрокарбоксицерамид-БСА с покрытием @ 300 нг/на лунку и Ag3 представляет собой свободный БСА (Sigma A6003) с покрытием @ 300 нг/на лунку.

Таблица 1 мАт к церамиду

Клон # Ag1 OD (IgG (гамма)) AG1 OD (IgM (Mμ)) Ag2 OD (гамма) Ag3 OD (гамма)
Б, 2,4 2,4 2,4 1,295
7E8 1,530 0,045 0,077 0,906
8H8 +3,000 0,103 0,098 +3,000
9A2 +3,000 0,055 0,078 +3,000
7B10 0,080 0,180 0,078 0,077
9H10 0,052 0,230 0,064 0,095
9H11 0,045 0,343 0,047 0,105
6C8 0,192 0,039 0,049 0,098
NC 0,047 0,066 0,048 0,096
PC +3,000 0,067 0,070 +3,000
NC=50% культуральной среды+50% 5% молоко/PBS
PC=Мышиная сердечная сыворотка # 1 @ 1:1K

Клоны 6B5 и 6C8 были идентифицированы как IgG, в то время как клоны 7B10, 9H10 и 9H11 были идентифицированы как IgM. Дополнительные данные для тех, которые идентифицированы как IgG, содержатся в Таблице 2. Ag1 представляет собой С16:0 карбоксицерамид-БСА с покрытием @ 500 нг/на лунку в бикарбонате натрия, Ag2 представляет собой С-16:0 дигидро-карбоксицерамид-БСА с покрытием @ 500 нг /на лунку в бикарбонате натрия и Ag3 представляет собой свободный БСА (Sigma A6003) с покрытием @ 500 нг/на лунку в бикарбонате натрия.

Таблица 2 - Кривая концентраций мАт к церамиду

Клон # разведение Ат AG1 (гамма) AG1 (Mμ) Ag2 (гамма) Ag2 (Mμ) Ag3 (гамма) Ag3 (Mμ)
6B5 (0,99мг/мл) 10 мкг/мл 2,4 0,072 0,150
6B5 (0,99мг/мл) 1 мг/мл 0,399 0,089 0,119
6B5 (0,99мг/мл) 0,1 мг/мл 0,147 0,072 0,079
6C8 (0,79мг/мл) 10 мг/мл 0,119 0,073 0,062
6C8 (0,79мг/мл) 1 мг/мл 0,057 0,074 0,057
6C8 (0,79мг/мл) 0,1 мг/мл 0,052 0,068 0,056
NC 0,053 0,062 0,048 0,052 0,060 0,056
PC 1,426 0,218 0,094 0,070 0,350 0,127
NC=5% молоко-PBS PC=CERM01 Мышиная сыворотка из хвостовой вены # 1 @ 1: 1K

На Фигуре 3 показано, что клоны 9H10, 9H11, 7B10, 6B5 и 6C8 демонстрируют биологическую активность in vitro.

Положительные клоны скринировали на биологическую активность путем обработки клеток Jurkat с помощью проникающего излучения 10 Гр. Моноклональные антитела (МАт) добавляли к культуральной среде в указанных дозах непосредственно перед IR, и клетки фиксировали через 16 ч инкубации. Апоптоз оценивали количественно с помощью красителя HOESCHST бисбензимид и проводили морфологическое исследование. Результаты представлены на Фигуре 4.

Летальность крипт изучали на клонах 7B10 (IgM), 6B5 (IgG), и 6C8 (IgG). На Фигуре 5 показано, что все они дозозависимо ингибировали летальность крипт при введении за 15 минут до IR 15 Гр.

Секвенировали CDR из 6B5, 6C8, 7B10, 9H10 и 9H11. Данные о последовательностях выявили значительную гомологию среди этих МАт, а также гомологию с CDR из 2А2 (генерированных с помощью альтернативного протокола иммунизации/скрининга). IgM, по видимому, имеют еще большую степень гомологии друг с другом и с 2А2. Таким же образом, два IgG наиболее близки друг к другу. На Фигуре 6 показано выравнивание последовательности вариабельной области тяжелой цепи и легкой цепи шести мышиных антител, а также последовательности для гуманизированного h2A2 (производное от м2A2), а также изображение консенсусной последовательности, сгенерированное компьютером. В вариабельной области CDR1 тяжелой цепи, каждое из антител содержат 10 аминокислот, содержащих Gly в 1-ом положении от N-конца, Tyr или Phe в 2-ом положении от N-конца, Phe или Leu в 4-ом положении от N-конца и Thr или Ser в 5-ом положении от N-конца и His или Asn в 10-ом положении от N-конца. В вариабельной области CDR2 тяжелой цепи, каждое из антител содержат 16-17 аминокислот, содержащих Asn или Ile во 2-ом положении от N-конца, Phe или Ser в 4-ом положении от N-конца, Thr в 9-ом положении от C-конца, Tyr в 7-ом положении от С-конца, Asn или Arg в 6-ом положении от С-конца, Lys или Ala в 4-ом положении от С-конца и Phe в 3-ем положении от С-конца. В вариабельной области CDR3 тяжелой цепи мышиных антител, каждое из антител содержит 7-11 аминокислот, содержащих Tyr или Thr в 4-ом положении от N-конца. В вариабельной области CDR1 легкой цепи, каждое из антител содержат 10-16 аминокислот, содержащих Ala или Ser во 2-ом положении от N-конца, Ser в 3-ем положении от N-конца, Ser или Asp в 5-ом положении от N-конца, и Tyr, Ser или Phe в 3-ем положении от С-конца. В вариабельной области CDR2 легкой цепи, каждое из антител содержит 7 аминокислот, содержащих Ser или Asn в 3-ем положении от N-конца, Lys или Ser в 5-ом положении от N-конца, и Ser или Asp в 7-ом положении от N-конца. В вариабельной области CDR3 легкой цепи, каждое из мышиных антител содержит 9 аминокислот, содержащих Gln, Leu или Trp в 1-ом положении от N-конца, Gln во 2-ом положении от N-конца, Pro в 7-ом положении от N-конца и Thr в 9-ом положении от N-конца.

