Применение пептида нервных нитей для предупреждения или уменьшения прогрессирования рака предстательной железы

Изобретение относится к способу снижения возникновения или уменьшения прогрессирования рака простаты у млекопитающего, склонного к развитию рака простаты, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы, включающий введение млекопитающему, склонному к развитию рака простаты, терапевтически эффективного количества выделенного пептида, состоящего из аминокислотной последовательности SEQ ID NO. 66 (Ile-Asp-Gln-Gln-Val-Leu-Ser-Arg-Ile-Lys-Leu-Glu-Ile-Lys-Arg-Cys-Leu), где пептид вводят в центральную часть простаты, в которой рак является менее распространенным, где способ снижает возникновение рака простаты более чем на около 15% по сравнению с млекопитающими, получающими плацебо, или уменьшает прогрессирование рака предстательной железы до показателя, который находится в диапазоне от около 0% до менее чем около 5%. 2 н. и 12 з.п. ф-лы, 6 табл., 3 пр.

 

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

[0001] Рассматриваемая в настоящий момент заявка содержит перечень последовательностей, направленный в электронном виде в формате ASCII и включенный в данный документ в полном объеме посредством ссылки. Указанная копия ASCII, созданная 27 июля 2016 г., называется 063307-0447523_SL.txt, и ее размер составляет 33 218 байтов.

ПЕРЕКРЕСТНАЯ ССЫЛКА

[0002] Данная заявка испрашивает приоритет по обычной заявке на патент США № 15/185,344, поданной 17 июня 2016 г., под названием «Способ предупреждения или уменьшения прогрессирования рака предстательной железы», содержание которой полностью включено в настоящий документ посредством ссылки.

УРОВЕНЬ ТЕХНИКИ

1. Область техники, к которой относится изобретение

[0003] Варианты осуществления настоящего изобретения включают способы предупреждения или уменьшения прогрессирования рака предстательной железы у млекопитающих, склонных к развитию рака предстательной железы, а также способы снижения частоты случаев клинически диагностируемого рака предстательной железы с применением композиций, содержащих соединения на основе небольших пептидов и фармацевтически приемлемого носителя. Способы включают, помимо прочего, введение нуждающимся в этом пациентам соединений внутримышечно, перорально, внутривенно, внутрибрюшинно, внутрипредстательным способом, внутрицеребрально (интрапаренхиматозно), интрацеребровентрикулярно, внутриочагово, интраокулярно, внутриартериально, интратекально, внутриопухолево, интраназально, местно, трансдермально, подкожно или внутрикожно, причем пациенты, у которых еще не был клинически диагностирован рак предстательной железы, менее склонны к развитию клинического рака предстательной железы (т. е. частота случаев рака предстательной железы ниже) и/или пациенты, которые относятся к группе риска развития рака предстательной железы (рак предстательной железы, обнаруженный с помощью тестов), не демонстрируют значительного прогрессирования рака (т. е. предупреждение или уменьшение прогрессирования рака предстательной железы).

2. Предшествующий уровень техники

[0004] Суть многих терапевтических способов лечения и процедур заключается в удалении или разрушении вредоносных или нежелательных тканей. К примерам таких способов лечения относится хирургическое удаление предраковых и раковых образований, разрушение метастатических опухолей путем химиотерапии, а также уменьшение железистой гиперплазии (например, предстательной железы). Другие примеры включают удаление с лица нежелательных волос, удаление бородавок и удаление нежелательной жировой ткани.

[0005] Необходима эффективная композиция, которая будет разрушать и, следовательно, способствовать удалению вредных или нежелательных клеток и тканей или будет подавлять их дальнейший рост и которая будет оказывать преимущественно местное влияние, обладая при этом минимальной системной токсичностью или не обладая ею вовсе. Существует также потребность в сокращении необходимости инвазивного хирургического вмешательства, даже после проведения лечения с применением эффективной композиции.

[0006] Некоторые агенты, известные своей способностью разрушать и, следовательно, способствовать удалению вредных или нежелательных клеток и тканей или подавлять их дальнейший рост, описаны в заявке на патент США № 14/808,731, поданной 24 июля 2015 г., под названием: METHODS OF REDUCING THE NEED FOR SURGERY IN PATIENTS SUFFERING FROM BENIGN PROSTATIC HYPERPLASIA; в заявке на патент США № 14/606,683, поданной 27 января 2015 г., под названием: METHOD OF TREATING DISORDERS REQUIRING DESTRUCTION OR REMOVAL OF CELLS; в заявке на патент США № 14/738,551, поданной 12 июня 2015 г., под названием: COMBINATION COMPOSITIONS FOR TREATING DISORDERS REQUIRING REMOVAL OR DESTRUCTION OF UNWANTED CELLULAR PROLIFERATIONS, в публикациях заявки на патент США № 2007/0237780 (в настоящее время аннулированная); № 2003/0054990 (в настоящее время аннулированная); № 2003/0096350 (в настоящее время патент США № 6,924,266); № 2003/0096756 (в настоящее время патент США № 7,192,929); № 2003/0109437 (в настоящее время патент США № 7,241,738); № 2003/0166569 (в настоящее время патент США № 7,317,077); № 2005/0032704 (в настоящее время патент США № 7,408,021); а также № 2015/0148303 (в настоящее время патент США № 9,243,035), полное содержание которых включено в данный документ посредством ссылки.

[0007] Рак является аномалией внутренних регуляторных механизмов клеток, которая приводит к нерегулируемому росту и размножению клетки. Нормальные клетки образуют ткани, и когда эти клетки теряют способность функционировать в виде специфических регулируемых и координированных единиц (утрата способности к дифференциации), то такой дефект ведет к беспорядку в клеточной популяции. В этом случае образуется опухоль.

[0008] Доброкачественные гипертрофии ткани являются такими аномалиями, когда клетки желательно удалить из организма. Доброкачественные опухоли являются клеточными пролиферациями, которые не образуют в организме метастазы, однако вызывают симптомы болезни. Такие опухоли могут быть летальными, если они локализованы в недоступных областях органов, например в мозге. Доброкачественные опухоли могут возникать в таких органах, как легкое, мозг, кожа, гипофиз, щитовидная железа, кора надпочечника и костный мозг, яичник, матка, яичко, соединительная ткань, мышцы, кишечник, ухо, нос, горло, миндалины, рот, печень, желчный пузырь, поджелудочная железа, предстательная железа, сердце и другие органы.

[0009] Хирургическое вмешательство часто является первым шагом при лечении рака. Задачи хирургического вмешательства различны. Иногда оно применяется для удаления как можно большей части видимой опухоли или по крайней мере для уменьшения ее размеров (удаления основной части опухоли таким образом, чтобы осталось как можно меньше для лечения другими способами). В зависимости от типа рака и его местонахождения хирургическое вмешательство также может обеспечивать пациенту некоторое симптоматическое облегчение. Например, если хирург сможет удалить большую часть растущей опухоли мозга, давление внутри черепа снизится, и это приведет к облегчению симптомов пациента.

[0010] Не все опухоли поддаются хирургическому лечению. Некоторые из них могут быть расположены в тех частях тела, откуда их невозможно полностью удалить. В качестве таких примеров могут служить опухоли ствола мозга (часть мозга, которая регулирует дыхание) или же опухоль, которая выросла в главном кровеносном сосуде и вокруг него. В таких случаях хирургическое вмешательство ограничено из-за высокого риска, связанного с удалением опухоли.

[0011] В некоторых случаях не применяют хирургическое вмешательство с целью уменьшения размера опухоли, так как в этом просто нет необходимости. Примером является лимфома Ходжкина - рак лимфатических узлов, который очень хорошо поддается комбинированному лечению химиотерапией и радиационной терапией. В случае лимфомы Ходжкина хирургическое вмешательство редко применяется для лечения, но почти всегда используется с целью постановки диагноза.

[0012] Химиотерапия является еще одним распространенным способом лечения рака. По существу, она предполагает применение медикаментов (обычно их принимают перорально или путем инъекции), которые специфически атакуют быстро делящиеся клетки (например, такие, которые присутствуют в опухоли) во всем организме. Это позволяет применять химиотерапию для лечения опухолей, которые уже образовали метастазы, а также опухолей, которые с высокой долей вероятности могут распространяться через кровь и лимфатические системы, однако не выражены вне первичной опухоли. Химиотерапия также может использоваться, чтобы усилить ответную реакцию локализованных опухолей на хирургическое вмешательство и радиационную терапию. Так обстоит дело, например, в случае некоторых раковых образований головы и шеи.

[0013] К сожалению, другие клетки человеческого организма, которые, как правило, тоже быстро делятся (такие как внутренний слой желудка и волосы) также подвергаются воздействию химиотерапии. По этой причине многие химиотерапевтические агенты вызывают нежелательные побочные эффекты, такие как тошнота, рвота, анемия, выпадение волос и другие симптомы. Эти побочные эффекты являются временными, и существуют препараты, которые позволяют облегчить многие из них. По мере развития наших познаний исследователи изобрели новые химиотерапевтические агенты, которые не только более эффективно уничтожают раковые клетки, но и оказывают меньше побочного влияния на пациента.

[0014] Химиотерапевтические средства вводятся пациентам различными способами.

Некоторые из них представляют собой пилюли, а другие вводятся путем внутривенной или другой инъекции. При инъекционной химиотерапии для осуществления лечения пациент посещает кабинет врача или больницу. Другие химиотерапевтические агенты требуют непрерывного вливания в кровоток в течение 24 часов в сутки. При таких видах химиотерапии проводится незначительное хирургическое вмешательство для имплантации небольшого насоса, носимого пациентом. После имплантации насос медленно вводит препарат. Во многих случаях в вену пациента помещается постоянный порт, чтобы устранить необходимость повторных уколов.

[0015] Доброкачественные опухоли и мальформации также можно лечить разнообразными способами, включая хирургическое вмешательство, радиотерапию, лекарственную терапию, тепловую или электрическую абляцию, криотерапию и другие. Несмотря на то что доброкачественные опухоли не образуют метастазы, они могут увеличиваться в размерах и рецидивировать. Хирургическое удаление доброкачественных опухолей связано со всеми трудностями и побочными явлениями, которые, в целом, характерны для оперативного вмешательства, и зачастую неоднократно применяется в случае некоторых доброкачественных опухолей, таких как аденомы гипофиза, менингиомы мозга, гиперплазия предстательной железы и другие. Кроме того, некоторым пациентам, которые получают нехирургическое лечение для облегчения симптомов доброкачественных опухолей, впоследствии все равно требуется проведение инвазивного хирургического вмешательства. Lepor, Medical Treatment of Benign Prostatic Hyperplasia, Reviews in Urology, Vol. 13, No. 1, pp. 20-33 (2011), описывает различные исследования эффективности лекарственной терапии при лечении доброкачественной гиперплазии предстательной железы и необходимость в проведении последующего инвазивного хирургического вмешательства.

[0016] Роль андрогенов в развитии доброкачественной гиперплазии предстательной железы у мужчин хорошо известна и задокументирована (Wilson, N. Engl. J. Med. 317: 628-629, 1987). Фактически, доброкачественная гиперплазия предстательной железы не развивается при отсутствии яичек (упоминается в Wendel etal., J. Urol. 108: 116-119, 1972).

[0017] Известно, что блокада секреции тестикулярного андрогена путем хирургической или медикаментозной (с применением агониста ЛГРГ) кастрации уменьшает размер предстательной железы (Auclair et al., Biochem. Biophys. Res. Commun. 76: 855-862, 1977; Auclair et al., Endocrinology 101: 1890-1893, 1977; Labrie etal., Int. J. Andrology, suppl. 2 (V. Hansson, ed.), Scriptor Publisher APR, pp. 303-318, 1978; Labrie et al., J. Andrology 1: 209-228, 1980; Tremblay and Belanger, Contraception 30: 483-497, 1984; Tremblay et al., Contraception 30: 585-598, 1984; Dube etal., Acta Endocrinol. (Copenh) 116: 413-417, 1987; Lacoste etal., Mol. Cell. Endocrinol. 56: 141-147, 1988; White, Ann. Surg. 22: 1-80, 1895; Faure et al., Fertil. Steril. 37: 416-424, 1982; Labrie et al., Endocrine Reviews 7: 67-74, 1986; Huggins and Stevens, J. Urol. 43: 705-714, 1940; Wendel etal., J. Urol. 108: 116-119, 1972; Peters and Walsh, N. Engl. J. Med. 317: 599-604, 1987; Gabrilove etal., J. Clin. Endocrinol. Metab. 64: 1331-1333, 1987).

[0018] Несколько исследований показали, что лечение антиандрогеном также уменьшает размер предстательной железы (Neri et al., Endocrinology, 82: 311-317, 1968; Neri et al., Investigative Urology, 10: 123-130, 1972; Tunn etal., Acta Endocrinol. (Copenh.) 91: 373-384, 1979; Seguin etal., Mol. Cell. Endocrinol., 21: 37-41, 1981; Lefebvre etal., The Prostate 3: 569-578, 1982; Marchetti and Labrie, J. Steroid Biochem, 29: 691-698, 1988; Lacoste et al., Mol. Cell. Endocrinol. 56: 141-147, 1988; Tunn et al., Invest. Urol. 18: 289-292, 1980; Scott and Wade, J. Urol. 101: 81-85, 1969; Caine etal., J. Urol. 114: 564-568, 1975; Stone et al., J. Urol. 141: 240A, 1989; Clejan et al., J. Urol. 141: 534A, 1989).

[0019] Патент США № 3,423,507 описывает использование антиандрогена ципротерона ацетата (1α, 2β-метилен-6-хлор-17 α -ацетокси-6- дегидропрогестерон) для лечения доброкачественной гиперплазии предстательной железы. Чистые антиандрогены (патент США № 4,329,364) вызывают повышение секреции тестостерона, что может привести к более высокой степени ароматизации в эстрогены, а это в соответствии с современным уровнем знаний оказывает отрицательный эффект на гиперплазию предстательной железы (Jacobi et al., Endocrinology 102: 1748-1755, 1978). Некоторые исследования показали, что лечение химической кастрацией (с применением агониста ЛГРГ) в комбинации с антиандрогеном вызывает более высокое ингибирование размеров предстательной железы по сравнению с этими методами лечения, применяемыми отдельно (Seguin et al., Mol. Cell. Endocrinol. 21: 37-41, 1981; Lefebvre et al., The Prostate 3: 569-578, 1982; Marchetti and Labrie, J. Steroid Biochem. 29: 691-698, 1988.

[0020] Тестостерон в предстательной железе, как и во многих других тканях, необратимо превращается 5α-редуктазой в более сильный андроген дигидротестостерон (Bruchovsky and Wilson, J. Biol. Chem. 243: 2012- 2021, 1968; Wlson, Handbook of Physiology 5 (section 7), pp. 491-508, 1975). Было обнаружено, что ингибиторы 5α-редуктазы ингибируют рост предстательной железы (Brooks et al., Endocrinology 109: 830, 1981; Brooks et al., Proc. Soc. Exp. Biol. Med. 169: 67, 1982; Brooks et al., Prostate 3: 35, 1982; Wenderoth et al., Endocrinology 113,569-573, 1983; McConnell et al., J. Urol. 141: 239A, 1989); Stoner, E., Lecture on the role of 5.alpha.- reductase inhibitor in benign prostatic hypertropy, 84th AUA Annual Meeting, Dallas, May 8, 1989.

[0021] Ингибирующее действие ингибитора 5α-редуктазы Merck L 652,931 на развитие предстательной железы и семенных пузырьков у крыс препубертатного возраста было описано в Proc. 71st Annual Meeting of Endocr. Soc. abst. #1165, p. 314, 1989. Ингибирующее действие MK-906 на образование дигидротестостерона у мужчин было описано Gormley et al. в Proc. 71st Annual Meeting of Endocr. Soc., abst. #1225, p. 329, 1989; Imperato-McGinley et al., в Proc. 71st Annual Meeting of Endocr. Soc., abst. #1639, p. 432, 1989; Geller and Franson, в Proc. 71st Annual Meeting of Endocr. Soc., abst. #1640, p. 432, 1989 and Tenover et al., в Proc. 71st Annual Meeting of Endocr. Soc., abst. #583, p. 169, 1989. Активность ингибиторов 5α-редуктазы N, N-диэтил-4-метил-3-оксо-4-аза-5.альфа.-андростан-17.бета.- карбоксамида (4-MA) и 6-метилен-4-прегнен-3,20-диона (LY 207320) была описана Toomey et al., Proc. 71st Annual Meeting of Endocr. Soc., abst. #1226, p. 329, 1989.

[0022] Кроме хорошо известного воздействия андрогенов на рост предстательной железы, многие исследования показывают, что эстрогены также играют определенную роль в пролиферации предстательной железы (Walsh and Wilson, J. Clin. Invest. 57: 1093-1097, 1976; Robinette et al., Invest. Urol. 15: 425-432, 1978; Moore etal., J. Clin. Invest. 63: 351-257, 1979). Более того, обнаружили, что эстрогены увеличивают вызванный андрогенами рост предстательной железы у собак (Walsh and Wilson, J. Clin. Invest. 57: 1093-1097, 1976; Jacobi et al., Endocrinology 102: 1748-1755, 1978; Tunn et al., Urol. Int. 35: 125-140, 1980). Возможным объяснением такого усиливающего эффекта эстрогена на вызванный андрогенами рост предстательной железы может быть наблюдение, что 17β-эстрадиол усиливает связывание андрогенов в предстательной железе собак (Moore et al., J. Clin. Invest. 63: 351-357, 1979).

[0023] Было обнаружено, что антиэстроген тамоксифен улучшает вызванную стероидами доброкачественную гиперплазию предстательной железы у собак (Funke et al., Acta Endocrinol. 100: 462-472, 1982). Ведение антиэстрогена тамоксифена в сочетании со стероидным антиандрогеном ципротерона ацетатом пациентам, страдающим от доброкачественной гиперплазии предстательной железы, продемонстрировало благоприятные эффекты на симптомы заболевания (Di Silverio et al., в Ipertrofia Prostatica Benigna (F. Di Silverio, F. Neumann and M. Tannenbaum, eds), Excerpta Medica, pp. 117-125, 1986). Патент США № 4,310,523 описывает эффективность применения комбинации антиандрогена и антиэстрогена для профилактики и/или лечения доброкачественной гиперплазии предстательной железы. Однако тамоксифен оказывает собственную эстрогенную активность, что ограничивает его эффективность.

[0024] Образование эстрогена в результате ароматизации андрогенов происходит в нескольких местах. У мужчин ароматизация андрогенов происходит в яичках, жировой и мышечной ткани, коже, печени, мозгу и предстательной железе (Schweikert et al., J. Clin. Endocrinol. Metab. 40: 413-417, 1975; Folker and James, J. Steroid Biochem. 49: 687-690, 1983; Longcope et al., J. Clin. Endocrinol. Metab. 46: 146-152, 1978; Lacoste and Labrie, unpublished data; Stone et al., The Prostate 9: 311-318, 1986; Stone et al., Urol. Res. 15: 165-167, 1987). Имеются данные, указывающие на повышенную выработку эстрогенов в тканях предстательной железы у пациентов с доброкачественной гиперплазией предстательной железы (Stone et al., The Prostate 9: 311-318, 1986). Подобные данные свидетельствуют о том, что местное образование эстрогенов может играть решающую роль для стимуляции роста предстательной железы, превышая эффект, предполагаемый для циркулирующих эстрогенов.

[0025] Патент США № 4,472,382 описывает лечение доброкачественной гиперплазии предстательной железы с применением антиандрогена и определенных пептидов, которые выступают как агонисты ЛГРГ. Патент США № 4,596,797 описывает использование ингибиторов ароматазы в качестве способа профилактики и/или лечения гиперплазии предстательной железы. Патент США № 4,760,053 описывает способ лечения определенных раковых заболеваний с применением комбинации агониста ЛГРГ с антиандрогеном и/или антиэстрогеном и/или по меньшей мере одним ингибитором биосинтеза половых стероидных гормонов. Патент США № 4,775,660 описывает способ лечения рака молочных желез с применением комбинированной терапии, которая может включать хирургическое или химическое предупреждение секреции яичников и введение антиандрогена и антиэстрогена.

[0026] Патент США № 4,659,695 описывает способ лечения рака предстательной железы у склонных к заболеванию самцов, включая мужчин, чью секрецию тестикулярных гормонов блокируют хирургическим или химическим путем, например, при использовании агониста ЛГРГ, что предполагает введение антиандрогена, например, флутамида, в сочетании с по меньшей мере одним ингибитором биосинтеза половых стероидных гормонов, например, аминоглутетимидом и/или кетоконазолом. Полное содержание вышеупомянутых патентов (патенты США № 4,472,382, 4,596,797, 4,760,053, 4,775,660 и 4,659,695) включено в настоящий документ посредством ссылки.