Кроме того, на Фигуре 6 представлена консенсусная последовательность CDR тяжелой цепи и легкой цепи антитела к церамиду на основе информации о последовательности, полученной из последовательностей CDR из 6B5, 6C8, 7B10, 9H10 и 9H11. Авторы настоящего изобретения неожиданно обнаружили, что CDR-области вариабельных областей легкой и тяжелой цепи антитела к церамиду содержат определенные консервативные аминокислотные остатки. В некоторых воплощениях, консенсусная последовательность, определенная из последовательности из двух или нескольких антител к церамиду 6B5, 6C8, 7B10, 9H10, 9H11 и 2А2, может быть использована для генерирования ScFv, содержащего консенсусные CDR, консенсусные вариабельные области, или вариабельные области, содержащие по меньшей мере примерно 80%, 90% или 95% идентичности последовательности с консенсусной последовательностью вариабельной области.

Пример 3: Получение ScFv к церамиду

На основе данных эффективности Мат были выбраны CDR из 6B5 (наряду с 2а2) для конструирования в виде одноцепочечного Fv. Были сконструированы два одноцепочечных (SC) Fv-конструкта для экспрессии ScFv и получения очищенного ScFv для тестирования эффективности. 6B5 ScFv были легко экспрессированы и очищены. Биологическое тестирование ScFv, как и моноклональных антител, проводили с использованием in vitro ингибирования апоптоза клеток Jurkat и in vivo ингибирования радиационного ЖК-синдрома. На Фигуре 5 показано с помощью анализа микроколоний, что 6B5 IgG защищает от гибели крипт. На Фигуре 7 показано, что ScFv ингибирует апоптоз клеток Jurkat. На Фигуре 8 показано, что 6B5 ScFv защищает от истощения ЖК-крипт in vivo при введении за 15 минут до облучения 15 Гр. На Фигуре 9 показано, что 6B5 ScFv уменьшает отрицательное воздействие истощения ЖК-крипт in vivo при введении через 24 часа после облучения дозой 15 Гр.

ScFv против церамида защищает мышей от летального острого криза отторжения трансплантата

Мышам C57BL /6(MHC H2b гаплотипа) вводили физиологический раствор, 50 мг/кг гуманизированного h2A2 к церамиду или 7,5 мг/кг ScFv 6B5 к церамиду с помощью указанного способа введения и схемы дозирования. Дозирование начинали за 15 мин до тотального облучения всего организма дробными дозами 1100 сГр (TBI). Мыши затем получали аллогенной трансплантацию костного мозга через 16-20 часов после TBI, состоящую из 5×106 аллогенного костного мозга (BM) или BM и 2×106 аллогенных CD5+ наивных Т-клеток из мышей-доноров B10.BR (MHC H2k2 гаплотипа). Мышей наблюдали ежедневно на выживание. Данные представляют выживаемость на 10-й день, определенный, чтобы быть репрезентативным выживаемости в течение 90 дней. Внутривенный путь введения физиологического раствора по схеме дозирования 0, 4 и 8 дней приводил к выживаемости 30% через 10 дней. Внутривенный путь введения моноклонального антитела h2A2 по схеме дозирования 0, 4 и 8 дней приводил к выживаемости 100% после 10 дней (р <0,001 по сравнению с контрольным физиологическим раствором). Внутривенный путь введения ScFv по схеме дозирования 0, 4 и 8 дней приводил к 60% выживаемости через 10 дней (р <0,05 по сравнению с контрольным физиологическим раствором). Подкожный путь введения физиологического раствора по схеме дозирования 0, 2, 4, 6 и 8 дней приводил к 0% выживаемости после 10 дней. Подкожный путь введения физиологического раствора по схеме дозирования 0, 2, 4, 6 и 8 дней приводил к выживаемости 100% после 10 дней (р <0,001 по сравнению с контрольным физиологическим раствором).

Как показано на Фигуре 10, ScFv к церамиду защищает кишечные крипты дозозависимым образом. Как показано на Фигуре 11, ScFv к церамиду сохраняет эффективность при введении с помощью альтернативных инъекций. Как показано на Фигуре 12, h2A2 и ScFv к церамиду защищают и уменьшают отрицательное воздействие летальных эффектов радиационного ЖК-синдрома. Как показано на Фигуре 13, ScFv к церамиду защищает мышей от летального острого криза отторжения трансплантата. Как показано на Фигуре 14, ScFv к церамиду защищает мышиные кишечные стволовые клетки во время летального острого криза отторжения трансплантата. Как показано на Фигуре 15, h2A2 и ScFv к церамиду повышает сохранность CD4+ и CD8+ лимфоцитов в лимфатических узлах брыжейки (Фиг. 15).

Вышеприведенное описание представлено с целью обучения обычного специалиста в данной области техники, как осуществить на практике настоящее изобретение, и оно не предназначено для подробного изложения всех его обычных модификаций и вариаций, которые станут очевидными специалистам в данной области после прочтения описания. Однако предполагается, что все такие обычные модификации и вариации должны быть включены в объем настоящего изобретения, который определен в следующей формуле изобретения. Формула изобретения предназначена для охвата компонентов и стадий в любой последовательности, которая эффективна для достижения предназначенных целей, если контекст определенно не указывает на противоположное.

--->

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

<110> МЕМОРИАЛ СЛОАН-КЕТТЕРИНГ КЭНСЕР СЕНТЕР

СЕРАМИД ТЕРАПЬЮТИКС

<120> АНТИТЕЛА К ЦЕРАМИДУ

<130> P109831EP-WO

<140> 15830378.4

<141> 2015-08-07

<150> 62/034,453

<151> 2014-08-07

<160> 51

<170> PatentIn version 3.5

<210> 1

<211> 10

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области тяжелой цепи антитела к церамиду

<400> 1

Gly Tyr Thr Phe Thr Asp His Thr Ile His

1 5 10

<210> 2

<211> 17

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области тяжелой цепи

<400> 2

Tyr Asn Tyr Pro Arg Asp Gly Ser Thr Lys Tyr Asn Glu Lys Phe Lys

1 5 10 15

Gly

<210> 3

<211> 11

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области тяжелой цепи

<400> 3

Gly Phe Ile Thr Thr Val Val Pro Ser Ala Tyr

1 5 10

<210> 4

<211> 11

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области легкой цепи

<400> 4

Arg Ala Ser Lys Ser Ile Ser Lys Tyr Leu Ala

1 5 10

<210> 5

<211> 7

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области легкой цепи

<400> 5

Ser Gly Ser Thr Leu Gln Ser

1 5

<210> 6

<211> 9

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области легкой цепи

<400> 6

Gln Gln His Asn Glu Tyr Pro Trp Thr

1 5

<210> 7

<211> 119

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области тяжелой цепи

<400> 7

Gln Val Gln Leu Gln Gln Ser Asp Ala Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Val Ser Gly Tyr Thr Phe Thr Asp His

20 25 30

Thr Ile His Trp Met Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile

35 40 45

Gly Tyr Asn Pro Arg Asp Gly Ser Thr Lys Tyr Asn Glu Lys Phe Gly

50 55 60

Lys Ala Thr Leu Thr Asp Ala Asp Lys Ser Ser Ser Thr Ala Tyr Met

65 70 75 80

Gln Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys Ala

85 90 95

Lys Gly Phe Ile Thr Thr Val Val Pro Ser Ala Tyr Trp Gly Gln Gly

100 105 110

Thr Leu Val Thr Val Ser Ala

115

<210> 8

<211> 107

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области легкой цепи

<400> 8

Asp Val Gln Ile Thr Gln Ser Pro Ser Tyr Leu Ala Ala Ser Pro Gly

1 5 10 15

Glu Thr Ile Thr Ile Asn Cys Arg Ala Ser Lys Ser Ile Ser Lys Tyr

20 25 30

Leu Ala Trp Tyr Gln Glu Lys Pro Gly Lys Thr Asn Lys Leu Leu Ile

35 40 45

Tyr Ser Gly Ser Thr Leu Gln Ser Gly Ile Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro

65 70 75 80

Glu Asp Phe Ala Met Tyr Tyr Cys Gln Gln His Asn Glu Tyr Pro Trp

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105

<210> 9

<211> 10

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области тяжелой цепи

<400> 9

Gly Tyr Ala Phe Ser Ser Tyr Trp Met Asn

1 5 10

<210> 10

<211> 17

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области тяжелой цепи

<400> 10

Gln Ile Tyr Pro Gly Asp Gly Asp Thr Asn Tyr Asn Gly Lys Phe Lys

1 5 10 15

Gly

<210> 11

<211> 10

<212> Белок

<213> Artificial Sequence

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области тяжелой цепи

<400> 11

Arg Cys Tyr Tyr Gly Leu Tyr Phe Asp Val

1 5 10

<210> 12

<211> 11

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области легкой цепи

<400> 12

Lys Ala Ser Gln Asp Ile Asn Arg Tyr Leu Ser

1 5 10

<210> 13

<211> 7

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области легкой цепи

<400> 13

Arg Ala Asn Arg Leu Val Asp

1 5

<210> 14

<211> 9

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области легкой цепи

<400> 14

Leu Gln Tyr Asp Glu Phe Pro Tyr Thr

1 5

<210> 15

<211> 119

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области тяжелой цепи

<400> 15

Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ala Phe Ser Ser Tyr

20 25 30

Trp Met Asn Trp Val Lys Gln Arg Pro Gly Lys Gly Leu Glu Trp Ile

35 40 45

Gly Gln Ile Tyr Pro Gly Asp Gly Asp Thr Asn Tyr Asn Gly Lys Phe

50 55 60

Lys Gly Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys

85 90 95

Thr Arg Arg Cys Tyr Tyr Gly Leu Tyr Phe Asp Val Trp Gly Thr Gly

100 105 110

Thr Thr Val Thr Val Ser Ser

115

<210> 16

<211> 108

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области легкой цепи

<400> 16

Asp Ile Lys Met Thr Gln Ser Pro Ser Ser Arg Tyr Ala Ser Leu Gly

1 5 10 15

Glu Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Arg Tyr

20 25 30

Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ser Pro Lys Thr Leu Ile

35 40 45

Tyr Arg Ala Asn Arg Leu Val Asp Gly Val Pro Ser Ser Arg Phe Ser

50 55 60

Gly Ser Gly Ser Gly Gln Asp Tyr Ser Leu Thr Ile Ser Ser Leu Glu

65 70 75 80

Tyr Glu Asp Met Gly Ile Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe Pro

85 90 95

Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105

<210> 17

<211> 10

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области тяжелой цепи антитела к церамиду

<400> 17

Gly Tyr Thr Phe Thr Ser Tyr Trp Met His

1 5 10

<210> 18

<211> 16

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области тяжелой цепи

<400> 18

Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Tyr Asn Gln Phe Lys Asp

1 5 10 15

<210> 19

<211> 8

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области тяжелой цепи

<400> 19

Gly Gly Tyr Tyr Gly Phe Ala Tyr

1 5

<210> 20

<211> 10

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области легкой цепи

<400> 20

Ser Ala Ser Ser Ser Val Ser Tyr Met Tyr

1 5 10

<210> 21

<211> 7

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области легкой цепи

<400> 21

Leu Thr Ser Asn Leu Ala Ser

1 5

<210> 22

<211> 9

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области легкой цепи

<400> 22

Gln Gln Trp Ser Ser Asn Pro Leu Thr

1 5

<210> 23

<211> 117

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области тяжелой цепи

<400> 23

Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Ala Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr

20 25 30

Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile

35 40 45

Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Tyr Asn Gln Lys Phe

50 55 60

Lys Asp Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Gln Leu Ser Ser Leu Thr Tyr Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Gly Gly Tyr Tyr Gly Phe Ala Tyr Trp Gly Gln Gly Thr Leu

100 105 110

Val Thr Val Ser Ala

115

<210> 24

<211> 106

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области легкой цепи

<400> 24

Gln Ile Val Leu Thr Gln Ser Pro Ala Leu Met Ser Ala Ser Pro Gly

1 5 10 15

Glu Lys Val Thr Met Thr Cys Ser Ala Ser Ser Ser Val Ser Tyr Met

20 25 30

Tyr Trp Tyr Gln Gln Lys Pro Arg Ser Ser Pro Lys Pro Trp Ile Tyr

35 40 45

Leu Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu Ala Glu

65 70 75 80

Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Trp Ser Ser Asn Pro Leu Thr

85 90 95

Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys

100 105

<210> 25

<211> 10

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области тяжелой цепи антитела к церамиду

<400> 25

Gly Phe Ser Leu Thr Gly Tyr Gly Val His

1 5 10

<210> 26

<211> 16

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области тяжелой цепи

<400> 26

Val Ile Trp Ser Gly Gly Ser Thr Asp Tyr Asn Ala Ala Phe Ile Ser

1 5 10 15

<210> 27

<211> 10

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области тяжелой цепи

<400> 27

Asn Tyr Gly Tyr Asp Tyr Ala Met Asp Tyr

1 5 10

<210> 28

<211> 11

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области легкой цепи

<400> 28

Arg Ala Ser Gln Ser Ile Gly Thr Ser Ile His

1 5 10

<210> 29

<211> 7

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области легкой цепи

<400> 29

Tyr Ala Ser Glu Ser Ile Ser

1 5

<210> 30

<211> 9

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области легкой цепи

<400> 30

Gln Gln Ser Asn Ser Trp Pro Phe Thr

1 5

<210> 31

<211> 116

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области тяжелой цепи

<400> 31

Gln Val Gln Leu Lys Gln Ser Gly Pro Gly Val Gln Pro Ser Ser Leu

1 5 10 15

Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu Thr Ser Tyr Gly Val

20 25 30

His Trp Val Arg Gln Ser Pro Gly Lys Gly Leu Glu Trp Leu Gly Val

35 40 45

Ile Trp Ser Gly Gly Ser Thr Asp Tyr Asn Ala Ala Phe Ile Ser Arg

50 55 60

Leu Ser Ile Ser Lys Asp Asn Ser Lys Ser Gln Val Phe Phe Lys Met

65 70 75 80

Asn Ser Leu Gln Ala Asp Asp Thr Ala Ile Tyr Tyr Cys Ala Arg Asn

85 90 95

Tyr Gly Tyr Asp Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr Ser Val

100 105 110

Thr Val Ser Ser

115

<210> 32

<211> 107

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области легкой цепи

<400> 32

Asp Ile Leu Leu Thr Gln Ser Pro Ala Ile Leu Ser Val Ser Pro Gly

1 5 10 15

Glu Arg Val Ser Phe Ser Cys Arg Ala Ser Gln Ser Ile Gly Thr Ser

20 25 30

Ile His Trp Tyr Gln Gln Arg Thr Asn Gly Ser Pro Arg Leu Leu Ile

35 40 45

Lys Tyr Ala Ser Glu Ser Ile Ser Gly Ile Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Thr Asp Phe Thr Leu Ser Ile Asn Ser Val Glu Ser

65 70 75 80

Glu Asp Ile Ala Asp Tyr Tyr Cys Gln Gln Ser Asn Ser Trp Pro Phe

85 90 95

Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys

100 105

<210> 33

<211> 10

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области тяжелой цепи антитела к церамиду

<400> 33

Gly Tyr Thr Phe Thr Asn Tyr Trp Met His

1 5 10

<210> 34

<211> 17

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области тяжелой цепи

<400> 34

Ala Ile Tyr Pro Gly Asp Ser Asp Thr Ser Tyr Asn Gln Lys Phe Lys

1 5 10 15

Gly

<210> 35

<211> 7

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области тяжелой цепи

<400> 35

Gly Leu Tyr Tyr Gly Tyr Asp

1 5

<210> 36

<211> 16

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR1 вариабельной области легкой цепи

<400> 36

Lys Ser Ser Gln Ser Leu Ile Asp Ser Asp Gly Lys Thr Phe Leu Asn

1 5 10 15

<210> 37

<211> 7

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR2 вариабельной области легкой цепи