[0027] Доброкачественная гиперплазия предстательной железы вызвана повышенной активностью как андрогенов, так и эстрогенов. Из-за подобной двойной этиологии доброкачественной гиперплазии предстательной железы предложенные гормональные терапии являются неудовлетворительными и непредсказуемыми, часто вызывая неприемлемые побочные эффекты. Более того, способы лечения предшествующего уровня техники редко приводили к уменьшению объема предстательной железы на более чем около 20-30%, оказывая неустойчивый эффект на симптоматику (Scott and Wade, J. Urol. 101: 81-85, 1969; Caine et al., J. Urol. 114: 564-568, 1975; Peters and Walsh, New Engl. J. Med. 317: 599-604, 1987; Gabrilove et al., J. Clin. Endocrinol. Metab. 64: 1331-1333, 1987; Stone et al., J. Urol. 141: 240A, 1989; Clejan et al., J. Urol. 141: 534A, 1989; Stoner, E., Lecture on the role of 5 α-reductase inhibitor in benign prostatic hypertrophy, 84th AUA Annual Meeting, Dallas, May 8, 1989.

[0028] Раскрытие механизма, приведенное выше, привело к недавней разработке эффективных агентов для контроля и во многих случаях обращения развития доброкачественной гиперплазии предстательной железы. Одно из ведущих мест среди таких агентов занимает продукт PROSCAR® (финастерид) производства компании Merck & Co., Inc. Эффект этого соединения заключается в ингибировании фермента 5α-редуктазы, который превращает тестостерон в 5α-дигидротестостерон, что приводит к снижению темпов увеличения предстательной железы и зачастую к уменьшению ее массы.

[0029] Рак предстательной железы известен как заболевание с крайне высоким показателем распространенности в отношении его клинической частоты среди популяции. Рак предстательной железы часто является бессимптомным заболеванием и имеет длительное бессимптомное течение. Интервал рака предстательной железы составляет в среднем от 7 до 14 лет, во время которого рак присутствует в доклинической форме, поскольку его невозможно идентифицировать при помощи стандартных клинических или лабораторных исследований (см. Etzioni, R et al., Am J Epidemiol. Vol. 148, pp. 775-85 (1998); и Gulati, R, et al., Cancer Epidemiol Biomarkers Prev; Vol. 20(5), pp. 740-50 (2011)). Такие доклинические бессимптомные формы рака предстательной железы до постановки четкого диагноза представляют собой хорошую мишень для лечения, и это может иметь положительный эффект для пациентов, прежде чем рак перейдет в клинически явную форму или его можно будет диагностировать каким-либо другим образом.

[0030] Во всех или в большинстве подобных случаев существует потребность в таких способах лечения, которые позволят удалять или разрушать нежелательные клеточные элементы при отсутствии рисков и побочных эффектов традиционной терапии, или в способах лечения, которые позволят более точно удалять нежелательные клеточные элементы. Кроме того, существует потребность в разработке методов лечения, которые позволят предотвращать или снижать прогрессирование рака предстательной железы или же снижать частоту случаев клинически диагностируемого рака предстательной железы.

[0031] Всюду в данном описании, включая вышеупомянутое описание предшествующего уровня техники, любые общедоступные документы, описанные в настоящем документе, включая любые опубликованные заявки на патент США, специально в полном объеме включены в настоящий документ посредством ссылки. Предшествующее описание прототипов никоим образом не предназначено для признания того факта, что любой из описанных там документов, включая рассматриваемые заявки на патент США, является прототипом настоящего изобретения. Кроме того, указание здесь любых недостатков, связанных с описанными продуктами, способами и/или аппаратурой, не предназначено для ограничения вариантов осуществления настоящего изобретения. Действительно, аспекты вариантов осуществления настоящего изобретения могут включать некоторые особенности описанных продуктов, способов и/или аппаратуры без ущерба от их недостатков.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

[0032] Все еще существует потребность в разработке новых, менее токсичных и менее интенсивных (например, избегая необходимости ежедневного или еженедельного приема лекарственных препаратов) способов лечения для предупреждения или уменьшения прогрессирования или частоты случаев рака предстательной железы. Кроме того, остается потребность в разработке таких способов лечения, которые будут снижать частоту случаев клинически диагностируемого рака предстательной железы. Данное изобретение удовлетворяет эти потребности.

[0033] Это изобретение частично основано на открытии, что некоторые пептиды белка нервной нити (NTP), включая специфический пептид, содержащий аминокислотную последовательность lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu-Glu-lle-Lys-Arg- Cys-Leu (SEQ ID NO: 66), эффективны для предупреждения или уменьшения прогрессирования рака предстательной железы, а также для снижения частоты случаев клинически диагностируемого рака предстательной железы.

[0034] Это изобретение также частично основано на открытии, что некоторые пептиды NTP, включая специфический пептид, содержащий аминокислотную последовательность lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu-Glu-lle-Lys-Arg- Cys-Leu (SEQ ID NO: 66), как отдельно, так и в комбинации с дополнительным активным агентом, эффективны для лечения и/или уничтожения нежелательных клеточных пролифераций у млекопитающих и обеспечивают неожиданное улучшение у пациентов, страдающих от рака предстательной железы или склонных к его развитию.

[0035] Некоторые варианты осуществления направлены на способы предупреждения или уменьшения прогрессирования рака предстательной железы у млекопитающих и включают введение нуждающемуся в этом млекопитающему терапевтически эффективного количества композиции, содержащей пептид NTP, отдельно или в комбинации с по меньшей мере одним активным агентом, эффективным для лечения и/или уничтожения нежелательных клеточных пролифераций у млекопитающих. В одном варианте осуществления предложены способы снижения частоты случаев рака предстательной железы у млекопитающих, включающие введение нуждающемуся в этом млекопитающему терапевтически эффективного количества композиции, содержащей пептид NTP, отдельно или в комбинации с по меньшей мере одним активным агентом, эффективным для лечения и/или уничтожения нежелательных клеточных пролифераций у млекопитающих.

[0036] Композиции могут вводиться внутримышечно, перорально, внутривенно, внутрибрюшинно, внутрицеребрально (интрапаренхиматозно), интрацеребровентрикулярно, внутриопухолево, внутриочагово, внутрикожно, интратекально, интраназально, интраокулярно, внутриартериально, местно, трансдермально, в виде аэрозоля, инфузии, болюсной инъекции, посредством имплантационного устройства, системы с замедленным высвобождением и т. д. В альтернативном варианте осуществления экспрессия пептидов NTP возможна in vivo путем введения гена, который экспрессирует пептиды NTP, путем введения в организм вакцины, которая индуцирует образование такого пептида, или путем введения в организм клеток, бактерий или вирусов, которые экспрессируют пептид in vivo вследствие генетической модификации или как-либо иначе.

[0037] В другом варианте осуществления введение композиции, содержащей пептид NTP, отдельно или в комбинации с по меньшей мере одним активным агентом, эффективным для лечения и/или уничтожения нежелательных клеточных пролифераций у млекопитающих, снижает частоту случаев клинически диагностируемого рака предстательной железы более чем на 15%, если сравнивать с известной прогнозируемой частотой случаев клинически диагностируемого рака предстательной железы.

[0038] Предшествующее общее описание и последующее детальное описание являются иллюстративными и разъяснительными и предназначены для обеспечения более детального объяснения вариантов осуществления настоящего изобретения. Другие цели, преимущества и особенности будут очевидны специалистам в данной области из последующего детального описания вариантов осуществления настоящего изобретения.

ДЕТАЛЬНОЕ ОПИСАНИЕ ПРЕДПОЧТИТЕЛЬНЫХ ВАРИАНТОВ ОСУЩЕСТВЛЕНИЯ

[0039] Перед тем как описать указанные белки, нуклеотидные последовательности, пептиды, композиции, активные агенты и т. д., а также способы, необходимо принять во внимание, что это изобретение не ограничено конкретной методологией, протоколами, линиями клеток, векторами и описанными реактивами, поскольку они могут измениться. Следует также иметь в виду, что используемая в настоящем документе терминология применяется только для описания конкретных вариантов осуществления и не предназначена для ограничения объема настоящего изобретения, которое будет ограничено только в соответствии с прилагаемой формулой изобретения.

[0040] Если не указано иное, все используемые в настоящем документе термины и фразы даны в соответствии со сформулированными ниже определениями. В тексте настоящего описания использование форм единственного числа включает ссылку на множественное число, если в контексте явно не указано иное. Таким образом, например, ссылка на «клетку-хозяина» включает множество таких клеток-хозяев, а ссылка на «антитело» является ссылкой на одно или более антител и их эквиваленты, известные специалистам в данной области, и т. д.

[0041] Описанные в настоящем документе аминокислоты и их остатки могут обозначаться в соответствии с принятым однобуквенным или трехбуквенным кодом, представленным в таблице ниже.

Таблица 1

Аминокислота Однобуквенный
символ
Трехбуквенный символ
Аланин A Ala
Аргинин R Arg
Аспарагин N Asn
Аспарагиновая кислота D Asp
Цистеин C Cys
Глутамин Q Gln
Глутаминовая кислота E Glu
Глицин G Gly
Гистидин H His
Изолейцин I lie
Лейцин L Leu
Лизин K Lys
Метионин M Met
Фенилаланин F Phe
Пролин P Pro
Серин S Ser
Треонин T Thr
Триптофан W Trp
Тирозин Y Tyr
Валин V Val

[0042] Выражение «пептид NTP» относится к пептидам, содержащим аминокислотные последовательности, соответствующие по меньшей мере части аминокислотной последовательности белков нервной нити или фрагментам белков нервной нити, и включает гомологи, производные, варианты, гибридные белки и пептидные миметики таких пептидов, если в контексте не указано иное. Выражение «пептид NTP» также относится к пептиду или другому химическому составу, описанным в одной или нескольких публикациях заявки на патент США № 2007/0237780 (в настоящее время аннулированная); № 2003/0054990 (в настоящее время патент США № 7,172,893); № 2003/0096350 (в настоящее время патент США № 6,924,266); № 2003/0096756 (в настоящее время патент США № 7,192,929); № 2003/0109437 (в настоящее время патент США № 7,241,738); № 2003/0166569 (в настоящее время патент США № 7,317,077) и № 2005/0032704 (в настоящее время патент США № 7,408,021). Полное содержание каждой из этих заявок включено в настоящий документ посредством ссылки. Специфические пептиды перечислены далее.

1) SEQ ID NO. 1: MEFSLLLPRLECNGA или Met-Glu-Phe-Ser- Leu-Leu-Leu-Pro-Arg-Leu-Glu-Cys-Asn-Gly-Ala

2) SEQ ID NO. 2: GAISAHRNLRLPGSS или Gly-Ala-lle-Ser-Ala- His-Arg-Asn-Leu-Arg-Leu-Pro- Gly-Ser-Ser

3) SEQ ID NO. 3: DSPASASPVAGITGMCT или Asp-Ser-Pro-Ala- Ser-Ala-Ser-Pro-Val-Ala-Gly-lle-Thr-Gly-Met-Cys-Thr

4) SEQ ID NO.4: MCTHARLILYFFLVEM или Met-Cys-Thr-His- Ala-Arg-Leu-lle-Leu-Tyr-Phe-Phe-Leu-Val-Glu-Met

5) SEQ ID NO.5: YFFLVEMEFLH или Tyr-Phe-Phe-Leu-Val-Glu- Met-Glu-Phe-Leu-His

6) SEQ ID NO.6: VGQAGLELPTS или Val-Gly-GIn-Ala-Gly-Leu- Glu-Leu-Pro-Thr-Ser

7) SEQ ID NO.7: DDPSVSASQSARYRTGH или Asp-Asp-Pro- Ser-Val-Ser-Ala-Ser-GIn-Ser-Ala-Arg-Tyr-Arg-Thr-Gly-His

8) SEQ ID NO.8: TGHHARLCLANFCG или Thr-Gly-His-His-Ala- Arg-Leu-Cys-Leu-Ala-Asn-Phe-Cys-Gly

9) SEQ ID NO.9: ANFCGRNRVSLMCPSWS или Ala-Asn-Phe- Cys-Gly-Arg-Asn-Arg-Val-Ser-Leu-Met-Cys-Pro-Ser-Trp-Ser

10) SEQ ID NO. 10: PELKQSTCLSLPKCWDYRR или Pro-Glu-Leu- Lys-GIn-Ser-Thr-Cys-Leu-Ser-Leu-Pro-Lys-Cys-Trp-Asp-Tyr- Arg-Arg

11) SEQ ID NO.11: LKQSTCLSLPKCWDYRR или Leu-Lys-GIn- Ser-Thr-Cys-Leu-Ser-Leu-Pro-Lys-Cys-Trp-Asp-Tyr-Arg-Arg

12) SEQ ID NO.12: STCLSLPKCWDYRR или Ser-Thr-Cys-Leu- Ser-Leu-Pro-Lys-Cys-Trp-Asp-Tyr-Arg-Arg

13) SEQ ID NO. 13: LSLPKCWDYRR или Leu-Ser-Leu-Pro-Lys- Cys-T rp-Asp-T yr-Arg-Arg

14) SEQ ID NO.14: KCWDYRRAAVPGL или Lys-Cys-Trp-Asp-Tyr- Arg-Arg-Ala-Ala-Val-Pro-Gly-Leu

15) SEQ ID NO. 15: KCWDYRRAAVPGLFILFFL или Lys-Cys-Trp- Asp-Tyr-Arg-Arg-Ala-Ala-Val-Pro-Gly-Leu-Phe-lle-Leu-Phe- Phe-Leu

16) SEQ ID NO.16: KCWDYRRAAVPGLFILFFLRHRCP или Lys- Cys-Trp-Asp-Tyr-Arg-Arg-Ala-Ala-Val-Pro-Gly-Leu-Phe-lle- Leu-Phe-Phe-Leu-Arg-His-Arg-Cys-Pro

17) SEQ ID NO.17:

KCWDYRRAAVPGLFILFFLRHRCPTLTQDEVQWCDHSS или Lys-Cys-Trp-Asp-Tyr-Arg-Arg-Ala-Ala-Val-Pro-Gly-Leu-Phe- lle-Leu-Phe-Phe-Leu-Arg-His-Arg-Cys-Pro-Thr-Leu-Thr-GIn- Asp-Glu-Val-GIn-Trp-Cys-Asp-His-Ser-Ser

18) SEQ ID NO. 18: WDYRR или Trp-Asp-Tyr-Arg-Arg

19) SEQ ID NO.19: FILFFLRHRCPTL или Phe-lle-Leu-Phe-Phe- Leu-Arg-His-Arg-Cys-Pro-Thr-Leu

20) SEQ ID NO.20: FILFFLRHRCPTLTQDEVQWCDHSS или Phe- lle-Leu-Phe-Phe-Leu-Arg-His-Arg-Cys-Pro-Thr-Leu-Thr-GIn- Asp-Glu-Val-GIn-Trp-Cys-Asp-His-Ser-Ser

21) SEQ ID NO.21: HRCPTLTQDEVQWCDHSSLQPSTPEIKHP или His-Arg-Cys-Pro-Thr-Leu-Thr-GIn-Asp-Glu-Val-GIn-Trp- Cys-Asp-His-Ser-Ser-Leu-GIn-Pro-Ser-Thr-Pro-Glu-lle-Lys- His-Pro

22) SEQ ID NO.22: PASASQVAGTKDMH или Pro-Ala-Ser-Ala- Ser-GIn-Val-Ala-Gly-Thr-Lys-Asp-Met-His

23) SEQ ID NO.23: DMHHYTWLIFIFIFNFLR или Asp-Met-His-His- Tyr-Thr-Trp-Leu-lle-Phe-lle-Phe-lle-Phe-Asn-Phe-Leu-Arg

24) SEQ ID NO.24: HYTWLIFIFIFNFLRQSLN или His-Tyr-Thr-Trp- Leu-lle-Phe-lle-Phe-lle-Phe-Asn-Phe-Leu-Arg-GIn-Ser-Leu- Asn

25) SEQ ID NO.25:

SVTQAGVQWRNLGSLQPLPPGFKLFSCPSLLSSWDYRRPP RLANF или Ser-Val-Thr-GIn-Ala-Gly-Val-GIn-Trp-Arg-Asn-Leu- Gly-Ser-Leu-GIn-Pro-Leu-Pro-Pro-Gly-Phe-Lys-Leu-Phe-Ser- Cys-Pro-Ser-Leu-Leu-Ser-Ser-Trp-Asp-Tyr-Arg-Arg-Pro-Pro- Arg-Leu-Ala-Asn-Phe

26) SEQ ID NO.26: PGFKLFSCPSLLSSWDYRR или Pro-Gly-Phe- Lys-Leu-Phe-Ser-Cys-Pro-Ser-Leu-Leu-Ser-Ser-Trp-Asp-Tyr- Arg-Arg

27) SEQ ID NO.27: FKLFSCPSLLSSWDYRRPPRLANF или Phe- Lys-Leu-Phe-Ser-Cys-Pro-Ser-Leu-Leu-Ser-Ser-Trp-Asp-Tyr- Arg-Arg-Pro-Pro-Arg-Leu-Ala-Asn-Phe

28) SEQ ID NO.28: FSCPSLLSSWDYRR или Phe-Ser-Cys-Pro- Ser-Leu-Leu-Ser-Ser-Trp-Asp-Tyr-Arg-Arg

29) SEQ ID NO.29: SLLSSWDYRR или Ser-Leu-Leu-Ser-Ser-Trp- Asp-Tyr-Arg-Arg

30) SEQ ID NO.30: SSWDY или Ser-Ser-Trp-Asp-Tyr

31) SEQ ID NO.31: SSWDYRR или Ser-Ser-Trp-Asp-Tyr-Arg-Arg

32) SEQ ID NO.32: SSWDYRRPPRLANFFVFLVEMGFTM или Ser-Ser-Trp-Asp-Tyr-Arg-Arg-Pro-Pro-Arg-Leu-Ala-Asn-Phe- Phe-Val-Phe-Leu-Val-Glu-Met-Gly-Phe-Thr-Met

33) SEQ ID NO.33: FVFLVEMGFTM или Phe-Val-Phe-Leu-Val- GI u-M et-GI y-Phe-Th r-M et

34) SEQ ID NO.34: MGFTMFARLILISGPCDLPASAS или Met-Gly- Phe-Thr-Met-Phe-Ala-Arg-Leu-lle-Leu-lle-Ser-Gly-Pro-Cys- Asp-Leu-Pro-Ala-Ser-Ala-Ser

35) SEQ ID NO.35: ISGPC или lle-Ser-Gly-Pro-Cys

36) SEQ ID NO.36: DLPASASQSAGITGVSH или Asp-Leu-Pro-Ala- Ser-Ala-Ser-GIn-Ser-Ala-Gly-lle-Thr-Gly-Val-Ser-His

37) SEQ ID NO.37: GVSHHARLIFNFCLFEM или Gly-Val-Ser-His- His-Ala-Arg-Leu-lle-Phe-Asn-Phe-Cys-Leu-Phe-Glu-Met

38) SEQ ID NO.38: NFCLFEMESH или Asn-Phe-Cys-Leu-Phe- Glu-Met-Glu-Ser-His

39) SEQ ID NO.39:

SVTQAGVQWPNLGSLQPLPPGLKRFSCLSLPSSWDYGHLP PHPANF или Ser-Val-Thr-GIn-Ala-Gly-Val-GIn-Trp-Pro-Asn- Leu-Gly-Ser-Leu-GIn-Pro-Leu-Pro-Pro-Gly-Leu-Lys-Arg-Phe- Ser-Cys-Leu-Ser-Leu-Pro-Ser-Ser-Trp-Asp-Tyr-Gly-His-Leu- Pro-Pro-His-Pro-Ala-Asn-Phe

40) SEQ ID NO.40: PPGLKRFSCLSLPSSWDYG или Pro-Pro-Gly- Leu-Lys-Arg-Phe-Ser-Cys-Leu-Ser-Leu-Pro-Ser-Ser-Trp-Asp- Tyr-Gly

41) SEQ ID NO.41: FSCLSLPSSWDYGH или Phe-Ser-Cys-Leu- Ser-Leu-Pro-Ser-Ser-Trp-Asp-Tyr-Gly-His

42) SEQ ID NO.42: LSLPSSWDY или Leu-Ser-Leu-Pro-Ser-Ser- Trp-Asp-Tyr

43) SEQ ID NO.43:

SSWDYGHLPPHPANFCIFIRGGVSPYLSGWSQTPDLR или Ser-Ser-Trp-Asp-Tyr-Gly-His-Leu-Pro-Pro-His-Pro-Ala-Asn- Phe-Cys-lle-Phe-lle-Arg-Gly-Gly-Val-Ser-Pro-Tyr-Leu-Ser- Gly-Trp-Ser-GIn-Thr-Pro-Asp-Leu-Arg

44) SEQ ID NO.44: PGFFKLFSCPSLLSSWDYRR или Pro-Gly- Phe-Phe-Lys-Leu-Phe-Ser-Cys-Pro-Ser-Leu-Leu-Ser-Ser- T rp-Asp-T yr-Arg-Arg