<400> 37

Leu Val Ser Lys Leu Asp Ser

1 5

<210> 38

<211> 9

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

CDR3 вариабельной области легкой цепи

<400> 38

Trp Gln Gly Thr His Phe Pro Tyr Thr

1 5

<210> 39

<211> 115

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области тяжелой цепи

<400> 39

Glu Val Gln Leu Gln Gln Ser Gly Thr Val Leu Ala Arg Pro Gly Ala

1 5 10 15

Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr

20 25 30

Trp Met His Trp Val Lys Gln Arg Pro Val Gln Gly Leu Glu Trp Ile

35 40 45

Gly Ala Ile Tyr Pro Gly Asp Ser Asp Thr Ser Tyr Asn Gln Lys Phe

50 55 60

Lys Gly Lys Ala Lys Leu Thr Ala Val Thr Ser Thr Ser Thr Ala Phe

65 70 75 80

Met Glu Leu Ser Ser Leu Thr Asn Glu Asp Ser Ala Val Tyr Tyr Cys

85 90 95

Thr Gly Leu Tyr Tyr Gly Tyr Asp Trp Gly Gln Gly Thr Thr Leu Thr

100 105 110

Val Ser Ser

115

<210> 40

<211> 112

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

последовательность вариабельной области легкой цепи

<400> 40

Asp Val Leu Met Thr Gln Thr Pro Leu Thr Leu Ser Val Thr Ile Gly

1 5 10 15

Gln Pro Ala Ser Ile Ser Cys Lys Ser Ser Gln Ser Leu Ile Asp Ser

20 25 30

Asp Gly Lys Thr Phe Leu Asn Trp Leu Leu Gln Arg Pro Gly Gln Ser

35 40 45

Pro Lys Arg Leu Ile Tyr Leu Val Ser Lys Leu Asp Ser Gly Val Pro

50 55 60

Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile

65 70 75 80

Ser Arg Val Glu Ala Glu Asp Leu Gly Leu Tyr Tyr Cys Trp Gln Gly

85 90 95

Thr His Phe Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105 110

<210> 41

<211> 109

<212> Белок

<213> Homo sapiens

<220>

<223> Human V gene 1-46

<400> 41

Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr

20 25 30

Tyr Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met

35 40 45

Gly Ile Ile Asn Pro Ser Gly Gly Ser Thr Ser Tyr Ala Gln Lys Phe

50 55 60

Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr

65 70 75 80

Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser

100 105

<210> 42

<211> 113

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

VL 2A2

<400> 42

Asp Val Leu Met Thr Gln Thr Pro Leu Thr Leu Ser Val Thr Ile Gly

1 5 10 15

Gln Pro Ala Ser Ile Ser Cys Lys Ser Ser Gln Ser Leu Ile Asp Ser

20 25 30

Asp Gly Lys Thr Phe Leu Asn Trp Leu Leu Gln Arg Pro Gly Gln Ser

35 40 45

Pro Lys Arg Leu Ile Tyr Leu Val Ser Lys Leu Asp Ser Gly Val Pro

50 55 60

Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile

65 70 75 80

Ser Arg Val Glu Ala Glu Asp Leu Gly Leu Tyr Tyr Cys Trp Gln Gly

85 90 95

Thr His Phe Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105 110

Arg

<210> 43

<211> 112

<212> Белок

<213> Homo sapiens

<220>

<223> ген А1 V человека

<400> 43

Asp Val Val Met Thr Gln Ser Pro Leu Ser Leu Pro Val Thr Leu Gly

1 5 10 15

Gln Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Val Tyr Ser

20 25 30

Asp Gly Asn Thr Tyr Leu Asn Trp Phe Gln Gln Arg Pro Gly Gln Ser

35 40 45

Pro Arg Arg Leu Ile Tyr Lys Val Ser Asn Trp Asp Ser Gly Val Pro

50 55 60

Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile

65 70 75 80

Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Gly

85 90 95

Thr His Trp Pro Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys Arg

100 105 110

<210> 44

<211> 1395

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

гуманизированная последовательность тяжелой цепи 2A2

<400> 44

atggactgga cctggagggt cttctgcttg ctggctgtag ctccaggtgc tcactcccag 60

gtgcagcttg tgcagtctgg ggctgaggtg aaaaagcctg gggcttcagt gaaggtgtcc 120

tgcaaggctt ctggctacac ctttaccaac tactggatgc actgggtaag acaggcgcct 180

ggacagggtc tggaatggat gggcgctatt tatcctggag atagtgatac tagctacaac 240

cagaagttca agggccgggt cacaatgact cgagacacat ccaccagcac tgtctacatg 300

gagctcagca gcctgagaag tgaggacact gcggtctatt actgtgcacg cctttactac 360

ggctacgact ggggccaagg caccactgtc acagtctcct cagccagcac gaagggccca 420

tcggtcttcc ccctggcacc ctcctccaag agcacctctg ggggcacagc ggccctgggc 480

tgcctggtca aggactactt ccccgaaccg gtgacggtgt cgtggaactc aggcgccctg 540

accagcggcg tgcacacctt cccggctgtc ctacagtcct caggactcta ctccctcagc 600

agcgtggtga ccgtgccctc cagcagcttg ggcacccaga cctacatctg caacgtgaat 660

cacaagccca gcaacaccaa ggtggacaag aaagttgagc ccaaatcttg tgacaaaact 720

cacacatgcc caccgtgccc agcacctgaa ctcctggggg gaccgtcagt cttcctcttc 780

cccccaaaac ccaaggacac cctcatgatc tcccggaccc ctgaggtcac atgcgtggtg 840

gtggacgtga gccacgaaga ccctgaggtc aagttcaact ggtacgtgga cggcgtggag 900

gtgcataatg ccaagacaaa gccgcgggag gagcagtaca acagcacgta ccgtgtggtc 960

agcgtcctca ccgtcctgca ccaggactgg ctgaatggca aggagtacaa gtgcaaggtc 1020

tccaacaaag ccctcccagc ccccatcgag aaaaccatct ccaaagccaa agggcagccc 1080

cgagaaccac aggtgtacac cctgccccca tcccgggatg agctgaccaa gaaccaggtc 1140

agcctgacct gcctggtcaa aggcttctat cccagcgaca tcgccgtgga gtgggagagc 1200

aatgggcagc cggagaacaa ctacaagacc acgcctcccg tgctggactc cgacggctcc 1260

ttcttcctct acagcaagct caccgtggac aagagcaggt ggcagcaggg gaacgtcttc 1320

tcatgctccg tgatgcatga ggctctgcac aaccactaca cgcagaagag cctctccctg 1380

tccccgggta aatga 1395

<210> 45

<211> 463

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетическая

гуманизированная последовательность тяжелой цепи 2A2

<400> 45

Met Asp Trp Thr Trp Arg Val Phe Cys Leu Leu Ala Val Ala Pro Gly

1 5 10 15

Ala His Ser Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys

20 25 30

Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe

35 40 45

Thr Asn Tyr Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu

50 55 60

Glu Trp Met Gly Ala Ile Tyr Pro Gly Asp Ser Asp Thr Ser Tyr Asn

65 70 75 80

Gln Lys Phe Lys Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser

85 90 95

Thr Val Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val

100 105 110