45) SEQ ID NO.45: PELKQSTCLSLPKCWDYRR или Pro-Glu-Leu- Lys-GIn-Ser-Thr-Cys-Leu-Ser-Leu-Pro-Lys-Cys-Trp-Asp-Tyr- Arg-Arg

46) SEQ ID NO.46: PPGLKRFSCLSLPSSWDYG или Pro-Pro-Gly- Leu-Lys-Arg-Phe-Ser-Cys-Leu-Ser-Leu-Pro-Ser-Ser-Trp-Asp- Tyr-Gly

47) SEQ ID NO.47: FSCLSLPSSWDYGH или Phe-Ser-Cys-Leu- Ser-Leu-Pro-Ser-Ser-Trp-Asp-Tyr-Gly-His

48) SEQ ID NO.48: STCLSLPKCWDYRR или Ser-Thr-Cys-Leu- Ser-Leu-Pro-Lys-Cys-Trp-Asp-Tyr-Arg-Arg

49) SEQ ID NO.49: FSCPSLLSSWDYRR или Phe-Ser-Cys-Pro- Ser-Leu-Leu-Ser-Ser-Trp-Asp-Tyr-Arg-Arg

50) SEQ ID NO.50: LSLPSSWDY или Leu-Ser-Leu-Pro-Ser-Ser- Trp-Asp-Tyr

51) SEQ ID NO.51: LSLPKCWDYRR или Leu-Ser-Leu-Pro-Lys- Cys-T rp-Asp-T yr-Arg-Arg

52) SEQ ID NO.52: SLLSSWDYRR или Ser-Leu-Leu-Ser-Ser-Trp- Asp-Tyr-Arg-Arg

53) SEQ ID NO.53: LPSSWDYRR или Leu-Pro-Ser-Ser-Trp-Asp- Tyr-Arg-Arg

54) SEQ ID NO.54: SSWDYRR или Ser-Ser-Trp-Asp-Tyr-Arg-Arg

55) SEQ ID NO.55: SSWDY или Ser-Ser-Trp-Asp-Tyr

56) SEQ ID NO.56: SSWDYRRFILFFL или Ser-Ser-Trp-Asp-Tyr- Arg-Arg-Phe-lle-Leu-Phe-Phe-Leu

57) SEQ ID NO.57: WDYRRFIFNFL или Trp-Asp-Tyr-Arg-Arg-Phe- lle-Phe-Asn-Phe-Leu

58) SEQ ID NO.58: FNFCLF или Phe-Asn-Phe-Cys-Leu-Phe

59) SEQ ID NO.59: FIFNFL или Phe-lle-Phe-Asn-Phe-Leu

60) SEQ ID NO.60: PASASPVAGITGM или Pro-Ala-Ser-Ala-Ser- Pro-Val-Ala-Gly-lle-Thr-Gly-Met

61) SEQ ID NO.61: PASASQVAGTKDM или Pro-Ala-Ser-Ala-Ser- Gln-Val-Ala-Gly-Thr-Lys-Asp-Met

62) SEQ ID NO.62: PASASQSAGITGV или Pro-Ala-Ser-Ala-Ser- Gln-Ser-Ala-Gly-lle-Thr-Gly-Val

63) SEQ ID NO.63: PASASPVAG или Pro-Ala-Ser-Ala-Ser-Pro- Val-Ala-Gly

64) SEQ ID NO.64: FFLVEM или Phe-Phe-Leu-Val-Glu-Met

65) SEQ ID NO.65: SVTQAGVQW или Ser-Val-Thr-GIn-Ala-Gly- Val-GIn-Trp

66) SEQ ID NO.66: IDQQVLSRIKLEIKRCL или lle-Asp-GIn-GIn- Val-Leu-Ser-Arg-lle-Lys-Leu- Glu-lle-Lys-Arg-Cys-Leu

67) SEQ ID NO.67: LSRIKLEIK или Leu-Ser-Arg-lle-Lys-Leu-Glu- lle-Lys

68) SEQ ID NO.68: GDHGRPNLSRLKLAIKYEVKKM или Gly-Asp- His-Gly-Arg-Pro-Asn-Leu-Ser-Arg-Leu-Lys-Leu-Ala-lle-Lys- Tyr-G I u-Val- Lys- Lys- M et

69) SEQ ID NO.69: QQSIAVKFLAVFGVSI или Gln-GIn-Ser-lle-Ala- Val-Lys-Phe-Leu-Ala-Val- Phe-Gly-Val-Ser-lle

70) SEQ ID NO.70: GLLFPVFSVCYLIAPKSPLGL или Gly-Leu- Leu-Phe-Pro-Val-Phe-Ser-Val-Cys-Tyr-Leu-lle-Ala-Pro-Lys- Ser-Pro-Leu-Gly-Leu

71) SEQ ID NO. 71: MMVCWNRFGKWVYFI или Met-Met-Val-Cys- Trp-Asn-Arg-Phe-Gly-Lys-Trp-Val-Tyr-Phe-lle

72) SEQ ID NO. 72: SAIFNFGPRYLYHGV или Ser-Ala-lle-Phe- Asn-Phe-Gly-Pro-Arg-Tyr-Leu- Tyr-His-Gly-Val

73) SEQ ID NO. 73: PFYFLILVRIISFLI или Pro-Phe-Tyr-Phe-Leu- lle-Leu-Val-Arg-lle-lle-Ser-Phe-Leu-lle

74) SEQ ID NO. 74: GDMEDVLLNCTLLKR или Gly-Asp-Met-Glu- Asp-Val-Leu-Leu-Asn-Cys-Thr-Leu-Leu-Lys-Arg

75) SEQ ID NO. 75: SSRFRFWGALVCSMD или Ser-Ser-Arg-Phe- Arg-Phe-Trp-Gly-Ala-Leu-Val-Cys-Ser-Met-Asp

76) SEQ ID NO. 76: SCRFSRVAVTYRFIT или Ser-Cys-Arg-Phe- Ser-Arg-Val-Ala-Val-Thr-Tyr- Arg-Phe-lle-Thr

77) SEQ ID NO. 77: LLNIPSPAVWMARNT или Leu-Leu-Asn-lle- Pro-Ser-Pro-Ala-Val-Trp-Met-Ala-Arg-Asn-Thr

78) SEQ ID NO. 78: MAQSRLTATSASRVQ или Met-Ala-GIn-Ser- Arg-Leu-Thr-Ala-Thr-Ser-Ala-Ser-Arg-Val-GIn

79) SEQ ID NO. 79: AILLSQPPKQLGLRA или Ala-lle-Leu-Leu-Ser- Gln-Pro-Pro-Lys-GIn-Leu-Gly-Leu-Arg-Ala

80) SEQ ID NO. 80: PANTPLIFVFSLEAG или Pro-Ala-Asn-Thr- Pro-Leu-lle-Phe-Val-Phe-Ser-Leu- Glu-Ala-Gly

81) SEQ ID NO. 81: FHHICQAGLKLLTSG или Phe-His-His-lle- Cys-GIn-Ala-Gly-Leu-Lys-Leu-Leu-Thr-Ser-Gly

82) SEQ ID NO. 82: DPPASAFQSAGITGV или Asp-Pro-Pro-Ala- Ser-Ala-Phe-GIn-Ser-Ala-Gly- lle-Thr-Gly-Val

83) SEQ ID NO. 83: SHLTQPANLDKKICS или Ser-His-Leu-Thr- Gln-Pro-Ala-Asn-Leu-Asp-Lys-Lys-lle-Cys-Ser

84) SEQ ID NO. 84: NGGSCYVAQAGLKLLASCNPSK или Asn- Gly-Gly-Ser-Cys-Tyr-Val-Ala-GIn-Ala-Gly-Leu-Lys-Leu-Leu- Ala-Ser-Cys-Asn-Pro-Ser-Lys

85) SEQ ID NO. 85: MWTLKSSLVLLLCLT или Met-Trp-Thr-Leu- Lys-Ser-Ser-Leu-Val-Leu-Leu-Leu-Cys-Leu-Thr

86) SEQ ID NO. 86: CSYAFMFSSLRQKTS или Cys-Ser-Tyr-Ala- Phe-Met-Phe-Ser-Ser-Leu-Arg-GIn-Lys-Thr-Ser

87) SEQ ID NO. 87: EPQGKVPCGEHFRIR или Glu-Pro-GIn-Gly- Lys-Val-Pro-Cys-Gly-Glu-His-Phe-Arg-lle-Arg

88) SEQ ID NO. 88: QNLPEHTQGWLGSKW или Gln-Asn-Leu-Pro- Glu-His-Thr-Gln-Gly-Trp-Leu-Gly-Ser-Lys-Trp

89) SEQ ID NO. 89: LWLLFAVVPFVILKC или Leu-Trp-Leu-Leu- Phe-Ala-Val-Val-Pro-Phe-Val-lle-Leu-Lys-Cys

90) SEQ ID NO. 90: QRDSEKNKVRMAPFF или Gln-Arg-Asp-Ser- Glu-Lys-Asn-Lys-Val-Arg-Met-Ala-Pro-Phe-Phe

91) SEQ ID NO. 91: LHHIDSISGVSGKRMF или Leu-His-His-lle- Asp-Ser-lle-Ser-Gly-Val-Ser-Gly-Lys-Arg-Met-Phe

92) SEQ ID NO. 92: EAYYTMLHLPTTNRP или Glu-Ala-Tyr-Tyr- Thr-Met-Leu-His-Leu-Pro-Thr-Thr-Asn-Arg-Pro

93) SEQ ID NO. 93: KIAHCILFNQPHSPR или Lys-lle-Ala-His-Cys- lle-Leu-Phe-Asn-GIn-Pro-His- Ser-Pro-Arg

94) SEQ ID NO. 94: SNSHSHPNPLKLHRR или Ser-Asn-Ser-His- Ser-His-Pro-Asn-Pro-Leu-Lys-Leu-His-Arg-Arg

95) SEQ ID NO. 95: SHSHNRPRAYILITI или Ser-His-Ser-His-Asn- Arg-Pro-Arg-Ala-Tyr-lle-Leu-lle-Thr-lle

96) SEQ ID NO. 96: LPSKLKLRTHSQSHH или Leu-Pro-Ser-Lys- Leu-Lys-Leu-Arg-Thr-His-Ser-GIn-Ser-His-His

97) SEQ ID NO. 97: NPLSRTSNSTPTNSFLMTSSKPR или Asn- Pro-Leu-Ser-Arg-Thr-Ser-Asn-Ser-Thr-Pro-Thr-Asn-Ser-Phe- Leu-Met-Thr-Ser-Ser-Lys-Pro-Arg

98) SEQ ID NO. 98: SSSLGLPKCWDYRHE или Ser-Ser-Ser-Leu- Gly- Leu-Pro-Lys-Cys-T rp-Asp-T yr-Arg- H is-GI u

99) SEQ ID NO. 99: LLSLALMINFRVMAC или Leu-Leu-Ser-Leu- Ala-Leu-Met-lle-Asn-Phe-Arg-Val-Met-Ala-Cys

100) SEQ ID NO. 100: TFKQHIELRQKISIV или Thr-Phe-Lys-GIn- His-lle-Glu-Leu-Arg-GIn-Lys-lle-Ser-lle-Val

101) SEQ ID NO. 101: PRKLCCMGPVCPVKI или Pro-Arg-Lys-Leu- Cys-Cys-Met-Gly-Pro-Val-Cys-Pro-Val-Lys-lle

102) SEQ ID NO. 102: ALLTINGHCTWLPAS или Ala-Leu-Leu-Thr- lle-Asn-Gly-His-Cys-Thr-Trp-Leu-Pro-Ala-Ser

103) SEQ ID NO. 103: MFVFCLILNREKIKG или Met-Phe-Val-Phe- Cys-Leu-lle-Leu-Asn-Arg-Glu-Lys-lle-Lys-Gly

104) SEQ ID NO. 104: GNSSFFLLSFFFSFQ или Gly-Asn-Ser-Ser- Phe-Phe-Leu-Leu-Ser-Phe-Phe-Phe-Ser-Phe-GIn

105) SEQ ID NO. 105: NCCQCFQCRTTEGYA или Asn-Cys-Cys- Gln-Cys-Phe-GIn-Cys-Arg-Thr-Thr-Glu-Gly-Tyr-Ala

106) SEQ ID NO. 106: VECFYCLVDKAAFECWWFYSFDT или Val- Glu-Cys-Phe-Tyr-Cys-Leu-Val-Asp-Lys-Ala-Ala-Phe-Glu-Cys- T rp-T rp-Phe-Tyr-Ser-Phe-Asp-Thr

107) SEQ ID NO. 107: MEPHTVAQAGVPQHD или Met-Glu-Pro-His-Thr-Val-Ala-GIn-Ala-Gly-Val-Pro-GIn-His-Asp

108) SEQ ID NO. 108: LGSLQSLLPRFKRFS или Leu-Gly-Ser-Leu-Gln-Ser-Leu-Leu-Pro-Arg-Phe-Lys-Arg-Phe-Ser

109) SEQ ID NO. 109: CLILPKIWDYRNMNT или Cys-Leu-lle-Leu-Pro- Lys-11 e-Trp-Asp-Ty r-Arg-Asn-M et-Asn-Th r

110) SEQ ID NO. 110: ALIKRNRYTPETGRKS или Ala-Leu-lle-Lys-Arg-Asn-Arg-Tyr-Thr-Pro-Glu-Thr-Gly-Arg-Lys-Ser

111) SEQ ID NO. 111: IDQQVLSRI или lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle

112) SEQ ID NO. 112: KLEIKRCL или Lys-Leu-Glu-lle-Lys-Arg-Cys- Leu

113) SEQ ID NO. 113: VLSRIK или Val-Leu-Ser-Arg-lle-Lys

114) SEQ ID NO. 114: RIKLEIK или Arg-lle-Lys-Leu-Glu-lle-Lys

115) SEQ ID NO. 115: VLSRI KLEIKRCL или Val-Leu-Ser-Arg-lle- Lys-Leu-Glu-lle-Lys-Arg-Cys-Leu; и

116) SEQ ID NO. 116: IDQQVLSRIKLEI или lle-Asp-GIn-GIn-Val- Leu-Ser-Arg-lle-Lys-Leu-Glu-lle.

Выражение «пептид NTP» также предпочтительно включает (помимо прочего) аминокислотные последовательности SEQ ID NO: от 1 до 116.

[0043] Термин «фрагмент» относится к белку или полипептиду, который состоит из непрерывной подпоследовательности аминокислотной последовательности белка или пептида, и включает распространенные в природе фрагменты, такие как варианты и фрагменты сплайсинга, образовавшиеся в результате протеазной активности, встречающейся в природе in vivo. Такой фрагмент может быть усечен с амино-конца, карбоксильного конца и/или от средней части (как, например, при естественном сплайсинге). Такие фрагменты можно получить из амино-концевого метионина или же без него. Термин «фрагмент» включает идентичные или отличные фрагменты одного и того же белка или пептида с общей смежной аминокислотной последовательностью или без нее, соединенных друг с другом непосредственно или через линкер. Специалист в данной области техники может без излишних экспериментов выбрать подходящий фрагмент для использования в вариантах осуществления, следуя рекомендациям и процедурам, описанным в настоящем документе.

[0044] Термин «вариант» относится к белку или полипептиду, который, в отличие от аминокислотной последовательности белка или пептида, содержит одну или более аминокислотных замен, делеций и/или инсерций, и включает встречающиеся в природе аллельные варианты или альтернативные варианты сплайсинга белка или пептида. Термин «вариант» включает замещение одной или более аминокислот в пептидной последовательности подобной или гомологичной аминокислотой (аминокислотами) или отличной аминокислотой (аминокислотами). Существует множество параметров, по которым аминокислоты могут оцениваться как подобные или гомологичные. (Gunnar von Heijne, Sequence Analysis in Molecular Biology, p. 123-39 (Academic Press, New York, N.Y. 1987.) Предпочтительные варианты включают аланиновые замены в одной или более аминокислотных позиций. К другим предпочтительным заменам относятся консервативные замены, в результате которых незначительно меняется или не меняется общий результирующий заряд, полярность или гидрофобность белка. Консервативные замены приведены ниже в таблице 2.

Таблица 2

Консервативные аминокислотные замены

Основные: аргинин
лизин
гистидин
Кислотные: глутаминовая кислота аспарагиновая кислота
Незаряженные полярные: глутамин
аспарагин
серин
треонин
тирозин
Неполярные: фенилаланин
триптофан
цистеин
глицин
аланин
валин
пролин
метионин
лейцин
изолейцин

В таблице 3 представлена другая схема аминокислотной замены:

Таблица 3

Исходный остаток Замены
Ala gly;ser
Arg lys
Asn gln;his
Asp glu
Cys ser
Gin asn
Glu asp
Gly ala; pro
His asn;gln
lle eu;val
Leu ile;val
Lys arg;gln;glu
Met leu;tyr;ile
Phe met;leu;tyr
Ser thr
Thr ser
Trp tyr
Tyr trp; phe
Val ile;leu

[0045] Другие варианты могут состоять из менее консервативных аминокислотных замен, таких как селективные остатки, которые заметнее отличаются по своему влиянию на поддержание (а) структуры полипептидного остова в области замены, например, в виде плоской или спиральной конформации, (б) заряда или гидрофобности молекулы на целевом сайте или (в) общей части боковой цепи. Предполагают, что более существенное влияние на функцию, как правило, оказывают такие замены, в которых (а) глицин и/или пролин замещается другой аминокислотой либо удаляется или включается; (б) гидрофильный остаток, например, серил или треонил, заменяется (или замещается) гидрофобным остатком, например, лейцилом, изолейцилом, фенилаланилом, валилом или аланилом; (в) цистеиновый остаток заменяется (или замещается) любым другим остатком; (г) остаток, имеющий электроположительную боковую цепь, например, лизил, аргинил или гистидил, заменяется (или замещается) остатком, имеющим электроотрицательный заряд, например, глутамилом или аспартилом; или (д) остаток, имеющий объемную боковую цепь, например, фенилаланин, заменяется (или замещается) не обладающим такой боковой цепью остатком, например, глицином. К другим вариантам относятся те, которые разработаны для образования нового сайта (новых сайтов) гликозилирования и/или фосфорилирования, или те, которые разработаны для удаления существующего сайта (существующих сайтов) гликозилирования и/или фосфорилирования. Варианты включают по меньшей мере одну аминокислотную замену на сайте гликозилирования, на сайте протеолитического расщепления и/или в цистеиновом остатке. Варианты также включают белки и пептиды, которые имеют дополнительные аминокислотные остатки в начале или в конце аминокислотной последовательности белка или пептида на линкерных пептидах. Например, цистеиновый остаток можно добавить как к амино-концу, так и к карбоксильному концу пептида NTP, чтобы осуществить циклизацию этого пептида путем образования дисульфидной связи. Термин «вариант» также охватывает полипептиды, которые содержат аминокислотную последовательность пептида NTP по меньшей мере с 1-25 или более дополнительными аминокислотами, фланкирующими с 3' или 5' концами пептида.

[0046] Термин «производное» относится к химически модифицированному белку или полипептиду, который был химически модифицирован в результате естественных процессов, таких как обработка и другие посттрансляционные модификации, или же методами химической модификации, как, например, присоединением одной или более молекул полиэтиленгликоля, сахаров, фосфатов и/или других таких молекул, где молекула или молекулы присоединены к белкам дикого типа или пептидам NTP не естественным образом. Производные включают соли. Такие химические модификации хорошо описаны в традиционной литературе, в более детальных монографиях, а также в обширной исследовательской литературе и хорошо известны специалистам в данной области техники. Следует учитывать, что тот же самый тип модификации в той или иной степени может присутствовать на нескольких сайтах данного белка или полипептида. Данный белок или полипептид может также содержать много типов модификаций. В белке или полипептиде модификации могут произойти везде, включая пептидный остов, боковые аминокислотные цепи, а также аминные и карбоксильные концы. Модификации включают, например, ацетилирование, ацилирование, АДФ-рибозилирование, амидирование, ковалентное присоединение флавина, ковалентное присоединение гемового компонента, ковалентное присоединение нуклеотида или нуклеотидного производного, ковалентное присоединение липида или липидного производного, ковалентное присоединение фосфатидилинозитола, перекрестное сшивание, циклизацию, образование дисульфидной связи, деметилирование, образование ковалентных поперечных связей, образование цистеина, образование пироглутамата, формилирование, гамма-карбоксилирование, гликозилирование, образование ГФИ-якоря, гидроксилирование, йодирование, метилирование, миристиолирование, окисление, протеолитический процессинг, фосфорилирование, пренилирование, рацемизацию, гликозилирование, присоединение липида, сульфатирование, гамма-карбоксилирование остатков глутаминовой кислоты, гидроксилирование и АДФ-рибозилирование, селеноилирование, сульфатирование, опосредованное транспортной РНК присоединение аминокислот к белкам, например, аргинилирование и убиквитинирование. См., например, Proteins-Structure And Molecular Properties, 2nd Ed., T. E. Creighton, W. H. Freeman and Company, New York (1993) и Wold, F., Posttranslational Protein Modifications: Perspectives and Prospects, pgs. 1-12 in Posttranslational Covalent Modification Of Proteins, B. C. Johnson, Ed., Academic Press, New York (1983); Seifter et al., Meth. Enzymol. 182:626-646 (1990) и Rattan etal., Protein Synthesis: Posttranslational Modifications and Aging, Ann. N.Y. Acad. Sci. 663: 48-62 (1992). Термин «производные» включает химические модификации, в результате которых образуется разветвленный или циклический белок или полипептид с разветвлением или без него. Циклические, разветвленные или разветвленные циклические белки или полипептиды могут образоваться в результате естественных посттрансляционных процессов и могут быть также получены исключительно синтетическими методами.

[0047] Термин «гомолог» относится к белку, который является по меньшей мере на 60% идентичным по своей аминокислотной последовательности пептиду NTP, что определяется стандартными методами, которые обычно используются для установления идентичности расположения аминокислот в двух полипептидах. Степень подобия или идентичности двух белков может быть легко рассчитана с помощью известных методов, включая, помимо прочего, методы, описанные в следующих трудах: Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; а также Carillo H. and Lipman, D., SIAM, J. Applied Math., 48:1073 (1988). Разработаны предпочтительные методы определения идентичности с целью выявления максимального сходства между исследуемыми последовательностями. Эти методы определения идентичности и подобия запрограммированы в общественно доступных компьютерных программах.

[0048] Предпочтительные компьютерные программные методы, пригодные для определения идентичности и подобия двух последовательностей, включают, помимо прочего, пакет программы GCG (Devereux, J., et al., Nucleic Acids Research, 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA, Atschul, S. F. et al., J. Molec. Biol., 215: 403-410 (1990). Программа BLAST X публично доступна в Национальном центре биотехнологической информации и в других источниках (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., J. Mol. Biol., 215: 403-410 (1990). Например, при использовании компьютерного алгоритма типа GAP (Компьютерная группа по генетике, Висконсинский университет, Мэдисон, Висконсин) два белка или полипептида, для которых должен быть определен процент идентичности последовательности, выравниваются для оптимального соответствия их соответствующих аминокислот (для выявления «согласованного промежутка», как это определяется алгоритмом).

[0049] Вместе с алгоритмом используется штраф на внесение делеции в выравнивание (который рассчитывают как средняя диагональ, умноженная на 3; «средняя диагональ» является средним значением диагонали используемой матрицы сравнения; «диагональ» - это показатель или число, заданное специфической матрицей сравнения для каждого идеального совпадения аминокислоты), штраф на продолжение делеции (который обычно является 1/10 частью штрафа на внесение делеции в выравнивание), а также матрица сравнения, например, РАМ 250 или BLOSUM 62. С алгоритмом может использоваться также и стандартная матрица сравнения (для матрицы сравнения РАМ250 см. Dayhoff et al. in: Atlas of Protein Sequence and Structure, vol. 5, supp.3; для матрицы сравнения BLOSUM 62 см. Henikoff et al., Proc. Natl. Acad. Sci USA, 89:10915-10919). В этом случае процент идентичности рассчитывают по алгоритму. По сравнению со сравнительным белком или пептидом гомологи в зависимости от обстоятельств, как правило, будут иметь одну или более аминокислотных замен, делеций и/или инсерций.

[0050] Термин «гибридный белок» относится к белку, в котором один или более пептидов рекомбинантно слиты или химически конъюгированы (в т. ч. ковалентно и нековалентно) с белком, таким как (помимо прочего) антитело или фрагмент антитела, например, фрагмент F.sub.ab или короткая цепь Fv. Термин «гибридный белок» также относится к мультимерам (т. е. димерам, тримерам, тетрамерам и высшим мультимерам) пептидов. К таким мультимерам относятся гомомерные мультимеры, содержащие один пептид, гетеромерные мультимеры, содержащие более чем один пептид, и гетеромерные мультимеры, содержащие по меньшей мере один пептид и по меньшей мере один другой белок. Такие мультимеры могут образоваться в результате формирования гидрофобных, гидрофильных, ионных и/или ковалентных ассоциаций, связей или звеньев, они также могут образовываться путем перекрестного сшивания с использованием линкерных молекул или могут быть связаны косвенно, например, через формирование липосомы.

[0051] Термин «пептидный миметик» или «миметик» относится к биологически активным соединениям, которые имитируют биологическую активность пептида или белка, но по химический природе они более не являются пептидами, то есть они больше не содержат пептидных связей (т. е. амидных связей между аминокислотами). Здесь термин пептидный миметик используется в более широком смысле и включает молекулы, которые по своей природе больше не являются типичными пептидами, такие как псевдопептиды, полупептиды и пептоиды. Примеры пептидных миметиков в таком более широком смысле (где часть пептида замещена структурой, не содержащей пептидных связей) описаны ниже. В соответствии с вариантами осуществления пептидные миметики, полностью или частично лишенные химической природы пептида, обеспечивают пространственную расстановку реакционноспособных химических компонентов, которая очень походит на трехмерную расстановку активных групп в пептиде, которые являются основой для пептидного миметика. В результате такой геометрии с подобным активным сайтом пептидный миметик оказывает на биологические системы такие эффекты, которые являются подобными биологической активности пептида.

[0052] Пептидные миметики в соответствии с вариантами осуществления настоящего изобретения предпочтительно по существу аналогичны как по своей трехмерной форме, так и по биологической активности описанным в настоящем документе пептидам. К примерам методов структурной модификации известного в данной области пептида с целью создания пептидного миметика относится инверсия хиральных центров остова, ведущих к структурам D-аминокислотных остатков, которые могут, в особенности на N-конце, привести к увеличению стабильности относительно протеолитической деградации, не оказывая при этом отрицательного влияния на активность. Пример этого дается в статье «Tritriated D-ala.sup.1-Peptide T Binding», Smith C. S. et al., Drug Development Res., 15, pp. 371-379 (1988). Вторым методом является изменение циклической структуры для увеличения стабильности, например, образование межмолекулярной N-C связи в имидах и лактамах (Ede et al. in Smith and Rivier (Eds.) "Peptides: Chemistry and Biology", Escom, Leiden (1991), pp. 268-270). Пример этого дается в конформационно-ограниченных соединениях, подобных тимопентину, таких, которые описаны в патенте США № 4,457,489 (1985), Goldstein, G. et al., полное содержание которого включено в настоящий документ посредством ссылки. Третий метод заключается в замещении пептидных связей в пептиде псевдопептидными связями, что ведет к повышению устойчивости к протеолизу.

[0053] Было описано множество псевдопептидных связей, которые в целом не влияют на структуру пептида и его биологическую активность. Одним из примеров такого подхода является замещение ретроинверсо-псевдопептидных связей ("Biologically active retroinverso analogues of thymopentin", Sisto A. et al in Rivier, J. E. and Marshall, G. R. (eds) "Peptides, Chemistry, Structure and Biology", Escom, Leiden (1990), pp. 722-773) and Dalpozzo, etal. (1993), Int. J. Peptide Protein Res., 41:561-566, которые включены в настоящий документ посредством ссылки). Согласно этой модификации аминокислотные последовательности пептидов могут быть идентичны последовательностям описанного выше пептида, за исключением того, что одна или более пептидных связей замещены ретроинверсо-псевдопептидной связью. Предпочтительно, чтобы большинство N-концевых пептидных связей были замещены, так как в результате такого замещения повышается устойчивость к протеолизу, который катализируется экзопептидазами, влияющими на N-конец. Дальнейшие модификации также могут быть получены путем замещения химических групп аминокислот другими химическими группами аналогичной структуры. Другая подходящая псевдопептидная связь, которая увеличивает стабильность к ферментному расщеплению, не влияя на биологическую активность или незначительно уменьшая ее, - это восстановленная изостерическая псевдопептидная связь (Couder, et al. (1993), Int. J. Peptide Protein Res., 41:181-184, полное содержание которого включено в настоящий документ посредством ссылки).

[0054] Таким образом, аминокислотные последовательности таких пептидов могут быть идентичны последовательностям пептида, за исключением того, что одна или более пептидных связей замещены изостерической псевдопептидной связью. Предпочтительно, чтобы большинство N-концевых пептидных связей были замещены, так как в результате такого замещения повышается устойчивость к протеолизу, который катализируется экзопептидазами, влияющими на N-конец. Синтез пептидов с одной или более восстановленными изостерическими псевдопептидными связями известен в данной области техники (Couder, et al. (1993), процитированный выше). Другие примеры включают использование кетометиленовой или метилсульфидной связей для замещения пептидных связей.

[0055] Пептоидные производные пептидов представляют другой класс пептидных миметиков, которые сохраняют важные структурные детерминанты для биологической активности, хотя и не содержат пептидных связей, что повышает их устойчивость к протеолизу (Simon, etal., 1992, Proc. Natl. Acad. Sci. USA, 89:9367-9371, полное содержание которого включено в настоящий документ посредством ссылки). Пептоиды - это олигомеры N-замещенных глицинов. Описано множество N-алкильных групп, каждая из которых соответствует боковой цепи природной аминокислоты (Simon, et al. (1992), процитированный выше). Некоторые или все аминокислоты пептидов могут быть замещены N-замещенным глицином, соответствующим замещенной аминокислоте.

[0056] Термин «пептидный миметик» или «миметик» включает также пептиды с обратной D-последовательностью и энантиомеры, как это определено ниже.

[0057] Термин «пептид с обратной D-последовательностью» относится к биологически активному белку или пептиду, состоящему из D-аминокислот, расположенных в обратном порядке по сравнению с последовательностью L-аминокислот пептида. Таким образом, карбоксиконцевой остаток L-аминокислотного пептида становится амино-концом для D-аминокислотного пептида и т. д. Например, пептид ETESH (SEQ ID NO: 117) становится HdSdEdTdEd, где Ed, Hd, Sd и Td являются D-аминокислотами, соответствующими L-аминокислотам E, H, S и T, соответственно.

[0058] Термин «энантиомер» относится к биологически активному белку или пептиду, в котором один или более L-аминокислотных остатков в аминокислотной последовательности пептида замещены соответствующим(-и) D-аминокислотным(-и) остатком (остатками).

[0059] Используемый в настоящем документе термин «композиция» в широком смысле относится к любой композиции, содержащей указанный пептид или аминокислотную последовательность, и необязательно к дополнительному активному агенту. Композиция может состоять из сухого состава, водного раствора или стерильной композиции. Композиции, включающие пептиды могут использоваться в качестве зондов для гибридизации. Зонды могут храниться в лиофилизированной форме и могут быть связаны со стабилизирующим агентом, таким как углевод. При гибридизации зонд можно помещать в водный раствор, содержащий соли, например, NaCl, детергенты, например, додецилсульфат натрия (SDS), и другие компоненты, например, раствор Денхардта, сухое молоко, ДНК спермы лосося и т. д.

[0060] Выражение «клинически диагностируемый рак предстательной железы» обозначает диагностирование рака предстательной железы с клинической точки зрения, а не при помощи тестов (например, анализа на ПСА) или вследствие случайного обнаружения. Специалист в данной области техники понимает разницу между клиническим диагностированием, случайным обнаружением и диагностированием при помощи тестов, ему известно, что клинически диагностируемый рак предстательной железы, как правило, предполагает проведение биопсии пораженных или окружающих тканей и определение того факта, содержит ли эта ткань раковые клетки. См., например, S. Srivastava etal., Molecular Pathology of Early Cancer, Chpt. 20 ʺPathology and Molecular Biology of Early Prostate Cancer, Sakrand Grignon, pp. 301-320, IOS Press, 1999.

[0061] В альтернативном варианте осуществления, в котором дополнительный активный агент используется вместе с пептидом NTP, выражение «активный агент» используется для обозначения любого агента, способного удалять нежелательные клеточные пролиферации и/или рост ткани. К подходящим активным агентам, помимо прочего, относятся: (i) антираковые активные агенты (такие как алкилирующие средства, ингибиторы топоизомеразы I, ингибиторы топоизомеразы II, антиметаболиты РНК/ДНК и антимитотические агенты); (ii) активные агенты для лечения доброкачественных опухолей, такие как активные агенты против угрей и бородавок; (iii) антиандрогенные соединения (ципротерона ацетат (1α, 2β-метилен-6-хлор-17 α - ацетокси-6-дегидропрогестерон) тамоксифен, ингибиторы ароматазы); (iv) блокаторы альфа-адренорецепторов (тамсулозин, теразозин, доксазозин, празозин, буназозин, индорамин, алфузозин, силодозин); (v) ингибиторы 5 α-редуктазы (финастерид, дутастерид); (vi) ингибиторы фосфодиэстеразы 5 типа (ФДЭ5) (тадалафил) и их комбинации.

[0062] Варианты осуществления настоящего изобретения направлены на способы предупреждения или уменьшения прогрессирования рака предстательной железы, а также на способы снижения частоты случаев рака предстательной железы у млекопитающих и включают введение нуждающемуся в этом млекопитающему терапевтически эффективного количества композиции, содержащей пептид NTP, отдельно или в комбинации с по меньшей мере одним активным агентом, эффективным для лечения и/или уничтожения нежелательных клеточных пролифераций у млекопитающих. В одном варианте осуществления получающие лечение млекопитающие являются такими, у которых ранее не был выявлен клинически диагностируемый рак предстательной железы. В другом варианте осуществления получающие лечение млекопитающие являются такими, у которых был выявлен клинически диагностируемый рак предстательной железы. В еще одном варианте осуществления композиции вводятся более одного раза.

[0063] Другие пептидные последовательности, полученные из пептида NTP, которые могут эффективно вызывать гибель клеток, также могут использоваться в качестве дополнительного активного агента в комбинации с описанными в настоящем документе пептидами NTP. Специалист в данной области техники, следуя предоставленным в настоящем документе рекомендациям, сможет без излишних экспериментов синтезировать фрагменты эффективного пептида, охватывая всю аминокислотную последовательность этого белка, чтобы определить другие эффективные пептидные последовательности.

[0064] Автором настоящего изобретения было неожиданно обнаружено, что использование пептидов NTP для лечения млекопитающих, нуждающихся в удалении или разрушении нежелательных клеточных элементов, обеспечило неожиданно более высокое снижение частоты случаев клинически диагностируемого рака предстательной железы, а также обеспечило неожиданное предупреждение или уменьшение прогрессирования рака предстательной железы. При проведении клинических исследований по лечению несвязанного заболевания (доброкачественной гиперплазии предстательной железы) автором настоящего изобретения было неожиданно обнаружено, что введение пептидов NTP отдельно или в комбинации с другим активным агентом значительно снизило частоту случаев клинически диагностируемого рака предстательной железы по сравнению с прогнозируемой частотой случаев у млекопитающих, не получавших никакого лечения. Сообщалось, что согласно результатам долгосрочных исследований с участием млекопитающих, страдающих от доброкачественной гиперплазии предстательной железы, частота случаев клинически диагностируемого рака предстательной железы составляла более 20%. Thompson, IM, etal., ʺThe Influence of Finasteride on the Development of Prostate Cancer,ʺ N Engl J Med, Vol.349, pp. 215-224 (2003); Andriole GL, etal., ʺEffect of Dutasteride on the Risk of Prostate Cancer,ʺ N Engl J Med, Vol. 362, pp. 1192-1202 (2010). В ходе клинических исследований автор обнаружил, что частота случаев клинически диагностируемого рака предстательной железы у мужчин, страдающих от доброкачественной гиперплазии предстательной железы и получающих лечение контрольным раствором (только базовым раствором), составила около 5-6%.

[0065] В отличие от опубликованной литературы и контрольных растворов, используемых в клиническом исследовании, пациенты, получавшие лечение композицией из настоящего изобретения, демонстрировали значительное снижение частоты случаев клинически диагностируемого рака предстательной железы. Способ в соответствии с вариантами осуществления настоящего изобретения может предотвратить возникновение клинически диагностируемого рака предстательной железы (частота случаев - 0%) или снизить частоту его возникновения по сравнению с контрольными растворами более чем на 15%, или более чем на 20%, или более чем на 25%, или более чем на 30%, или более чем на 40%, или более чем на 50%, а также на несколько порядков по сравнению с данными в известной литературе. Варианты осуществления могут обеспечить частоту случаев развития клинически диагностируемого рака предстательной железы в диапазоне от около 0% до около 5%, или от около 0% до около 4%, или от около 0% до около 3%, или от около 0% до около 2%, или от около 0% до около 1,5%, или от около 0% до около 1,3%, или от около 0% до около 1,0%, или от около 0% до около 0,8%.

[0066] При проведении клинических исследований по лечению несвязанного заболевания (доброкачественной гиперплазии предстательной железы) автором настоящего изобретения было также неожиданно обнаружено, что введение пептидов NTP отдельно или в комбинации с другим активным агентом значительно снизило и/или предотвратило прогрессирование рака предстательной железы у пациентов, которые относятся к группе риска развития рака предстательной железы. Пациент, который относится к группе риска развития рака предстательной железы, - это пациент, у которого рак предстательной железы был обнаружен на основе тестов, например, у него повышен уровень ПСА. В одном варианте осуществления пациенты, которые относятся к группе риска развития рака предстательной железы, демонстрируют на исходном уровне показатель ПСА более чем 2,0, или более чем 2,3, или более чем 2,5. Автор обнаружил, что введение композиций из вариантов осуществления настоящего изобретения для этой субпопуляции пациентов привело к снижению частоты возникновения клинически диагностируемого рака предстательной железы от около 0% до менее чем 5%, или от около 0% до менее чем 4%, или от около 0% до менее чем 3%, или от около 0% до менее чем 2%, или от около 0% до менее чем 1%, или от около 0% до менее чем 0,5%, или от около 0% до менее чем 0,2%, или до около 0% (обозначая предупреждение прогрессирования рака предстательной железы).

[0067] Варианты осуществления включают способ лечения млекопитающего, страдающего от заболевания, которое требует удаления или разрушения нежелательных клеточных пролифераций; данный способ включает введение млекопитающему один раз или более одного раза пептида NTP отдельно или в комбинации с введением дополнительного активного агента. Способ включает, помимо прочего, введение пептидов NTP внутримышечно, перорально, внутривенно, внутрибрюшинно, внутрицеребрально (интрапаренхиматозно), интрацеребровентрикулярно, внутриочагово, интраокулярно, внутриартериально, интратекально, внутриопухолево, интраназально, местно, трансдермально, подкожно или внутрикожно как отдельно, так и в конъюгированном с носителем виде. К нежелательным клеточным пролиферациям относятся, помимо прочего, доброкачественные и злокачественные опухоли, железистая гиперплазия (например, предстательной железы) и рак. Предпочтительные пептиды NTP включают один или более из следующих:

SEQ ID No. 66 IDQQVLSRIKLEIKRCL lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu- Glu-lle- Lys-Arg-Cys-Leu

SEQ ID NO. 111 IDQQVLSRI lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle

SEQ ID NO. 115 VLSRIKLEIKRCL Val-Leu-Ser-Arg-lle-Lys-Leu-Glu-lle-Lys-Arg-Cys-Leu

SEQ ID NO. 116 IDQQVLSRIKLEI lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu-Glu-lle

[0068] Любое млекопитающее может получить пользу от использования настоящего изобретения, включая людей, мышей, кроликов, собак, овец и других животных, любое млекопитающее, получающее лечение или поддающееся лечению ветеринаром, работником зоопарка или сотрудником заповедника. К предпочтительным млекопитающим относятся люди, овцы и собаки. В тексте настоящего описания термины млекопитающие и пациенты используются взаимозаменяемо.

[0069] Специалисту в данной области техники будет очевидно, что можно выбрать другие меньшие фрагменты вышеупомянутых пептидов NTP таким образом, что эти пептиды будут обладать аналогичной или схожей биологической активностью. Специалист в данной области техники может выбрать другие фрагменты таким образом, что эти пептиды будут обладать аналогичной или схожей биологической активностью. Пептиды из вариантов осуществления включают эти другие фрагменты. В целом, пептиды из вариантов осуществления содержат по меньшей мере 4 аминокислоты, предпочтительно по меньшей мере 5 аминокислот, и более предпочтительно по меньшей мере 6 аминокислот.

[0070] Варианты осуществления также охватывают способы лечения млекопитающих (или пациентов), нуждающихся в удалении или разрушении нежелательных клеточных пролифераций, данные способы включают введение композиции, содержащей пептиды NTP, содержащие два или более объединенных вместе пептидов NTP, вместе с дополнительным активным агентом. В той мере, в которой пептид NTP обладает желаемой биологической активностью, из этого следует, что два подобных пептида также будут обладать желаемой биологической активностью.

[0071] Пептиды NTP, их фрагменты, варианты, производные, гомологи, гибридные белки и миметики, которые охватывает данный вариант осуществления настоящего изобретения, могут быть получены, используя известные специалистам в данной области методы, такие как технология рекомбинантной ДНК, синтез белка и выделение встречающихся в природе пептидов, белков, белка AD7c и их фрагментов, вариантов, производных и гомологов.