Tyr Tyr Cys Ala Arg Leu Tyr Tyr Gly Tyr Asp Trp Gly Gln Gly Thr

115 120 125

Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro

130 135 140

Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly

145 150 155 160

Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn

165 170 175

Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln

180 185 190

Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser

195 200 205

Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser

210 215 220

Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr

225 230 235 240

His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser

245 250 255

Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg

260 265 270

Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro

275 280 285

Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala

290 295 300

Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val

305 310 315 320

Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr

325 330 335

Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr

340 345 350

Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu

355 360 365

Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys

370 375 380

Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser

385 390 395 400

Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp

405 410 415

Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser

420 425 430

Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala

435 440 445

Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly

450 455 460

<210> 46

<211> 720

<212> ДНК

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетический

полинуклеоитид

<400> 46

atgaggctcc ctgctcagct cctggggctg ctaatgctct gggtcccagg atccagtggg 60

gatgttgtga tgacccaatc tccactctct ttgccggtta cccttggaca accagcctcc 120

atctcttgca agtcaagtca gagcctcata gatagtgatg gaaagacatt tttgaattgg 180

ttccaacaga ggccaggcca gtctccaagg cgcctaatct atctggtgtc taaactggac 240

tctggagtcc ctgacaggtt ctctggcagt ggatcaggga cagatttcac tctgaaaatc 300

agcagagtgg aggctgagga tgtgggagtt tattattgct ggcaaggtac acattttccg 360

tacacgttcg gacaggggac caagctggaa ataaaacgga cggtggctgc accatctgtc 420

ttcatcttcc cgccatctga tgagcagttg aaatctggaa ctgcctctgt tgtgtgcctg 480

ctgaataact tctatcccag agaggccaaa gtacagtgga aggtggataa cgccctccaa 540

tcgggtaact cccaggagag tgtcacagag caggacagca aggacagcac ctacagcctc 600

agcagcaccc tgacgctgag caaagcagac tacgagaaac acaaagtcta cgcctgcgaa 660

gtcacccatc agggcctgag ttcgcccgtc acaaagagct tcaacagggg agagtgttaa 720

<210> 47

<211> 239

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетический

полипептид

<400> 47

Met Arg Leu Pro Ala Gln Leu Leu Gly Leu Leu Met Leu Trp Val Pro

1 5 10 15

Gly Ser Ser Gly Asp Val Val Met Thr Gln Ser Pro Leu Ser Leu Pro

20 25 30

Val Thr Leu Gly Gln Pro Ala Ser Ile Ser Cys Lys Ser Ser Gln Ser

35 40 45

Leu Ile Asp Ser Asp Gly Lys Thr Phe Leu Asn Trp Phe Gln Gln Arg

50 55 60

Pro Gly Gln Ser Pro Arg Arg Leu Ile Tyr Leu Val Ser Lys Leu Asp

65 70 75 80

Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe

85 90 95

Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr

100 105 110

Cys Trp Gln Gly Thr His Phe Pro Tyr Thr Phe Gly Gln Gly Thr Lys

115 120 125

Leu Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro

130 135 140

Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu

145 150 155 160

Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp

165 170 175

Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp

180 185 190

Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys

195 200 205

Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln

210 215 220

Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys

225 230 235

<210> 48

<211> 120

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетический

полипептид

<400> 48

Gln Val Gln Leu Gln Gln Ser Asp Ala Glu Leu Val Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Ile Ser Cys Lys Val Ser Gly Tyr Thr Phe Thr Asp His

20 25 30

Thr Ile His Trp Met Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile

35 40 45

Gly Tyr Asn Tyr Pro Arg Asp Gly Ser Thr Lys Tyr Asn Glu Lys Phe

50 55 60

Lys Gly Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr

65 70 75 80

Met Gln Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys

85 90 95

Ala Lys Gly Phe Ile Thr Thr Val Val Pro Ser Ala Tyr Trp Gly Gln

100 105 110

Gly Thr Leu Val Thr Val Ser Ala

115 120

<210> 49

<211> 118

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетический

полипептид

<400> 49

Gln Val Gln Leu Lys Gln Ser Gly Pro Gly Leu Val Gln Pro Ser Gln

1 5 10 15

Ser Leu Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu Thr Ser Tyr

20 25 30

Gly Val His Trp Val Arg Gln Ser Pro Gly Lys Gly Leu Glu Trp Leu

35 40 45

Gly Val Ile Trp Ser Gly Gly Ser Thr Asp Tyr Asn Ala Ala Phe Ile

50 55 60

Ser Arg Leu Ser Ile Ser Lys Asp Asn Ser Lys Ser Gln Val Phe Phe

65 70 75 80

Lys Met Asn Ser Leu Gln Ala Asp Asp Thr Ala Ile Tyr Tyr Cys Ala

85 90 95

Arg Asn Tyr Gly Tyr Asp Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr

100 105 110

Ser Val Thr Val Ser Ser

115

<210> 50

<211> 115

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетический

полипептид

<400> 50

Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala

1 5 10 15

Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr

20 25 30

Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met

35 40 45

Gly Ala Ile Tyr Pro Gly Asp Ser Asp Thr Ser Tyr Asn Gln Lys Phe

50 55 60

Lys Gly Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr

65 70 75 80

Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Leu Tyr Tyr Gly Tyr Asp Trp Gly Gln Gly Thr Thr Val Thr