[0072] Пептиды NTP и их фрагменты, варианты, производные, гомологи, гибридные белки и миметики могут быть получены из других пептидов, белков и их фрагментов, вариантов, производных и гомологов, используя методы, известные специалистам в данной области техники. Такие методы включают (помимо прочего) использование протеаз для расщепления пептида или белка с образованием желаемых пептидов NTP.

[0073] Пептид NTP может быть получен, используя известные технологии рекомбинантной ДНК, такие как сформулированные у Sambrook et al. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. and/or Ausubel etal., eds., Current Protocols in Molecular Biology, Green Publishers Inc. and Wiley and Sons, N.Y.

[0074] Ген или кДНК, кодирующие пептид NTP, могут быть получены, например, путем скрининга геномной библиотеки или библиотеки кДНК либо путем ПЦР-амплификации. Зонды и праймеры, необходимые для скрининга библиотеки, могут быть произведены на основе информации о последовательности для других известных генов или фрагментов гена от того же самого или связанного семейства генов, таких как, например, сохраненные мотивы, обнаруженные в других пептидах или белках. Кроме того, если ген, кодирующий пептид NTP, был идентифицирован, то весь ген или его часть могут использоваться в качестве зонда, чтобы идентифицировать гомологичные гены. Зонды или праймеры могут использоваться для скрининга библиотек кДНК из различных источников ткани, которые предположительно экспрессируют ген пептида NTP. Как правило, во время скрининга необходимо применять условия высокой жесткости, чтобы минимизировать число полученных при этом ложноположительных результатов.

[0075] Другой способ получения гена, кодирующего пептид NTP, состоит в том, чтобы использовать химический синтез, применяя известные специалисту в данной области техники методы, такие как описанные Engels et al., Angew. Chem. Inti. Ed., 28:716- 734. Эти способы включают, помимо прочего, фосфотриэфирный, фосфорамидитный и H-фосфонатный методы синтеза нуклеиновых кислот. Предпочтительным методом для такого химического синтеза является синтез на полимерной основе с использованием стандартных методов фосфорамидитной химии. Как правило, ДНК, кодирующая пептид или белок, будет длиной в несколько сотен нуклеотидов. Используя эти методы, нуклеиновые кислоты, содержащее более чем около 100 нуклеотидов, могут синтезироваться в виде нескольких фрагментов. После этого фрагменты могут быть лигированы вместе, чтобы сформировать полноразмерный пептид или белок. Как правило, фрагмент ДНК, кодирующий амино-конец белка, будет иметь АТГ, который кодирует остаток метионина. Этот метионин может как присутствовать, так и отсутствовать в зрелой форме белка или пептида в зависимости от того, предназначен ли синтезированный в клетке-хозяине белок для секреции из этой клетки.

[0076] При помощи стандартных методик лигирования ген, кДНК или их фрагмент, кодирующий пептид NTP, может быть включен в соответствующий вектор экспрессии или амплификации. Как правило, выбирается такой вектор, который будет функциональным в конкретно используемой клетке-хозяине (т. е. вектор совместим с механизмом клетки-хозяина таким образом, что может произойти амплификация и/или экспрессия гена). Амплификацию/экспрессию гена, кДНК или их фрагмента, кодирующего пептид NTP, можно осуществить в клетках-хозяевах прокариот, дрожжей, насекомых (системы бакуловируса) и/или эукариот. Выбор клетки-хозяина будет частично зависеть от того, должен ли пептид NTP быть гликозилирован и/или фосфорилирован. Если это так, то в качестве клетки-хозяина предпочтительны клетки дрожжей, насекомых или млекопитающих.

[0077] Как правило, векторы, используемые в любой из клеток-хозяев, будут содержать по меньшей мере 5' фланкирующую последовательность (называемую также промотором), а также другие регуляторные элементы, такие как усиливающий агент (усиливающие агенты), начало репликационного элемента, элемент терминации транскрипции, полная интронная последовательность, содержащая донорные и акцепторные сайты сплайсинга, последовательность сигнального пептида, элемент сайта связывания рибосомы, последовательность полиаденилирования, область полилинкера для включения нуклеиновой кислоты, кодирующей полипептид, который будет експрессирован, и выбираемый элемент маркера. Каждый из этих элементов описан ниже. Необязательно, вектор может содержать последовательность метки, т. е. олигонуклеотидную молекулу, расположенную на 5' или 3' концах кодирующей последовательности белка или пептида; олигонуклеотидная молекула кодирует полигис (например, гексагис (SEQ ID NO: 118)), или другую метку, такую как FLAG, HA (гемагглютинин вируса гриппа), или myc, для которой существуют коммерчески доступные антитела. Эта метка, как правило, сливается с полипептидом во время экспрессии полипептида и может служить средством для аффинной очистки белка или пептида от клетки-хозяина. Аффинная очистка может быть выполнена, например, с помощью колоночной хроматографии с использованием антител против метки в качестве аффинной матрицы. Необязательно, метка может быть впоследствии удалена с очищенного белка или пептида различными способами, например, используя определенные пептидазы.

[0078] Шарнирную область и Fc область иммуноглобулина человека специалист в данной области техники может слить на N-конце или С-конце пептида NTP. Полученный гибридный белок, содержащий Fc, может быть очищен при помощи аффинной колонки белка А. Как известно, Fc демонстрирует большой фармакокинетический период полураспада in vivo, и оказалось, что период полураспада in vivo у слившихся с Fc белков значительно больше, чем у их неслившихся аналогов. Кроме того, слияние с Fc-областью позволяет димеризовать/мультимеризовать молекулу, которая может быть полезна с точки зрения биологической активности некоторых молекул.

[0079] 5' фланкирующая последовательность может быть гомологичной (т. е. от того же вида и/или штамма, что и клетка-хозяин), гетерологичной (т. е. от другого, отличного от клетки-хозяина вида или штамма), гибридной (т. е. комбинация 5' фланкирующих последовательностей из более чем одного источника), синтетической, или она может быть 5' фланкирующей последовательностью гена нативного белка или пептида. По существу, источником 5' фланкирующей последовательности может быть любой одноклеточный прокариот или эукариот, любой позвоночный или беспозвоночный организм или любое растение при условии, что 5' фланкирующая последовательность является функциональной в механизме клетки-хозяина и может быть им активирована.

[0080] 5' фланкирующие последовательности, применимые в векторах варианта осуществления настоящего изобретения, могут быть получены любым из нескольких способов, известных в данной области техники. Как правило, применимые в настоящем изобретении 5' фланкирующие последовательности, отличающиеся от фланкирующей последовательности гена белка или пептида, должны быть предварительно идентифицированы путем картирования и/или путем расщепления рестрикционной эндонуклеазой, и, таким образом, могут быть изолированы из надлежащего источника ткани с использованием соответствующих рестрикционных эндонуклеаз. В некоторых случаях полная нуклеотидная последовательность 5' фланкирующей последовательности может быть известна. Здесь 5' фланкирующая последовательность может быть синтезирована с помощью описанных выше способов синтеза или клонирования нуклеиновых кислот. Если известна вся 5' фланкирующая последовательность или только ее часть, то она может быть получена, используя ПЦР и/или скрининг геномной библиотеки с подходящим олигонуклеотидом и/или фрагментами 5' фланкирующей последовательности от того же или другого вида.

[0081] Если 5' фланкирующая последовательность не известна, то фрагмент ДНК, содержащий 5' фланкирующую последовательность, можно выделить из более крупного участка ДНК, который может содержать, например, кодирующую последовательность или даже другой ген или гены. Выделение может быть достигнуто путем расщепления рестрикционной эндонуклеазой, используя один или более тщательно отобранных ферментов, чтобы выделить надлежащий фрагмент ДНК. После расщепления желательный фрагмент может быть выделен путем очистки в агарозном геле, на колонке Qiagen® или другими известными специалисту в данной области техники способами. Принцип выбора подходящих ферментов для достижения этой цели должен быть очевиден специалисту в данной области техники.

[0082] Начало репликационного элемента, как правило, является частью коммерчески приобретенных векторов экспрессии прокариот и способствует амплификации вектора в клетке-хозяине. Амплификация вектора до определенного числа копий в некоторых случаях может быть важна для оптимальной экспрессии белка или пептида. Если выбранный вектор не содержит начало репликационного сайта, его можно химически синтезировать на основе известной последовательности и лигировать в вектор. Элемент терминации транскрипции, как правило, расположен на 3' конце кодирующей последовательности белка или петида, и предназначен для прекращения транскрипции белка или пептида. Как правило, элемент терминации транскрипции в прокариотических клетках представляет собой G-C-богатый фрагмент, сопровождаемый поли-T последовательностью. Несмотря на то что элемент может быть клонирован от библиотеки или приобретен коммерчески как часть вектора, он может быть также легко синтезирован, используя описанные выше способы синтеза нуклеиновых кислот.

[0083] Выбираемый элемент маркерного гена кодирует белок, необходимый для выживания и роста клетки-хозяина, выращенной в селективной культуральной среде. Типичные выбираемые маркерные гены кодируют белки, которые (а) повышают устойчивость прокариотических клеток-хозяев к антибиотикам или другим токсинам, например, к ампициллину, тетрациклину или канамицину, (б) восполняют ауксотрофные дефициты клетки или (в) обеспечивают важнейшие питательные вещества, не доступные в комплексных питательных средах. Предпочтительными выбираемыми маркерами являются ген сопротивления к канамицину, ген сопротивления к ампициллину и ген сопротивления к тетрациклину.

[0084] Элемент связывания рибосомы, обычно называемый последовательностью Шайна-Дальгарно (у прокариот) или последовательностью Козак (у эукариот), как правило, необходим для инициирования трансляции мРНК. Элемент, как правило, расположен 3' от промотора и 5' от кодирующей последовательности синтезируемого белка или пептида. Последовательность Шайна-Дальгарно различна, но, как правило, представляет собой полипурин (т. е. имеет высокое содержание A-G). Множество последовательностей Шайна-Дальгарно были идентифицированы, и каждую из них можно легко синтезировать, применяя описанные выше способы, и использовать в прокариотическом векторе.

[0085] В тех случаях, когда желательно, чтобы пептид NTP был выделен из клетки-хозяина, можно использовать сигнальную последовательность, чтобы направить пептид из клетки-хозяина, где он синтезируется, и удалить карбоксильную концевую часть белка, чтобы предотвратить мембранную фиксацию. Как правило, сигнальная последовательность расположена в кодирующем участке гена пептида NTP или кДНК либо непосредственно на 5' конце кодирующего участка гена пептида. Множество сигнальных последовательностей были идентифицированы, и любую из них, которая является функциональной в выбранной клетке-хозяине, можно использовать в сочетании с геном пептида или кДНК. Следовательно, сигнальная последовательность может быть гомологичной или гетерологичной гену пептида или кДНК, а также может быть гомологичной или гетерологичной гену пептида или кДНК. Кроме того, сигнальную последовательность можно химически синтезировать, используя описанные выше способы. В большинстве случаев секреция полипептида из клетки-хозяина через присутствие сигнального пептида приводит к удалению из полипептида аминоконцевого метионина.

[0086] Во многих случаях транскрипция гена пептида NTP или кДНК повышается вследствие присутствия одного или более интронов в векторе; это, в особенности, относится к тем случаям, когда пептид вырабатывается в эукариотических клетках-хозяевах, в частности, в клетках-хозяевах млекопитающих. Используемые интроны могут естественным образом встречаться в гене пептида, особенно если используемый ген содержит полноразмерную геномную последовательность или ее фрагмент. Если интрон естественным образом не встречается в пределах гена (как в большинстве случаев для кДНК), то интрон(-ы) может быть получен из другого источника. Как правило, позиция интрона относительно фланкирующей последовательности и гена пептида является важным фактором, поскольку интрон должен быть транскрибирован, чтобы быть эффективным. По существу, если ген пептида, включенный в вектор экспрессии, является молекулой кДНК, то предпочтительной позицией интрона является 3' относительно сайта начала транскрипции и 5' относительно поли-А-последовательности терминации транскрипции. В случае кДНК пептида интрон или интроны будут предпочтительно расположены на одной или другой стороне (т. е. 5' или 3') кДНК таким образом, что это не будет прерывать данную кодирующую последовательность. Для практической реализации настоящего варианта осуществления можно использовать любой интрон из любого источника, включая любой вирусный, прокариотический и эукариотический (растение или животное) организм, при условии, что он будет совместим с клеткой-хозяином (клетками-хозяевами), в которую его вводят. В настоящий документ включены также и синтетические интроны. Необязательно, в векторе можно использовать более одного интрона.

[0087] Когда один или более описанных выше элементов отсутствуют в используемом векторе, они могут быть индивидуально получены и лигированы в вектор. Способы, используемые для получения каждого из элементов, хорошо известны специалистам в данной области техники и сопоставимы со способами, описанными выше (т. е. синтез ДНК, скрининг библиотеки и т. п.).

[0088] Заключительные векторы, используемые для практической реализации настоящего варианта осуществления, могут быть сконструированы из исходных векторов, таких как коммерчески доступный вектор. Такие векторы могут содержать или не содержать некоторые из элементов, которые будут включены в готовый вектор. Если ни один из желательных элементов не присутствует в исходном векторе, то каждый элемент может быть индивидуально лигирован в вектор путем сокращения вектора соответствующей рестрикционной эндонуклеазой (эндонуклеазами) таким образом, чтобы концы предназначенного для лигирования элемента и концы вектора были совместимы для лигирования. В некоторых случаях необходимо притуплять предназначенные для совместного лигирования концы, чтобы выполнить удовлетворительное лигирование. Притупление достигается путем заполнения вначале «липких концов», используя ДНК-полимеразу Кленова или Т4 ДНК-полимеразу в присутствии всех четырех нуклеотидов. Эта процедура хорошо известна в данной области техники и была описана ранее, например, в работе Sambrook et al. В альтернативном варианте осуществления два или более элементов, которые будут введены в вектор, сперва могут быть лигированы вместе (если они должны быть расположены смежно относительно друг друга), а затем лигированы в вектор.

[0089] Дополнительный способ конструирования вектора состоит в том, чтобы провести все лигирования различных элементов одновременно в одну реакционную смесь. В таких условиях из-за неправильного лигирования или вставки элементов будет произведено много бессмысленных или нефункциональных векторов, однако функциональный вектор может быть идентифицирован и отобран путем расщепления рестрикционной эндонуклеазой.

[0090] Предпочтительными векторами для практической реализации настоящего варианта осуществления являются те, которые совместимы с клетками-хозяевами бактерий, насекомых и млекопитающих. Такие векторы включают, помимо прочего, pCRII, pCR3 и pcDNA3.1 (Invitrogen Company, San Diego, Calif.), pBSII (Stratagene Company, La Jolla, Calif.), pET15b (Novagen, Madison, Wis.), PGEX (Pharmacia Biotech, Piscataway, N.J.), pEGFP-N2 (Clontech, Palo Alto, Calif.), pETL (BlueBachl; Invitrogen) и pFastBacDual (Gibco/BRL, Grand Island, N.Y.).

[0091] После того как вектор был построен, и молекула нуклеиновой кислоты, кодирующая полноразмерный или усеченный белок или пептид, была вставлена в надлежащий сайт вектора, готовый вектор может быть вставлен в подходящую клетку-хозяина для амплификации и/или экспрессии полипептида. Клетки-хозяева могут быть прокариотическими клетками-хозяевами (например, E. Coli), или эукариотическими клетками-хозяевами (например, клетки дрожжей, клетки насекомых или клетки позвоночных). Клетка-хозяин, культивируемая в соответствующих условиях, может синтезировать белок или пептид, которые впоследствии могут быть выделены из культуральной среды (если клетка-хозяин выделяет их в среду) или непосредственно из производящей их клетки-хозяина (если клетка-хозяин не выделяет их в среду).

[0092] После выделения пептид NTP может быть очищен при помощи таких способов, как хроматография на молекулярных ситах, аффинная хроматография и т. п. Выбор клетки-хозяина для получения белка или пептида будет частично зависеть от того, должен ли гликозилироваться или фосфорилироваться пептид (в таком случае в качестве клетки-хозяина предпочтительны эукариотические клетки), а также от способности клетки-хозяина сворачивать пептид в его нативную третичную структуру (например, надлежащая ориентация дисульфидных мостиков и т. д.) таким образом, чтобы получить биологически активный белок из пептида, обладающего биологической активностью, пептид может быть свернут после синтеза, используя соответствующие химические условия, как это описывается ниже. Подходящие клетки или линии клеток включают клетки млекопитающих, такие как клетки яичника китайского хомяка (CHO), клетки 293 или 293Т почки человеческого эмбриона (HEK) или клетки 3Т3. Принципы выбора подходящих клеток-хозяев млекопитающих и способы трансформации, культивирования, амплификации, скрининга, а также выделения и очистки продукта известны в данной области техники. К другим подходящим линиям клеток млекопитающих относятся линии клеток COS-1 и COS-7 и линия клеток CV-1 обезьяны. Следующие примеры клеток-хозяев млекопитающих включают линии клеток приматов и линии клеток грызунов, включая трансформированные линии клеток. Пригодны также нормальные диплоидные клетки, штаммы клеток, полученные из культуры in vitro первичной ткани, а также первичные ткани, культивируемые в искусственной среде. В выбираемом гене клетки-кандидаты могут быть генотипически несовершенны или могут содержать доминантно действующий выбираемый ген. К другим подходящим линиям клеток млекопитающих относятся, помимо прочего, клетки нейробластомы мыши N2A, HeLa, клетки L-929 мыши, линии 3Т3, полученные от домовых мышей, белых мышей или мышей NIH, линии клеток BHK или HaK хомяка.

[0093] Для вариантов осуществления настоящего изобретения в качестве клеток-хозяев аналогичным образом пригодны также и бактериальные клетки. Например, в области биотехнологии в качестве клеток-хозяев хорошо известны различные штаммы E. coli (например, HB101, DH5.alpha., DH10 и МС1061). Различные штаммы В. subtilis, Pseudomonas spp., другие Bacillus spp., Streptomyces spp. и т. п. также можно использовать в этом способе. Для экспрессии полипептидов, описанных в настоящих вариантах осуществления, в качестве клеток-хозяев также можно использовать клетки многих дрожжевых штаммов, известных специалистам в данной области техники.

[0094] Кроме того, где это желательно, в способах вариантов осуществления настоящего изобретения могут использоваться системы клеток насекомых. Такие системы описаны, например, у Kitts et al. (Biotechniques, 14:810-817), Lucklow (Curr. Opin. Biotechnol., 4:564-572) и Lucklow et al. (J. Virol., 67:4566-4579 ). Предпочтительными клетками насекомых являются Sf-9 и Hi5 (Invitrogen, Carlsbad, Calif.).

[0095] Инсерция (также называемая трансформацией или трансфекцией) вектора в отобранную клетку-хозяина может быть достигнута с помощью таких способов, как хлорид кальция, электропорация, микроинъекция, липофекция или ДЭАЭ-декстран. Выбранный способ частично будет зависеть от типа используемой клетки-хозяина. Эти и другие подходящие способы хорошо известны специалистам в данной области и сформулированы, например, у Sambrook et al. (см. выше).

[0096] Клетки-хозяева, содержащие вектор (т. е. трансформированные или трансфектированные клетки), могут быть культивированы с использованием стандартных сред, хорошо известных специалисту в данной области техники. Эти среды, как правило, содержат все питательные вещества, необходимые для роста и выживания клеток. Подходящими средами для культивирования клеток E. coli являются, например, бульон Luria Broth (LB) и/или бульон Terrific Broth (TB). Подходящими средами для культивирования эукариотических клеток являются RPMI 1640, MEM, DMEM, которые могут быть дополнены сывороткой и/или факторами роста, как этого требует специфика культивируемой линии клеток. Подходящей средой для клеток насекомых является среда Грейса, к которой, по мере необходимости, добавляется дрожжевой экстракт, гидролизат лактальбумина и/или эмбриональная телячья сыворотка. Как правило, антибиотик или другой компонент, способствующий селективному росту трансформированных клеток, добавляется к среде культивирования только в качестве добавки. Применяемый компонент будет определяться выбираемым маркерным элементом, присутствующим на плазмиде, при помощи которого была преобразована клетка-хозяин. Например, если выбираемый маркерный элемент устойчив к канамицину, в таком случае компонентом, который добавляют к среде культивирования, будет канамицин.

[0097] Количество пептида NTP, вырабатываемого в клетке-хозяине, можно определить с помощью стандартных способов, известных в данной области техники. К таким способам относится, помимо прочего, вестерн-блоттинг, электрофорез в полиакриламидном геле в присутствии додецилсульфата натрия, электрофорез в неденатурирующем геле, разделение с помощью ВЭЖХ, масс-спектроскопия, иммунопреципитация и/или анализы активности, такие как анализы задержки электрофоретического сдвига в геле для ДНК-связывающих белков.

[0098] Если было предусмотрено, что белок или пептид должны выделяться из клеток-хозяев, то большая часть белка или пептида может быть найдена в клеточной культуральной среде. Белки, полученные этим способом, как правило, не содержат аминоконцевой метионин, поскольку в процессе секреции он удаляется из клетки. Однако если белок или пептид не выделяются клетками-хозяевами, они будут присутствовать в цитоплазме и/или ядре (в случае эукариотических клеток-хозяев) или в цитозоли (в случае клеток-хозяев грамотрицательных бактерий) и могут содержать аминоконцевой метионин.

[0099] Для выделения пептида NTP, содержащегося в цитоплазме и/или ядре клетки-хозяина, как правило, клетки-хозяева сначала разрушаются механически или при помощи детергента, чтобы содержание клетки перешло в буферный раствор. После этого пептид может быть выделен из этого раствора.

[0100] Очистка пептидов NTP от раствора может достигаться различными методами. Если синтезируется такой пептид NTP, который на обоих своих концах, карбоксильном и аминном, содержит метку, такую как гексагистидин (SEQ ID NO: 118) (например, пептид/гексагис (SEQ ID NO: 118)), или другой маленький пептид, такой как FLAG (Sigma-Aldritch, St. Louis, Mo.), или кальмодулин-связывающий пептид (Stratagene, La Jolla, Calif.), то его по сути можно очистить при помощи одностадийного процесса путем пропускания раствора через аффинную колонку там, где матрица колонки имеет высокую аффинность к метке или непосредственно к белку (т. е. моноклональное антитело, специфически опознающее пептид). Например, полигистидин с высокой аффинностью и специфичностью связывается с никелем, цинком и кобальтом; таким образом, можно применять метод афинной хроматографии на иммобилизованных ионах металла, в котором используется никель-содержащая аффинная смола (например, используемая в системах Qiagen's QIAexpress или Invitrogen's Xpress) или кобальт-содержащая аффинная смола (например, используемая в системе BD Biosciences-CLONTECH's Talon), для очистки пептида/полигис. (См., например, Ausubel et al., eds., Current Protocols in Molecular Biology, Section 10.11.8, John Wiley & Sons, New York).

[0101] Если пептид NTP был получен без присоединенной метки, и не доступны никакие антитела, то можно использовать другие известные методы очистки. Такие методы включают, помимо прочего, ионообменную хроматографию, хроматографию на гидроксиапатите, хроматографию гидрофобного взаимодействия, хроматографию на молекулярных ситах, ВЭЖХ, электрофорез в нативном геле в комбинации с элюцией из геля и препаративное изоэлектрическое фокусирование (Isoprime machine/technique, Hoefer Scientific). B некоторых случаях для достижения высокой степени очистки два или более этих методов могут быть объединены.

[0102] Если ожидается, что пептид NTP будет, главным образом, содержаться внутри клетки, то внутриклеточный материал (включая тельца включения для грамотрицательных бактерий) может быть извлечен из клетки-хозяина, используя любой стандартный метод, известный специалисту в данной области техники. Например, с целью высвобождения содержимого периплазмы/цитоплазмы клетки-хозяева могут подвергаться лизису при помощи пресса Френча, путем гомогенизации и/или при помощи ультразвука с последующим центрифугированием. Если пептид образует тельца включения в цитозоли, то такие тельца включения часто связываются с внутренними и/или внешними клеточными мембранами, и, таким образом, после центрифугирования они преимущественно концентрируются в осадочном материале. Затем осадочный материал обрабатывают при экстремальных значениях рН или же агентом, вызывающим диссоциацию комплексов, таким как детергент, гуанидин, производные гуанидина, мочевина или производные мочевины, в присутствии восстанавливающего агента, такого как дитиотреитол при щелочных значениях рН или трис-карбоксиэтилфосфин при кислых значениях рН, для высвобождения, расщепления и растворения телец включения. В такой растворимой форме пептид может быть затем проанализирован с помощью гель-электрофореза, иммунопреципитации и т. п. Если желательно выделить пептид, то выделение может быть достигнуто при помощи стандартных способов, таких как описаны ниже и описаны у Marston et al. Meth. Enz., 182:264-275.

[0103] В некоторых случаях после выделения пептид NTP может быть биологически неактивным. Для восстановления биологической активности могут использоваться различные способы повторного свертывания или превращения полипептида в его третичную структуру и образования дисульфидных связей. К таким методам относится обработка растворенного полипептида при значении рН, как правило, выше 7 и в присутствии специфической концентрации агента, вызывающего диссоциацию комплексов. Методика выбора агента, вызывающего диссоциацию комплексов, подобна методике, которую используют при выборе метода растворения тельца включения, но обычно при более низкой концентрации. При этом не обязательно, чтобы это был тот же самый агент, вызывающий диссоциацию комплексов, который использовался для растворения. В большинстве случаев свертывающий/окисляющий раствор содержит также и восстанавливающий агент или же восстанавливающий агент совместно с его окисленной формой в определенном соотношении для создания специфического окислительно-восстановительного потенциала, позволяющего осуществить перестановку дисульфидных связей при образовании белкового цистеинового мостика (цистеиновых мостиков). Некоторые из обычно используемых окислительно-восстановительных пар включают цистеин/цистамин, глутатион (GSH)/дитиобис GSH, хлорид меди, дитиотреитол (ДТТ)/дитиан-ДТТ, 2-меркаптоэтанол (bME)/дитио-b(МЕ). Во многих случаях для увеличения эффективности свертывания необходим сорастворитель; к наиболее распространенным реагентам, используемым для этой цели, относится глицерин, полиэтиленгликоль с различной молекулярной массой и аргинин.

[0104] Если тельца включения пептида NTP в значительной степени не сформированы в клетке-хозяине, то пептид NTP следует искать, главным образом, в супернатанте после центрифугирования клеточного гомогената, и пептид NTP может быть выделен из супернатанта с помощью таких способов, как будут описаны ниже.

[0105] В тех ситуациях, где это предпочтительно для частичного или полного выделения пептида NTP, очистка может быть достигнута при помощи известных специалисту в данной области техники стандартных способов. Такие способы включают, помимо прочего, электрофоретическое разделение, сопровождаемое электроэлюцией, различные типы хроматографии (иммуноаффинная, на молекулярных ситах и/или ионообменная) и/или высокоэффективную жидкостную хроматографию. В некоторых случаях для полной очистки предпочтительно использовать несколько способов.

[0106] В дополнение к подготовке и очистке пептидов NTP с использованием методов рекомбинантной ДНК пептиды NTP и их фрагменты, варианты, гомологи, гибридные белки, пептидные миметики и производные могут быть получены способами химического синтеза (например, твердофазным синтезом пептидов) с использованием известных в данной области техники методов, таких как описанные у Merrifield et al., J. Am. Chem. Soc., 85:2149, Houghten et al. Proc Natl Acad. Sci. USA, 82:5132, а также у Stewart and Young, Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, III. Такие пептиды могут синтезироваться с метионином или без него на амино-конце. Химически синтезируемые пептиды NTP могут быть окислены, используя способы образования дисульфидных мостиков, описанные в ссылочных материалах. Предполагают, что пептиды NTP будут обладать биологической активностью, сопоставимой с активностью пептидов, полученных в результате рекомбинации или путем выделения из природных источников, и, таким образом, могут взаимозаменяемо использоваться с рекомбинантным или природным пептидом.

[0107] Химически измененные композиции пептида NTP, в которых пептид связан с полимером, включены в объем вариантов осуществления настоящего изобретения. Выбранный полимер, как правило, является водорастворимым, таким образом, связанный с ним белок не выпадает в осадок в водной среде, такой как физиологическая среда. Выбранный полимер, как правило, модифицируют, чтобы он имел единственную реакционноспособную группу, такую как активный сложный эфир для ацилирования или альдегид для алкилирования, чтобы, таким образом, можно было контролировать степень полимеризации, как это предусмотрено в способах настоящего изобретения. Полимер может меть любую молекулярную массу и может быть разветвленным или неразветвленным. В указанные пептидные полимеры включены также и смеси полимеров.

[0108] В некоторых случаях может быть желательным получение вариантов нуклеиновой кислоты и/или аминокислоты встречающихся в природе пептидов NTP. Варианты нуклеиновой кислоты могут быть получены с помощью сайт-направленного мутагенеза, ПЦР-амплификации или других соответствующих способов, в которых праймеры имеют желательные точечные мутации (описание методов мутагенеза см. выше у Sambrook et al. и Ausubel et al.). Для получения таких вариантов может также использоваться химический синтез с применением способов, описанных Engels et al. (см. выше). Можно использовать и другие известные специалисту в данной области техники способы.

[0109] Предпочтительными вариантами нуклеиновой кислоты являются те, которые содержат нуклеотидные замены, ответственные за предпочтительное использование кодона в клетке-хозяине, используемой для получения пептида NTP. Такая оптимизация кодонов может быть определена с помощью компьютерных алгоритмов, которые включают таблицы частот использования кодонов, такие как Ecohigh. Cod, показывающие предпочтительное использование кодонов высоко экспрессируемых бактериальных генов, как это предусмотрено в версии 9.0 пакета компьютерной группы генетики Висконсинского университета, Madison, Ws. К другим полезным таблицам частот использования кодонов относятся Celegans_high.cod, Celegansjow.cod, Drosophila_high.cod, Human_high.cod, Maize_high.cod и Yeast_high.cod. Другими предпочтительными вариантами являются такие, которые кодируют консервативные аминокислотные изменения, как описано выше (например, когда заряд или полярность боковой цепи встречающейся в природе аминокислоты существенно не изменяется при замещении другой аминокислотой) по сравнению с диким типом, и/или такие, которые предназначены для создания нового(-ых) сайта(-ов) гликозилирования и/или фосфорилирования, или такие, которые предназначены для удаления существующего(-их) сайта(-ов) гликозилирования и/или фосфорилирования.

[0110] Пептиды NTP и их фрагменты, гомологи, варианты, гибридные белки, пептидные миметики, производные и соли также могут быть получены, используя обычные методы синтеза пептидов, известные специалистам в данной области техники. Эти методы включают способы химического связывания (ср. Wunsch, E: Methoden der organischen Chemie, Volume 15, Band 1+2, Synthese von Peptiden, thime Verlag, Stuttgart (1974) и Barrany, G.; Marrifield, R. B.: The Peptides, eds. E. Gross, J. Meienhofer, Volume 2, Chapter 1, pp. 1- 284, Academic Press (1980)), способы ферментного связывания (ср. Widmer, F. Johansen, J. T., Carlsberg Res. Commun., Vol. 44, pp. 37-46 (1979); Kullmann, W.: Enzymatic Peptide Synthesis, CRC Press Inc. Boca Raton, Fla. (1987) и Wdmer, F., Johansen, J. T. in Synthetic Peptides in Biology and Medicines, eds. Alitalo, K., Partanen, P., Vatieri, A., pp.79-86, Elsevier, Amsterdam (1985)) или комбинацию химических и ферментных способов, если это выгодно для проекта с функциональной и экономичной точки зрения. Следуя приведенным в настоящем документе рекомендациям, специалисты в данной области техники смогут изменить пептидную последовательность пептида NTP с целью получения гомолога, имеющего аналогичную или подобную биологическую активность (биоактивность), что и исходный или нативный пептид NTP.

[0111] Существуют преимущества использования не самого пептида, а миметика такого пептида NTP. В целом, пептидные миметики биологически более доступны, имеют более длительную продолжительность действия и являются более дешевыми в получении, чем нативные белки и пептиды.

[0112] Пептидные миметики пептидов NTP могут быть получены с помощью методов комбинаторной химии и других методов, известных в данной области техники (см., например, Proceedings of the 20th European Peptide Symposium, ed. G. Jung, E. Bayer, pp. 289-336, а также приведенные там ссылки). К примерам известных в данной области техники способов структурной модификации пептида с целью создания пептидного миметика относится инверсия хиральных центров остова, ведущих к структурам D-аминокислотных остатков, которые могут, в особенности на N-конце, привести к увеличению стабильности относительно протеолитической деградации, не оказывая при этом отрицательного влияния на активность. Пример этого дается в статье Tritriated D- ala.sup.1-Peptide T Binding, Smith C. S. et al., Drug Development Res. 15, pp. 371-379 (1988).

[0113] Вторым способом является изменение циклической структуры для увеличения стабильности, например, образование межмолекулярной N-C связи в имидах и лактамах (Ede et al. in Smith and Rivier (Eds.) Peptides: Chemistry and Biology, Escom, Leiden (1991), pp. 268-270). Пример этого дается в конформационно-ограниченных соединениях, подобных тимопентину, таких, которые описаны в патенте США № 4,457,489 (1985), Goldstein, G. et al., полное содержание которого включено в настоящий документ посредством ссылки.

[0114] Третий способ заключается в замещении пептидных связей в пептиде NTP псевдопептидными связями, что ведет к повышению устойчивости к протеолизу. Было описано множество псевдопептидных связей, которые в целом не влияют на структуру пептида и его биологическую активность. Одним из примеров такого подхода является замещение ретроинверсо-псевдопептидных связей (Biologically active retroinverso analogues of thymopentin, Sisto A. et al in Rivier, J. E. and Marshall, G. R. (eds) Peptides, Chemistry, Structure and Biology, Escom, Leiden (1990), pp. 722-773) and Dalpozzo, etal. (1993), Int. J. Peptide Protein Res., 41:561-566, которые включены в настоящий документ посредством ссылки). Согласно этой модификации, аминокислотные последовательности пептидов могут быть идентичны последовательностям описанных выше пептидов, за исключением того, что одна или более пептидных связей замещены ретроинверсо-псевдопептидной связью. Предпочтительно, чтобы большинство N-концевых пептидных связей были замещены, так как в результате такого замещения повышается устойчивость к протеолизу, который катализируется экзопептидазами, влияющими на N-конец.

[0115] Синтез пептидов с одной или более восстановленными ретроинверсо-псевдопептидными связями известен в данной области техники (Sisto (1990) and Dalpozzo, et al. (1993), процитированный выше). Таким образом, пептидные связи могут быть замещены непептидными связями, которые позволяют пептидному миметику принимать аналогичную исходному пептиду структуру и, соответственно, биологическую активность. Дальнейшие модификации также могут быть получены путем замещения химических групп аминокислот другими химическими группами аналогичной структуры. Другая подходящая псевдопептидная связь, которая увеличивает стабильность к ферментному расщеплению, не влияя на биологическую активность или незначительно уменьшая ее, - это восстановленная изостерическая псевдопептидная связь (Couder, etal. (1993), Int. J. Peptide Protein Res., 41:181-184, полное содержание которого включено в настоящий документ посредством ссылки). Таким образом, аминокислотные последовательности таких пептидов могут быть идентичны последовательностям пептида, за исключением того, что одна или более пептидных связей замещены изостерической псевдопептидной связью. Предпочтительно, чтобы большая часть N-концевой пептидной связи была замещена, так как в результате такого замещения повышается устойчивость к протеолизу, который катализируется экзопептидазами, влияющими на N-конец. Синтез пептидов с одной или более восстановленными изостерическими псевдопептидными связями известен в данной области техники (Couder, et al. (1993), процитированный выше). Другие примеры включают использование кетометиленовой или метилсульфидной связей для замещения пептидных связей.

[0116] Пептоидные производные пептидов NTP представляют другой класс пептидных миметиков, которые сохраняют важные структурные детерминанты для биологической активности, хотя и не содержат пептидных связей, что повышает их устойчивость к протеолизу (Simon, et al., 1992, Proc. Natl. Acad. Sci. USA, 89:9367-9371, полное содержание которого включено в настоящий документ посредством ссылки). Пептоиды - это олигомеры N-замещенных глицинов. Описано множество N-алкильных групп, каждая из которых соответствует боковой цепи природной аминокислоты (Simon, et al. (1992), процитированный выше, полное содержание которого включено в настоящий документ посредством ссылки). Некоторые или все аминокислоты пептида заменены N-замещенным глицином, соответствующим замещенной аминокислоте.

[0117] Усовершенствованию пептидных миметиков можно способствовать путем определения третичной структуры исходного пептида с помощью ЯМР-спектроскопии, кристаллографии и/или компьютерного молекулярного моделирования. Эти методы помогают в развитии новых композиций с повышенной активностью и/или большей биодоступностью и/или более высокой стабильностью по сравнению с исходным пептидом (Dean (1994), BioEssays, 16: 683-687; Cohen and Shatzmiller (1993), J. Mol. Graph., 11: 166-173; Wiley and Rich (1993), Med. Res. Rev., 13: 327-384; Moore (1994), Trends Pharmacol. Sci., 15: 124-129; Hruby (1993), Biopolymers, 33: 1073-1082; Bugg etal. (1993), Sci. Am., 269: 92-98, которые полностью включены в настоящий документ посредством ссылки).

[0118] После идентификации потенциального пептидного миметика его можно синтезировать и анализировать, используя способы оценки его активности, описанные ниже в примерах. Настоящее изобретение охватывает соединения пептидных миметиков, полученные с помощью описанных выше способов, имеющие биологическую активность пептидов и аналогичную трехмерную структуру. Специалисту в данной области техники будет очевидно, что пептидный миметик может быть получен из любого пептида, имеющего одну или более из описанных выше модификаций. Более того, будет очевидно, что пептидные миметики из настоящего варианта осуществления в дополнение к их применению в качестве терапевтических композиций могут дополнительно использоваться для получения еще более активных непептидных соединений.

[0119] Сегодня существует множество организаций, которые способны синтезировать описанные в настоящем документе пептиды. Например, имея последовательность пептида NTP, организация может синтезировать пептид и переслать синтезированный пептид с сопровождающей документацией и доказательством идентичности этого пептида.

[0120] Варианты осуществления настоящего изобретения направлены на способы лечения млекопитающих с заболеваниями, требующими удаления клеток, такими как доброкачественные и злокачественные опухоли, железистая гиперплазия (например, предстательной железы) и рак, в которых лечение снижает частоту случаев клинически диагностируемого рака предстательной железы либо предупреждает или уменьшает прогрессирование рака предстательной железы у пациентов, которые относятся к группе риска развития рака предстательной железы. Подобный способ включает введение нуждающемуся в этом млекопитающему терапевтически эффективного количества пептида NTP отдельно или в комбинации с дополнительным активным агентом. Нуждающимися млекопитающими могут быть млекопитающие, страдающие от доброкачественной гиперплазии предстательной железы, которые могут находиться или не находиться в группе повышенного риска развития рака предстательной железы, либо млекопитающие, которые относятся к группе риска развития рака предстательной железы. Нуждающимся млекопитающим также может быть любое млекопитающее, которое может получить пользу от снижения частоты случаев клинически диагностируемого рака предстательной железы.

[0121] В случае использования дополнительного активного агента им может быть один или более активных агентов, выбранных из (i) антираковых активных агентов (таких как алкилирующие средства, ингибиторы топоизомеразы I, ингибиторы топоизомеразы II, антиметаболиты РНК/ДНК и антимитотические агенты); (ii) активных агентов для лечения доброкачественных опухолей, таких как активные агенты против угрей и бородавок (салициловая кислота); (iii) антиандрогенных соединений (ципротерона ацетат (1α, 2β-метилен-6-хлор-17α-ацетокси-6-дегидропрогестерон)) тамоксифен, ингибиторы ароматазы); (iv) блокаторов альфа-адренорецепторов (тамсулозин, теразозин, доксазозин, празозин, буназозин, индорамин, алфузозин, силодозин); (v) ингибиторов 5α-редуктазы (финастерид, дутастерид); (vi) ингибиторов фосфодиэстеразы 5 типа (ФДЭ5) (тадалафил) и их комбинаций. Предпочтительно, дополнительный активный агент выбирается из группы, состоящей из тамсулозина, финастерида, теразозина, доксазозина, празозина, тадалафила, алфузозина, силодозина, дутастерида, комбинаций дутастерида и тамсулозина, а также их смесей и комбинаций.

[0122] К заболеваниям могут относиться, например, опухоли легких, молочных желез, желудка, поджелудочной железы, предстательной железы, мочевого пузыря, костей, яичников, кожи, почек, носовых пазух, толстой кишки, кишечника, желудка, прямой кишки, пищевода, крови, головного мозга и его оболочек, спинного мозга и его оболочек, мышц, соединительной ткани, надпочечников, паращитовидной железы, щитовидной железы, матки, яичек, гипофиза, половых органов, печени, желчного пузыря, глаз, ушей, носа, горла, миндалин, рта, лимфатических узлов и лимфоидной системы и других органов. В некоторых вариантах осуществления заболевание представляет собой доброкачественную гиперплазию предстательной железы, а в других вариантах осуществления - рак предстательной железы.

[0123] Используемый в настоящем документе термин «злокачественная опухоль» охватывает все формы карцином, сарком и меланом человека, которые встречаются в плохо дифференцированной, умеренно дифференцированной и хорошо дифференцированной формах.