100 105 110

Val Ser Ser

115

<210> 51

<211> 107

<212> Белок

<213> Искусственная последовательность

<220>

<223> Описание искусственной последовательности: Синтетический

полипептид

<400> 51

Asp Ile Lys Met Thr Gln Ser Pro Ser Ser Arg Tyr Ala Ser Leu Gly

1 5 10 15

Glu Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Arg Tyr

20 25 30

Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ser Pro Lys Thr Leu Ile

35 40 45

Tyr Arg Ala Asn Arg Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly

50 55 60

Ser Gly Ser Gly Gln Asp Tyr Ser Leu Thr Ile Ser Ser Leu Glu Tyr

65 70 75 80

Glu Asp Met Gly Ile Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe Pro Tyr

85 90 95

Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105

<---

1. Антитело, которое специфически связывается с церамидом, или его антигенсвязывающий фрагмент, содержащее вариабельную область тяжелой цепи (VH) и вариабельную область легкой цепи (VL),

где VH содержит

вариабельную область тяжелой цепи CDR1, содержащую последовательность GYTFTDHTIH (SEQ ID NO: 1),

вариабельную область тяжелой цепи CDR2, содержащую последовательность YNYPRDGSTKYNEKFKG (SEQ ID NO: 2), и

вариабельную область тяжелой цепи CDR3, содержащую последовательность GFITTVVPSAY (SEQ ID NO: 3), и

где VL содержит

вариабельную область легкой цепи CDR1, содержащую последовательность RASKSISKYLA (SEQ ID NO: 4),

вариабельную область легкой цепи CDR2, содержащую последовательность SGSTLQS (SEQ ID NO: 5), и

вариабельную область легкой цепи CDR3, содержащую последовательность QQHNEYPWT (SEQ ID NO: 6).

2. Антитело или его антигенсвязывающий фрагмент по п.1, в котором VH содержит аминокислотную последовательность QVQLQQSDAELVKPGASVKISCKVSGYTFTDHTIHWMKQRPEQGLEWIGYNYPRDGSTKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCAKGFITTVVPSAYWGQGTLVTVSA (SEQ ID NO: 48) и VL содержит аминокислотную последовательность SEQ ID NO: 8.

3. Антитело или его антигенсвязывающий фрагмент по п.1 или 2, которое выбрано из группы, состоящей из моноклонального антитела, химерного антитела, гуманизированного антитела, человеческого антитела и scFv.

4. Антитело или его антигенсвязывающий фрагмент по любому из пп.1-3, которое включено в состав для ингаляции или для внутривенного, внутримышечного, внутрибрюшинного, интрацереброспинального, подкожного, внутрисиновиального, интратекального, перорального введения или для местного применения.

5. Способ ингибирования апоптоза, ассоциированного с церамидом, у пациента, включающий введение терапевтически эффективного количества антитела или его антигенсвязывающего фрагмента по любому из пп.1-4.

6. Способ по п.5, где указанный апоптоз связан с заболеванием, выбранным из группы, состоящей из реакции "трансплантат против хозяина" (РТПХ), лучевой болезни, радиационного желудочно-кишечного (ЖК) синдрома и аутоиммунного заболевания.

7. Способ по п.6, где указанное заболевание представляет собой лучевую болезнь или ЖК-синдром и антитело или его антигенсвязывающий фрагмент вводят до облучения пациента.

8. Способ по п.6, где указанное заболевание представляет собой РТПХ и антитело или его антигенсвязывающий фрагмент вводят перед проведением трансплантации у пациента.

9. Способ по п.8, в котором указанный трансплантат является трансплантатом костного мозга.

10. Способ уменьшения отрицательного воздействия апоптоза, ассоциированного с церамидом, при ЖК-синдроме у пациента, включающий введение эффективного количества антитела или его антигенсвязывающего фрагмента по любому из пп.1-4 после воздействия проникающей радиации на указанного пациента.

11. Способ по п.10, в котором указанное антитело или его антигенсвязывающий фрагмент вводят непосредственно после воздействия проникающей радиации на указанного пациента.

12. Способ по п.11, в котором указанное антитело или его антигенсвязывающий фрагмент вводят в течение 24 часов после воздействия проникающей радиации на указанного пациента.

13. Способ ингибирования апоптоза, ассоциированного с церамидом, при РТПХ у пациента, включающий:

введение эффективного количества антитела или его антигенсвязывающего фрагмента по любому из пп.1-4 перед проведением трансплантации у пациента или после проведения трансплантации у пациента, но перед началом РТПХ.

14. Способ по п.13, в котором указанный трансплантат является трансплантатом костного мозга.



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к гуманизированному антителу 5-бром-2’-дезоксиуридина (анти-BRDU). Также раскрыты комплекс, конъюгат и фармацевтический состав для доставки BRDU-содержащей нуклеиновой кислоты к клетке.

Изобретение относится к области биохимии, в частности к моноклональному антителу к 6- гемисукцинильному эфиру морфина, способное блокировать биологическую активность морфина.

Изобретение относится к области биохимии. Описана группа изобретений, включающая гуманизированное моноклональное антитело или его антиген-связывающий фрагмент, которое связывается со специфичностью с антигеном Томсена-Фриденрайха (TF-Ag), конъюгат, связывающийся с раковыми клетками, которые экспрессируют TF-Ag, способ профилактики или лечения рака у индивидуума, при этом рак содержит раковые клетки, экспрессирующие TF-Ag, фармацевтическая композиция для лечения TF+ видов рака, содержащая вышеуказанное антитело или его антиген-связывающий фрагмент в терапевтически эффективном количестве, клетку-хозяин млекопитающего, предназначенную для экспрессии вышеуказанного антитела или его антиген-связывающего фрагмента.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая иммуногенную композицию для индуцирования иммунного ответа против стрептококка группы В (варианты), способ индукции иммунного ответа против стрептококка группы В, способ предупреждения или ослабления заболевания или состояния, связанного со стрептококком группы В, способ получения антитела, способ обеспечения пассивного иммунитета субъекту, где все вышеуказанные способы включают в себя введение иммуногенной композиции.