[0124] К заболеваниям, которые можно лечить подобным образом, также относятся, например, гиперплазия, гипертрофия или патологическое разрастание ткани органов, выбранных из группы, состоящей из легких, молочных желез, желудка, поджелудочной железы, предстательной железы, мочевого пузыря, костей, яичников, кожи, почек, носовых пазух, толстой кишки, кишечника, желудка, прямой кишки, пищевода, крови, головного мозга и его оболочек, спинного мозга и его оболочек, мышц, соединительной ткани, надпочечников, паращитовидной железы, щитовидной железы, матки, яичек, гипофиза, половых органов, печени, желчного пузыря, глаз, ушей, носа, горла, миндалин, рта, лимфатических узлов и лимфоидной системы.

[0125] К другим заболеваниям, которые можно лечить с использованием способа из вариантов осуществления настоящего изобретения, относятся вирусные, бактериальные или паразитические изменения ткани органов, выбранных из группы, состоящей из легких, молочных желез, желудка, поджелудочной железы, предстательной железы, мочевого пузыря, костей, яичников, кожи, почек, носовых пазух, толстой кишки, кишечника, желудка, прямой кишки, пищевода, крови, головного мозга и его оболочек, спинного мозга и его оболочек, мышц, соединительной ткани, надпочечников, паращитовидной железы, щитовидной железы, матки, яичек, гипофиза, половых органов, печени, желчного пузыря, глаз, ушей, носа, горла, миндалин, рта, лимфатических узлов и лимфоидной системы.

[0126] К заболеваниям, которые можно лечить подобным образом, также относятся патологии или нарушения ткани органов, выбранных из группы, состоящей из легких, молочных желез, желудка, поджелудочной железы, предстательной железы, мочевого пузыря, костей, яичников, кожи, почек, носовых пазух, толстой кишки, кишечника, желудка, прямой кишки, пищевода, крови, головного мозга и его оболочек, спинного мозга и его оболочек, мышц, соединительной ткани, надпочечников, паращитовидной железы, щитовидной железы, матки, яичек, гипофиза, половых органов, печени, желчного пузыря, глаз, ушей, носа, горла, миндалин, рта, лимфатических узлов и лимфоидной системы.

[0127] В частности, заболевание, которое можно лечить, может представлять собой гипертрофию миндалевидной железы, гиперплазию предстательной железы, псориаз, экзему, дерматозы или геморрой. Заболевание, которое можно лечить, может представлять собой сосудистую болезнь, такую как атеросклероз или артериосклероз, или нарушение сердечно-сосудистой системы, такое как варикозное расширение вен, стеноз или рестеноз артерии или стента. Заболевание, которое можно лечить, также может представлять собой косметическую модификацию ткани, например, кожи, глаз, ушей, носа, горла, рта, мышц, соединительной ткани, волос или ткани молочных желез.

[0128] Терапевтические композиции пептидов NTP могут содержать терапевтически эффективное количество пептида NTP в смеси с фармацевтически приемлемым носителем. В некоторых альтернативных вариантах осуществления дополнительный активный агент может быть введен в одной композиции вместе с пептидом NTP, а в других вариантах осуществления композицию, содержащую пептид NTP, вводят в виде инъекции, тогда как дополнительный активный агент будет составлен в виде препарата для перорального приема (гель, капсула, таблетка, жидкость и т. д.). Материалом носителя может быть вода для инъекции, предпочтительно содержащая добавленные к ней другие материалы, обычно используемые для введения в организм млекопитающих. Как правило, пептид NTP для терапевтического применения вводят в виде композиции, содержащей очищенный пептид в сочетании с одним или более физиологически приемлемых носителей, эксципиентов или разбавителей. Примерами подходящих носителей являются нейтральный забуференный физиологический раствор или физиологический раствор, смешанный с сывороточным альбумином. Предпочтительно, продукт составлен в виде лиофилизата с использованием соответствующих эксципиентов (например, сахарозы). При желании могут быть включены и другие стандартные носители, разбавители и эксципиенты. Композиции из вариантов осуществления настоящего изобретения могут также содержать известные специалистам в данной области техники буферы с соответствующим диапазоном значений уровня рН, в том числе Трис-буфер, имеющий рН около 7,0-8,5, или ацетатный буфер, имеющий рН около 4,0-5,5, которые могут дополнительно содержать сорбитол или его подходящую замену.

[0129] Настоящее изобретение также охватывает использование пептидов NTP, конъюгированных, связанных или сцепленных с антителом, фрагментом антитела, антителоподобной молекулой или молекулой с высокой аффинностью к определенному опухолевому маркеру, такому как клеточный рецептор, сигнальный пептид или сверхэкспрессированный фермент, для воздействия на нежелательные клеточные элементы у млекопитающего, ранее не получавшего лечение. Антитело, фрагмент антитела, антителоподобная молекула или молекула с высокой аффинностью к определенному опухолевому маркеру используются для воздействия на пептид, конъюгированный с определенной целевой клеткой или тканью. Например, на опухоль с отличительным поверхностным антигеном или экспрессированным антигеном может быть нацелено антитело, фрагмент антитела или антителоподобная связывающая молекула, в результате чего опухолевые клетки могут быть убиты пептидом. Такой подход с использованием нацеливания антитела имеет ожидаемые преимущества, выражающиеся в уменьшении дозировки, увеличении вероятности их связывания с целевыми клетками или поглощения ими, а также увеличении эффективности воздействия на метастатические и микроскопические опухоли и их лечения.

[0130] Настоящее изобретение также охватывает использование пептидов NTP, конъюгированных, связанных или сцепленных с белком или другой молекулой для образования композиции, которая при расщеплении в месте(-ах) расположения опухоли или других нежелательных клеток или возле него(них) ферментом или протеазой, специфическими для данной опухоли или места, или конъюгатом антитела, которое воздействует на опухоль или другие нежелательные клетки, выделяет пептид в месте(-ах) расположения опухоли или других нежелательных клеток.

[0131] Настоящее изобретение также охватывает использование пептидов NTP, конъюгированных, связанных или сцепленных с белком или другой молекулой для образования композиции, которая выделяет пептид или некоторый биологически активный фрагмент пептида при освещении обрабатываемой ткани светом (как в случае лазерной терапии или другой фотодинамической или фотоактивированной терапии) и другими формами электромагнитного излучения, такими как инфракрасное излучение, ультрафиолетовое излучение, рентгеновское или гамма-излучение, локальная термообработка, альфа- или бета-излучение, ультразвуковая эмиссия или другие источники локализованной энергии.

[0132] Настоящее изобретение охватывает также терапевтические композиции пептидов NTP, использующие дендримеры, фуллерены и другие синтетические молекулы, полимеры и макромолекулы, где пептид и/или соответствующая ему молекула ДНК конъюгированы или соединены с молекулой, полимером или макромолекулой, или включены в них самостоятельно или совместно с другими разновидностями молекул, такими как опухолеспецифический маркер. Например, в патенте США № 5,714,166 «Биологически активные и/или целевые дендримерные конъюгаты», среди прочего, описан способ получения и применения конъюгатов дендритного полимера, состоящего по меньшей мере из одного дендримера с целевой(-ыми) директорией(-ями) и по меньшей мере одного биологически активного агента, конъюгированного с ним. Содержание патента США № 5,714,166 полностью включено в настоящий документ посредством ссылки.

[0133] Настоящее изобретение также охватывает способы лечения млекопитающих с помощью терапевтических композиций, содержащих пептиды NTP и/или гены и системы доставки лекарственных средств, такие как липидные эмульсии, мицеллярные полимеры, полимерные микросферы, электроактивные полимеры, гидрогели и липосомы, в комбинации с дополнительным активным агентом.

[0134] Использование пептидов NTP, родственных генов или генных эквивалентов, переданных нежелательным клеткам у млекопитающих, также охватывается настоящим изобретением. Сверхэкспрессия пептида NTP в пределах опухоли может использоваться, чтобы индуцировать гибель клеток опухоли и тем самым уменьшать популяцию опухолевых клеток. Полагают, что передача гена или генного эквивалента пептида NTP для лечения нежелательных клеточных элементов имеет преимущества, так как предполагает использование меньшей дозы и проникает в потомственные образования целевых клеточных элементов, обусловливая тем самым потребность менее частого проведения терапии и меньшего объема общей терапии. Это изобретение также охватывает передачу генов, которые кодируют гибридный белок, содержащий пептид NTP, нежелательным клеткам или соседним клеткам, где после экспрессии гена и образования и/или выделения гибридного белка последний расщепляется при воздействии нативных ферментов или протеаз либо под влиянием пролекарств, выделяя при этом пептид NTP в нежелательные клетки или около них.

[0135] Использование клонированных рекомбинантных конъюгатов пептидов с антителами; клонированных рекомбинантных конъюгатов пептидов с фрагментами антител и клонированных рекомбинантных конъюгатов пептидов с антителоподобными белками для введения млекопитающим, ранее не получавшим лечение, также входит в объем настоящего изобретения. Преимущества клонированного пептида NTP, объединенного с направленным конъюгатом (таким как антитело, фрагмент антитела, антителоподобная молекула или молекула с высокой аффинностью к рецептору, специфическому к раку, или другому опухолевому маркеру), состоят в том, что такая молекула объединяет описанные выше преимущества нацеливания в дополнение к преимуществам производства и стандартизации клонированной конъюгированной молекулы.

[0136] Настоящее изобретение дополнительно охватывает использование терапевтических композиций пептидов NTP, генов или генных эквивалентов в качестве компонента покрытия медицинского устройства, такого как стент, чтобы устранить, ингибировать или предотвратить нежелательную клеточную пролиферацию или аккумуляцию в комбинации с дополнительным активным агентом.

[0137] К твердым лекарственным формам для перорального введения относятся, помимо прочего, капсулы, таблетки, пилюли, порошки и гранулы. В таких твердых лекарственных формах дополнительный активный агент и/или пептид NTP могут быть смешаны по меньшей мере с одним из следующих: (а) одним или более инертных эксципиентов (или носителей), такими как цитрат натрия или дикальцийфосфат; (б) филлерами или экстендерами, такими как крахмалы, лактоза, сахароза, глюкоза, маннитол и кремниевая кислота; (в) связующими веществами, такими как карбоксиметилцеллюлоза, альгинаты, желатин, поливинилпирролидон, сахароза и аравийская камедь; (г) увлажнителями, такими как глицерин; (д) разрыхлителями, такими как агар-агар, карбонат кальция, картофельный или тапиоковый крахмал, альгиновая кислота, некоторые комплексные силикаты и карбонат натрия; (е) замедлителями схватывания растворов, такими как парафин; (ж) ускорителями всасывания, такими как четвертичные аммониевые соединения; (з) смачивающими агентами, такими как ацетиловый спирт и глицерина моностеарат; (и) адсорбентами, такими как каолин и бентонит; и (к) лубрикантами, такими как тальк, стеарат кальция, стеарат магния, твердые полиэтиленгликоли, лаурилсульфат натрия или их смесями. В случае капсул, таблеток и пилюль лекарственные формы могут также включать буферные агенты.

[0138] Жидкие лекарственные формы для перорального введения включают фармацевтически приемлемые эмульсии, растворы, суспензии, сиропы и эликсиры. В дополнение к активным соединениям жидкие лекарственные формы могут содержать инертные разбавители, такие как вода или другие растворители, солюбилизирующие средства и эмульгаторы, которые широко используются в данной области техники. К примерам эмульгаторов относится этиловый спирт, изопропиловый спирт, этилкарбонат, этилацетат, бензиловый спирт, бензилбензоат, пропиленгликоль, 1,3-бутиленгликоль, диметилформамид, масла, такие как хлопковое масло, арахисовое масло, кукурузное масло, оливковое масло, касторовое масло и кунжутное масло, глицерин, тетрагидрофурфуриловый спирт, полиэтиленгликоли, сложные эфиры жирных кислот сорбита или смеси этих веществ и т. п.

[0139] Кроме подобных инертных разбавителей, композиции также могут содержать адъюванты, такие как смачивающие агенты, эмульсифицирующие и суспендирующие агенты, подсластители, ароматизаторы и отдушки.

[0140] Фактические уровни дозировки активных ингредиентов в композициях вариантов осуществления настоящего изобретения можно варьировать таким образом, чтобы получать количество пептида NTP и дополнительного активного агента, которое эффективно для достижения требуемого терапевтического ответа на конкретную композицию и способ введения. Поэтому выбранный уровень дозировки зависит от требуемого терапевтического эффекта, пути введения, требуемой продолжительности лечения и других факторов.

[0141] Млекопитающим, включая людей, эффективные количества могут быть введены, основываясь на площади поверхности тела. Взаимосвязь дозировок для животных различных размеров и видов, а также для людей (основанная на мг/м2 поверхности тела) описана E. J. Freireich et al., Cancer Chemother. Rep., 50 (4):219 (1966). Площадь поверхности тела может быть приблизительно определена на основании роста и веса индивидуума (см., например, Scientific Tables, Geigy Pharmaceuticals, Ardsley, N.Y. pp. 537-538 (1970)).

[0142] Общая суточная доза пептида NTP и дополнительного активного агента может вводиться в организм хозяина в однократной или разделенной дозах. Композиции в единичной дозированной форме могут содержать такие количества ее дольных единиц, которые в сумме составляют суточную дозу. Следует, однако, понимать, что определенный уровень дозы для любого конкретного пациента будет зависеть от различных факторов, включая массу тела, общее состояние здоровья, пол, режим питания, время и путь введения, активность введенного препарата, скорость всасывания и выведения, комбинацию с другими лекарственными средствами и серьезность конкретной болезни, подлежащей лечению. Предпочтительно, чтобы композиция вводилась однократно в виде инъекции или инфузии, а в другом предпочтительном варианте осуществления композицию вводят дважды. В настоящем варианте осуществления период времени между введением композиции может варьироваться в пределах от 2 месяцев до 10 лет, или от 8 месяцев до 4 лет, или в пределах более чем около одного года (например, от 1 до 2 лет).

[0143] Способ введения композиции пептида NTP согласно вариантам осуществления настоящего изобретения включает, помимо прочего, введение соединений внутримышечно, перорально, внутривенно, внутрибрюшинно, внутрицеребрально (интрапаренхиматозно), интрацеребровентрикулярно, внутриопухолево, внутриочагово, внутрикожно, интратекально, интраназально, интраокулярно, внутриартериально, местно, трансдермально, в виде аэрозоля, инфузии, болюсной инъекции, посредством имплантационного устройства, системы с замедленным высвобождением и т. д.

[0144] Другой способ введения пептида NTP, описанного в вариантах осуществления, - это трансдермальный или чрескожный путь. Дополнительный активный агент может применяться вместе с пептидом NTP или может вводиться отдельно, как было описано выше, или же может не вводиться вообще. Одним примером такого варианта осуществления является использование пластыря. В частности, пластырь может быть изготовлен с тонкодисперсной суспензией пептида, например, в диметилсульфоксиде (ДМСО) или в смеси ДМСО с хлопковым маслом, и наложен на поверхность кожи млекопитающих, имеющих опухоль, путем помещения пластыря в карман кожи вдали от участка размещения опухоли. Другие среды или их смеси с другими растворителями и твердыми подложками также подойдут одинаково хорошо. Пластырь может содержать соединение пептида в виде раствора или суспензии. Затем пластырь может быть наложен на кожу пациента, например, посредством размещения в кармане кожи пациента, сформированном путем загибания кожи и ее закрепления с помощью стежков, клипс или других зажимных приспособлений. Этот карман должен использоваться таким образом, чтобы был обеспечен непрерывный контакт с кожей без вмешательства млекопитающего. Помимо кармана кожи может использоваться любое приспособление, которое будет обеспечивать прочный контакт пластыря с кожей. Например, для закрепления пластыря на коже можно использовать клейкую повязку.

[0145] Пептиды NTP необязательно в комбинации с дополнительным активным агентом могут вводиться в виде лекарственной формы или препарата с замедленным высвобождением. Подходящие примеры препаратов с замедленным высвобождением включают полупроницаемые полимерные матрицы в виде формованных изделий, например, пленок или микрокапсул. К матрицам с замедленным высвобождением относятся полиэфиры, гидрогели, полилактиды (патент США № 3,773,919, EP 58,481), сополимеры L-глутаминовой кислоты и гамма этил-L-глютамата (Sidman et al., Biopolymers, 22: 547-556), поли(2-гидроксиэтилметакрилат) (Langer et al., J. Biomed. Mater. Res., 15: 167-277 и Langer, Chem. Tech., 12: 98- 105), этиленвинилацетат (Langer et al., supra) или поли-D-(-)-3-гидроксимасляная кислота (EP 133,988). Композиции с замедленным высвобождением также могут включать липосомы, которые могут быть получены любым из нескольких методов, известных в данной области техники (например, Eppstein et al., Proc. Natl. Acad. Sci. США, 82: 3688- 3692; EP 36,676; EP 88,046; и EP 143,949).

[0146] Другой способ введения пептида NTP, описанного в вариантах осуществления настоящего изобретения, основан на прямой или непрямой инфузии пептида NTP в опухоль или другую ткань, подвергаемую лечению. Одним примером такого варианта осуществления является прямая инъекция пептида NTP в опухоль или другую ткань, подвергаемую лечению. Лечение может состоять из одной инъекции, многократных инъекций в один прием или ряда инъекций в течение нескольких часов, дней или месяцев, что приводит к регрессии или разрушению опухоли или другой ткани, подвергаемой лечению. Такое лечение контролируется посредством биопсии, визуализации или других способов контроля тканевого роста. Инъекцию в опухоль или другую ткань, подвергаемую лечению, можно осуществить с помощью устройства, вставленного в полость, такую как нос, рот, ухо, влагалище, прямая кишка или уретра, или через разрез, чтобы проникнуть в опухоль или ткань in vivo, и ее можно выполнить в комплексе с применением метода визуализации или оптической системы, такой как ультразвуковой или волоконно-оптический эндоскоп, для идентификации соответствующего участка для выполнения инъекции(-й). Другой пример такого варианта осуществления состоит в использовании устройства, которое может обеспечить постоянную инфузию пептида NTP в ткань в течение некоторого времени.

[0147] Другой способ введения пептида NTP осуществляется в комплексе с хирургической или аналогичной процедурой, используемой для физического удаления, ампутации или разрушения любым другим способом опухолевых или других тканей или клеточных элементов, удаления или разрушения которых желают достичь, при этом пептид NTP из вариантов осуществления настоящего изобретения вводят непосредственно в область(-и) вокруг удаленной опухоли или другой ткани, чтобы уничтожить или воспрепятствовать росту любых опухолевых клеток или других клеточных элементов, которые не были удалены или разрушены в результате вышеописанной процедуры.

[0148] Другой способ введения пептида NTP, описанного в вариантах осуществления настоящего изобретения, основан на имплантации устройства в опухоль или другую ткань, подвергаемую лечению. В этом варианте осуществления дополнительный активный агент, как правило, будет вводиться отличным от пептида NTP путем. Одним примером такого варианта осуществления является имплантация содержащей пептид NTP пластинки в опухоль или другую ткань, подвергаемую лечению, и пероральное введение дополнительного активного агента. Через какое-то время пластинка выделяет в ткань терапевтическую дозу пептида NTP. Альтернативно или дополнительно, композиция может вводиться местно путем имплантации в пораженную область мембраны, губки или другого соответствующего материала, которые были пропитаны пептидом NTP. Если используется имплантационное устройство, оно может имплантироваться в любую подходящую ткань или орган, а доставка пептида может осуществляться непосредственно через устройство в виде болюсной инъекции, путем непрерывного введения или через катетер путем непрерывной инфузии.

[0149] Альтернативный способ введения состоит в том, чтобы ввести одну или более копий гена, кодирующего пептид NTP, в целевую клетку и при необходимости индуцировать с помощью копии(-й) гена внутриклеточное образование пептида. В этом варианте осуществления дополнительный активный агент, как правило, будет вводиться отличным от пептида NTP путем. Один из способов применения генной терапии состоит в том, чтобы использовать ген, кодирующий пептид NTP (геномную ДНК, кДНК и/или синтетическую ДНК, кодирующую пептид (или его фрагмент, вариант, гомолог или производное)), который может быть функционально связан с конститутивным или индуцируемым промотором для образования ДНК-конструкции генной терапии. Промотор может быть гомологичным или гетерологичным эндогенному гену, кодирующему пептид, при условии, что он будет активен в клетке или ткани такого типа, в которую будет помещена конструкция. Другие компоненты ДНК-конструкции генной терапии могут в случае необходимости необязательно включать молекулы ДНК, предназначенные для сайт-специфической интеграции (например, эндогенные фланкирующие последовательности, необходимые для гомологической рекомбинации), тканеспецифичный промотор, энхансер(-ы) или сайленсер(-ы), молекулы ДНК, способные к обеспечению избирательного преимущества перед родительской клеткой, молекулы ДНК, необходимые в качестве меток для идентификации трансформированных клеток, системы негативного отбора, клеточноспецифические связывающие средства (например, для нацеливания на клетки), клеточноспецифические факторы интернализации и факторы транскрипции для повышения экспрессии вектором, а также факторы, позволяющие изготовлять вектор.