Изобретение относится к области биохимии, в частности к конъюгату для нацеленной доставки полипептидного токсина. Также раскрыта фармацевтическая композиция, содержащая указанный конъюгат.

Настоящее изобретение относится к области иммунологии. Предложены антитело и фрагмент антитела, способные к связыванию с фосфорилхолином и/или конъюгатом фосфорилхолина.

Изобретения касаются молекулы нуклеиновой кислоты, кодирующей гомодимерный белок, гомодимерного белка, аминокислотной цепи, способной формировать гомодимерный белок, их применения для получения лекарственного средства, клетки-хозяина, фармацевтической и вакцинной композиций, способа получения гомодимерного белка или аминокислотной цепи и способа получения вакцины.

Изобретение относится к области биохимии, в частности к антителу, специфически связывающемуся с теофиллином, или его фрагменту, специфически связывающемуся с теофиллином.

Изобретение относится к биохимии. Описано гуманизированное антитело к биотину или его фрагмент, связывающий биотин, включающее: HVR-H3, содержащий аминокислотную последовательность SEQ ID NO: 11, HVR-H2, содержащий аминокислотную последовательность SEQ ID NO: 10, HVR-H1, содержащий аминокислотную последовательность SEQ ID NO: 09, HVR-L3, содержащий аминокислотную последовательность SEQ ID NO: 15, HVR-L2, содержащий аминокислотную последовательность SEQ ID NO: 14, и HVR-L1, содержащий аминокислотную последовательность SEQ ID NO: 13.

Настоящее изобретение относится к соединению, имеющему общую формулу (I): где m и n являются независимо целыми числами от 1 до 6; каждый из X1-X3 и Y1-Y3 является О; R1-R3 каждый независимо выбирают из группы, состоящей из водорода или алкила; и R является O-(CH2)x-C(=O)NR'-(CH2)y-NHR', причем: x и y каждый являются независимо целыми числами от 1 до 6; и R' выбирают из группы, состоящей из водорода и алкила.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая моноклональное антитело или его антиген-связывающий фрагмент, которое связывается с внеклеточным доменом протеинтирозинфосфатазы σ рецепторного типа человека (PTPRS человека) на плазмоцитоидной дендритной клетке (варианты), гибридому для получения вышеуказанного антитела, способ получения клетки, которая продуцирует антитело, способ получения антитела, распознающего PTPRS человека, применение клетки животного, которая сохраняет способность экспрессировать эндогенный полинуклеотид, который кодирует аминокислотную последовательность, включающую внеклеточный домен PTPRS человека, или фракцию мембран этой клетки для получения моноклонального антитела, способ детекции плазмацитоидной дендритной клетки, применение антитела или его фрагмента для детекции плазмоцитоидной дендритной клетки, способ подавления активности плазмацитоидной дендритной клетки ex vivo, применение антитела или его фрагмента для лечения заболевания, связанного с рDC и для лечения аутоиммунного заболевания, связанного с IFNальфа.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая моноклональное антитело или его антиген-связывающий фрагмент, которое связывается с внеклеточным доменом протеинтирозинфосфатазы σ рецепторного типа человека (PTPRS человека) на плазмоцитоидной дендритной клетке (варианты), гибридому для получения вышеуказанного антитела, способ получения клетки, которая продуцирует антитело, способ получения антитела, распознающего PTPRS человека, применение клетки животного, которая сохраняет способность экспрессировать эндогенный полинуклеотид, который кодирует аминокислотную последовательность, включающую внеклеточный домен PTPRS человека, или фракцию мембран этой клетки для получения моноклонального антитела, способ детекции плазмацитоидной дендритной клетки, применение антитела или его фрагмента для детекции плазмоцитоидной дендритной клетки, способ подавления активности плазмацитоидной дендритной клетки ex vivo, применение антитела или его фрагмента для лечения заболевания, связанного с рDC и для лечения аутоиммунного заболевания, связанного с IFNальфа.

Изобретение относится к области биохимии, в частности к антителу, которое специфично связывается с PD-1. Также раскрыты композиция, содержащая указанное антитело, нуклеиновая кислота, кодирующая указанное антитело, вектор и клетка-хозяин, содержащие указанную нуклеиновую кислоту.

Настоящее изобретение относится к области иммунологии. Предложены полноразмерные антитела-агонисты против CD40, а также анти-CD40 антитела.

Настоящее изобретение относится к области иммунологии. Предложены полноразмерные антитела-агонисты против CD40, а также анти-CD40 антитела.

Изобретение относится к области биотехнологии. Предложена молекула, специфически связывающая лиганд-1 белка программируемой смерти (PDL1) и ее применение, например, в составе фармацевтической композиции для лечения или предупреждения рака.

Изобретение относится к области биотехнологии. Предложена молекула, специфически связывающая лиганд-1 белка программируемой смерти (PDL1) и ее применение, например, в составе фармацевтической композиции для лечения или предупреждения рака.

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий фрагмент, способные к специфическому связыванию с PD-L1.

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий фрагмент, способные к специфическому связыванию с PD-L1.

Настоящее изобретение относится к области иммунологии. Предложены биспецифическое антитело и слитый белок для специфического связывания с GD2 и CD3.

Данное изобретение относится к биотехнологии. Предложен выделенный полипептид, представляющий собой фрагмент белка Hyr1 Candida albicans, для вакцинирования млекопитающего.

Изобретение относится к области биохимии, в частности к антителу, которое специфически связывается с церамидом. Также раскрыты способы ингибирования апоптоза, ассоциированного с церамидом, и уменьшения отрицательного воздействия указанного апоптоза. Изобретение позволяет эффективно ингибировать апоптоз, ассоциированный с церамидом. 4 н. и 10 з.п. ф-лы, 3 пр., 17 ил., 2 табл.

Наверх