[0150] К средствам доставки генов к клетке или ткани in vivo или ex vivo относится (помимо прочего) прямая инъекция голой ДНК, баллистические методы, опосредованная липосомой передача, опосредованная рецептором передача (комплекс лиганд-ДНК), электропорация и осаждение фосфатом кальция. См. патент США № 4,970,154, WO 96/40958, патент США № 5,679,559, патент США № 5,676,954 и патент США № 5,593,875, полное содержание каждого из которых включено в настоящий документ посредством ссылки. Они также включают использование вирусного вектора, такого как ретровирус, аденовирус, аденоассоциированный вирус, поксвирус, лентивирус, вирус папилломы или вирус простого герпеса, использование конъюгата ДНК с белком и использование липосомы. Использование векторов генной терапии описано, например, в патенте США № 5,672,344, патенте США № 5,399,346, патенте США № 5,631,236 и патенте США № 5,635,399, полное содержание каждого из которых включено в настоящий документ посредством ссылки.

[0151] Ген, кодирующий пептид NTP, может быть доставлен путем имплантации пациентам некоторых клеток, которые генетически проектировались ex vivo для экспрессии и секреции пептида NTP или его фрагментов, вариантов, гомологов или производных, используя для этого способы, такие как описываются в настоящем документе. Подобные клетки могут быть животными или человеческими и могут быть получены из собственной ткани пациента или из другого источника, как человеческого, так и нечеловеческого. Необязательно клетки могут быть иммортализованы или они могут быть стволовыми клетками. Однако с целью снизить шанс появления иммунологического ответа, предпочтительно инкапсулировать клетки во избежание инфильтрации окружающих тканей. В качестве материала для инкапсуляции, как правило, используют биологически совместимые, полупроницаемые полимерные оболочки или мембраны, которые обеспечивают высвобождение белковых продуктов, но предотвращают разрушение клеток посредством иммунной системы пациента или другими вредными факторами окружающих тканей. Способы, используемые для мембранной инкапсуляции клеток, знакомы специалистам в данной области техники, а подготовка инкапсулированных клеток и их имплантация в организм пациентов может быть достигнута без излишних экспериментов. См., например, патенты США №№ 4,892,538; 5,011,472 и 5,106,627, полное содержание каждого из которых включено в настоящий документ посредством ссылки. Система инкапсуляции живых клеток описана в заявке PCT WO 91/10425. Методы получения множества других форм с замедленным или контролируемым высвобождением, таких как липосомные носители, биоразлагаемые частицы или гранулы, также известны специалистам в данной области техники и описаны, например, в патенте США № 5,653,975, полное содержание которого включено в настоящий документ посредством ссылки. Инкапсулированные или неинкапсулированные клетки могут быть имплантированы в подходящие ткани или органы пациента.

[0152] В некоторых вариантах осуществления настоящее изобретение предлагает способ снижения частоты случаев клинически диагностируемого рака предстательной железы у млекопитающих, включая млекопитающих, страдающих от доброкачественной гиперплазии предстательной железы, причем способ включает по меньшей мере однократное введение млекопитающему терапевтически эффективного количества пептида NTP, в частности, выделенного пептида, содержащего аминокислотную последовательность SEQ ID NO. 66 (lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu- Glu-lle-Lys-Arg-Cys-Leu). В других вариантах осуществления настоящее изобретение предлагает способ предупреждения или уменьшения прогрессирования рака предстательной железы у млекопитающих, которые относятся к группе риска развития клинически диагностируемого рака предстательной железы, причем способ включает введение млекопитающему терапевтически эффективного количества пептида NTP, в частности, выделенного пептида, содержащего аминокислотную последовательность SEQ ID NO. 66 (lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys- Leu-Glu-lle-Lys-Arg-Cys-Leu).

[0153] В некоторых вариантах осуществления выделенный пептид, содержащий аминокислотную последовательность SEQ ID NO. 66, вводят в комбинации по меньшей мере с одним активным агентом, выбранным из группы, состоящей из (1) ингибитора 5α-редуктазы и/или антиэстрогена, (2) ингибитора 5α-редуктазы и/или ингибитора ароматазы, (3) ингибитора 5α-редуктазы и/или ингибитора 17β-HSD, (4) ингибитора 5α-редуктазы, антиэстрогена и ингибитора ароматазы, (5) ингибитора 5α-редуктазы, антиэстрогена и ингибитора 17β-HSD, (6) ингибитора 5α-редуктазы, ингибитора ароматазы, антиэстрогена и ингибитора 17β-HSD, (7) ингибитора 5α-редуктазы, антиандрогена и антиэстрогена, (8) ингибитора 5α-редуктазы, антиандрогена и ингибитора ароматазы, (9) ингибитора 5α-редуктазы, антиандрогена и ингибитора 17β-HSD, (10) ингибитора 5α-редуктазы, антиандрогена, антиэстрогена и ингибитора ароматазы, (11) ингибитора 5α-редуктазы, антиандрогена, ингибитора ароматазы и ингибитора 17β-HSD, (12) ингибитора 5α-редуктазы, антиандрогена, ингибитора ароматазы, антиэстрогена и ингибитора 17β-HSD, (13) ингибитора 17β-HSD и антиэстрогена, (14) ингибитора 17β-HSD и ингибитора ароматазы, (15) ингибитора 17β-HSD, ингибитора ароматазы и антиэстрогена, (16) ингибитора 17β-HSD, антиандрогена и антиэстрогена, (17) ингибитора 17β-HSD, антиандрогена и ингибитора ароматазы, (18) ингибитора 17β-HSD, антиандрогена, антиэстрогена и ингибитора ароматазы, (19) антиэстрогена и ингибитора ароматазы и (20) антиэстрогена, ингибитора ароматазы и антиандрогена, (21) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы и антиэстрогена, (22) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы и ингибитора ароматазы, (23) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы и ингибитора 17β-HSD, (24) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиэстрогена и ингибитора ароматазы, (25) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиэстрогена и ингибитора 17β-HSD, (26) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, ингибитора ароматазы, антиэстрогена и ингибитора 17β-HSD, (27) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиандрогена и антиэстрогена, (28) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиандрогена и ингибитора ароматазы, (29) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиандрогена и ингибитора 17β-HSD, (30) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиандрогена, антиэстрогена и ингибитора ароматазы, (31) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиандрогена, ингибитора ароматазы и ингибитора 17β-HSD, (32) агониста или антагониста ЛГРГ, ингибитора 5α-редуктазы, антиандрогена, ингибитора ароматазы, антиэстрогена и ингибитора 17β-HSD, (33) агониста или антагониста ЛГРГ, ингибитора 17β-HSD и антиэстрогена, (34) агониста или антагониста ЛГРГ, ингибитора 17β-HSD и ингибитора ароматазы, (35) агониста или антагониста ЛГРГ, ингибитора 17β-HSD, ингибитора ароматазы и антиэстрогена, (36) агониста или антагониста ЛГРГ, ингибитора 17β-HSD, антиандрогена и антиэстрогена, (37) агониста или антагониста ЛГРГ, ингибитора 17β-HSD, антиандрогена и ингибитора ароматазы, (38) агониста или антагониста ЛГРГ, ингибитора 17β-HSD, антиандрогена, антиэстрогена и ингибитора ароматазы, (39) агониста или антагониста ЛГРГ, антиэстрогена и ингибитора ароматазы и (40) агониста или антагониста ЛГРГ, антиэстрогена, ингибитора ароматазы и антиандрогена.

[0154] Следующие примеры приведены для иллюстрации вариантов осуществления настоящего изобретения. Следует, однако, понимать, что варианты осуществления не должны ограничиваться определенными условиями или деталями, описанными в этих примерах. В тексте данной спецификации любые ссылки на общедоступные документы, включая патенты США, специально включены посредством ссылок. В частности, варианты осуществления явным образом включают посредством ссылки примеры, содержащиеся в рассматриваемой заявке на патент США № 14/808,713, поданной 24 июля 2015 г., под названием METHODS OF REDUCING THE NEED FOR SURGERY IN PATIENTS SUFFERING FROM BENIGN PROSTATIC HYPERPLASIA; в заявке на патент США № 14/606,683, поданной 27 января 2015 г., под названием: METHOD OF TREATING DISORDERS REQUIRING DESTRUCTION OR REMOVAL OF CELLS; в заявке на патент США № 14/738,551, поданной 12 июня 2015 г., под названием: COMBINATION COMPOSITIONS FOR TREATING DISORDERS REQUIRING REMOVAL OR DESTRUCTION OF UNWANTED CELLULAR PROLIFERATIONS, в публикации заявки на патент США № 2007/0237780 (в настоящее время аннулированная); № 2003/0054990 (в настоящее время патент США № 7,172,893); № 2003/0096350 (в настоящее время патент США № 6,924,266); № 2003/0096756 (в настоящее время патент США № 7,192,929); № 2003/0109437 (в настоящее время патент США № 7,241,738); № 2003/0166569 (в настоящее время патент США № 7,317,077); № 2005/0032704 (в настоящее время патент США № 7,408,021) и № 2015/0148303 (в настоящее время патент США № 9,243,035), каждая из которых раскрывает, что указанные там определенные пептиды являются эффективными агентами для уничтожения in vivo клеток мышечной ткани, подкожной соединительной ткани, дермы и других тканей у здоровых грызунов.

Пример 1

[0155] В серии клинических исследований, проведенных в период с 2009 по 2016 гг., всего 628 мужчин с доброкачественной гиперплазией предстательной железы получили 2,5 мг SEQ ID NO. 66 (lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu-Glu-lle-Lys-Arg-Cys- Leu) путем внутрипредстательной инъекции в переходную зону предстательной железы для лечения симптомов доброкачественной гиперплазии предстательной железы, и впоследствии за ними осуществляли клиническое наблюдение и наблюдение с помощью лабораторных тестов. По прошествии периода времени до 6,5 лет после инъекции все доступные пациенты обследовались у уролога в специализированных клиниках на предмет симптомов доброкачественной гиперплазии предстательной железы, случаев прогрессирования заболевания и с целью проведения оценки безопасности. Были задокументированы все случаи рака предстательной железы, диагностируемого клинически или с помощью биопсии. Частоту новых случаев рака предстательной железы, подтвержденных с помощью биопсии или хирургическим путем, через 12 месяцев и в целом сравнивали с частотой случаев диагностированного рака предстательной железы в масштабных долгосрочных клинических исследованиях, описанных в медицинской литературе. Несмотря на то что а) терапия была направлена на доброкачественную гиперплазию предстательной железы; б) инъекции выполнялись в центральную часть предстательной железы, где раковые заболевания встречаются реже; и в) инъекции проводились только однократно или дважды для SEQ ID NO. 66, частота случаев рака предстательной железы по сравнению с известной прогнозируемой частотой случаев 2-25% была неожиданно ниже для этих пациентов и составила 0-1,3%. Результаты приводятся ниже в таблице 1.

Таблица 1

Лечение Количество пациентов Частота случаев раковых заболеваний
SEQ ID NO: 661 628 0,8%
Контроль2 > 20%

1. Исключая пациентов, у которых был выявлен рак предстательной железы в течение первых 12 месяцев исследования. Частота случаев клинически диагностируемого рака с момента включения пациентов, у которых был выявлен рак предстательной железы в течение первых 12 месяцев исследования, составила 1,3%;

2. Результаты долгосрочного исследования для популяции с доброкачественной гиперплазией предстательной железы, описанные в опубликованных исследованиях. (Thompson, IM, et al., The Influence of Finasteride on the Development of Prostate Cancer, N Engl J Med, Vol.349, pp. 215-224 (2003); Andriole GL, et al., Effect of Dutasteride on the Risk of Prostate Cancer, N Engl J Med, Vol. 362, pp. 1192-1202 (2010)).

[0156] Исходя из результатов этих исследований, ожидается, что введение пептидов NTP из настоящего изобретения пациентам, нуждающимся в лечении рака предстательной железы или склонным к его развитию, и/или введение в зоны предстательной железы, в которых раковые заболевания встречаются наиболее часто, будет иметь даже более выраженный эффект с точки зрения предупреждения частоты возникновения рака предстательной железы, а также предупреждения или уменьшения прогрессирования рака предстательной железы у пациентов, склонных к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы. Таким образом, заявленные композиции являются полезными для лечения популяции пациентов, отличной от тех, которые страдают от доброкачественной гиперплазии предстательной железы, композиции также являются полезными для предупреждения частоты возникновения рака предстательной железы и предупреждения или уменьшения прогрессирования рака предстательной железы у пациентов, склонных к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы для данной популяции.

Пример 2

[0157] В серии клинических исследований, проведенных в период с 2009 по 2016 гг., всего 816 мужчин с доброкачественной гиперплазией предстательной железы получили 2,5 мг (n=628) SEQ ID NO. 66 (lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu-Glu-lle-Lys-Arg-Cys- Leu) или только носитель в стерильном физиологическом растворе (n=188) путем внутрипредстательной инъекции в переходную зону предстательной железы для лечения симптомов доброкачественной гиперплазии предстательной железы, и впоследствии за ними осуществляли клиническое наблюдение и наблюдение с помощью лабораторных тестов. По прошествии периода времени до 6,5 лет после инъекции все доступные пациенты обследовались у уролога в специализированных клиниках на предмет симптомов доброкачественной гиперплазии предстательной железы, случаев прогрессирования заболевания и с целью проведения оценки безопасности. Были задокументированы все случаи рака предстательной железы, диагностируемого клинически или с помощью биопсии. Частоту новых случаев рака предстательной железы, подтвержденных с помощью биопсии или хирургическим путем, через 12 месяцев и в целом сравнивали с частотой случаев диагностированного рака предстательной железы у пациентов, получавших стерильный физиологический раствор (контроль). Несмотря на то что а) терапия была направлена на доброкачественную гиперплазию предстательной железы; б) инъекции выполнялись в центральную часть предстательной железы, где раковые заболевания встречаются реже; и в) инъекции проводились только однократно или дважды для SEQ ID NO. 66, частота случаев рака предстательной железы у субъектов, получавших лечение в соответствии с настоящим изобретением, была неожиданно значительно ниже, чем этот показатель в контрольной популяции. Результаты проиллюстрированы ниже в таблице 2.

Таблица 2

Лечение Количество пациентов Частота случаев раковых заболеваний1
SEQ ID NO: 662 628 0,8%*
Контроль1 188 2,7%

1. Исключая пациентов, у которых был выявлен рак предстательной железы в течение первых 12 месяцев исследования.

2. Частота случаев клинически диагностируемого рака с момента включения пациентов, у которых был выявлен рак предстательной железы в течение первых 12 месяцев исследования, составила 1,3%;

* р < 0,05

[0158] Исходя из результатов этих исследований, ожидается, что введение пептидов NTP из настоящего изобретения пациентам, нуждающимся в лечении рака предстательной железы или склонным к его развитию, и/или введение в зоны предстательной железы, в которых раковые заболевания встречаются наиболее часто, будет иметь даже более выраженный эффект с точки зрения предупреждения частоты возникновения рака предстательной железы, а также предупреждения или уменьшения прогрессирования рака предстательной железы у пациентов, склонных к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы. Таким образом, заявленные композиции являются полезными для лечения популяции пациентов, отличной от тех, которые страдают от доброкачественной гиперплазии предстательной железы, композиции также являются полезными для предупреждения частоты возникновения рака предстательной железы и предупреждения или уменьшения прогрессирования рака предстательной железы у пациентов, склонных к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы для данной популяции.

Пример 3

[0159] В серии клинических исследований, проведенных в период с 2009 по 2016 гг., всего 628 мужчин с доброкачественной гиперплазией предстательной железы получили 2,5 мг SEQ ID NO. 66 (lle-Asp-GIn-GIn-Val-Leu-Ser-Arg-lle-Lys-Leu-Glu-lle-Lys-Arg-Cys- Leu) путем внутрипредстательной инъекции в переходную зону предстательной железы для лечения симптомов доброкачественной гиперплазии предстательной железы, и впоследствии за ними осуществляли клиническое наблюдение и наблюдение с помощью лабораторных тестов. По прошествии периода времени до 6,5 лет после инъекции все доступные пациенты обследовались у уролога в специализированных клиниках на предмет симптомов доброкачественной гиперплазии предстательной железы, случаев прогрессирования заболевания и с целью проведения оценки безопасности. Были задокументированы все случаи рака предстательной железы, диагностируемого клинически или с помощью биопсии. Частоту новых случаев рака предстательной железы, подтвержденных с помощью биопсии или хирургическим путем, с показателем по шкале Глисона >= 7 сравнивали с частотой случаев диагностированного рака предстательной железы в масштабных долгосрочных клинических исследованиях, описанных в медицинской литературе. Несмотря на то что а) терапия была направлена на доброкачественную гиперплазию предстательной железы; б) инъекции выполнялись в центральную часть предстательной железы, где раковые заболевания встречаются реже; и в) инъекции проводились только однократно или дважды для SEQ ID NO. 66, частота случаев рака предстательной железы по сравнению с известной прогнозируемой частотой случаев 5-6% была неожиданно ниже для этих пациентов и составила 0,3%. Результаты приводятся ниже в таблице 3.

Таблица 3

Лечение Количество пациентов Частота случаев раковых заболеваний (показатель по шкале Глисона >= 7)
SEQ ID NO: 66 628 < 0,3%
Контроль1 5-6%

1. Результаты долгосрочного исследования для популяции с доброкачественной гиперплазией предстательной железы, описанные в опубликованных исследованиях. (Thompson, IM, et al., The Influence of Finasteride on the Development of Prostate Cancer, N Engl J Med, Vol.349, pp. 215-224 (2003); Andriole GL, et al., Effect of Dutasteride on the Risk of Prostate Cancer, N Engl J Med, Vol. 362, pp. 1192-1202 (2010)).

[0160] Исходя из результатов этих исследований, ожидается, что введение пептидов NTP из настоящего изобретения пациентам, нуждающимся в лечении рака предстательной железы или склонным к его развитию, и/или введение в зоны предстательной железы, в которых раковые заболевания встречаются наиболее часто, будет иметь даже более выраженный эффект с точки зрения предупреждения частоты возникновения рака предстательной железы, а также предупреждения или уменьшения прогрессирования рака предстательной железы у пациентов, склонных к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы. Таким образом, заявленные композиции являются полезными для лечения популяции пациентов, отличной от тех, которые страдают от доброкачественной гиперплазии предстательной железы, композиции также являются полезными для предупреждения частоты возникновения рака предстательной железы и предупреждения или уменьшения прогрессирования рака предстательной железы у пациентов, склонных к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы для данной популяции.

[0161] Результаты представленных выше примеров демонстрируют неожиданно превосходящий эффект пептидов NTP для снижения частоты случаев клинически диагностируемого рака предстательной железы и предупреждения или уменьшения прогрессирования рака предстательной железы у пациентов, склонных к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы. Специалистам в данной области техники будет очевидно, что могут быть выполнены различные модификации и изменения в способах и композициях настоящих вариантов осуществления без отступления от сущности и объема настоящего изобретения.

1. Способ снижения возникновения рака простаты у млекопитающего, склонного к развитию рака простаты, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы, включающий введение млекопитающему, склонному к развитию рака простаты, терапевтически эффективного количества выделенного пептида, состоящего из аминокислотной последовательности SEQ ID NO. 66 (Ile-Asp-Gln-Gln-Val-Leu-Ser-Arg-Ile-Lys-Leu-Glu-Ile-Lys-Arg-Cys-Leu), где, пептид вводят в центральную часть простаты, в которой рак является менее распространенным, где способ снижает возникновение рака простаты более чем на около 15% по сравнению с млекопитающими, получающими плацебо.

2. Способ по п. 1, где способ включает введение терапевтически эффективного количества пептида согласно п. 1 и носителя.

3. Способ по п. 1, где способ включает введение терапевтически эффективного количества пептида согласно п. 1 и по меньшей мере от одной до 25 дополнительных аминокислот, фланкирующих N-конец или С-конец выделенного пептида, указанного в п. 1.

4. Способ по п. 1, отличающийся тем, что способ обеспечивает снижение возникновения рака предстательной железы в диапазоне от около 0% до около 5%.

5. Способ по п. 4, отличающийся тем, что способ обеспечивает снижение возникновения рака предстательной железы в диапазоне от около 0% до около 2%.

6. Способ по п. 4, отличающийся тем, что способ обеспечивает снижение возникновения рака предстательной железы в диапазоне от около 0% до около 1,3%.

7. Способ уменьшения прогрессирования рака предстательной железы у млекопитающего, склонного к его развитию, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы, при этом способ включает введение млекопитающему терапевтически эффективного количества выделенного пептида, состоящего из аминокислотной последовательности SEQ ID NO. 66 (Ile-Asp-Gln-Gln-Val-Leu-Ser-Arg-Ile-Lys-Leu-Glu-Ile-Lys-Arg-Cys-Leu), где, пептид вводят в центральную часть простаты, в которой рак является менее распространенным, где способ уменьшает прогрессирование рака предстательной железы до показателя, который находится в диапазоне от около 0% до менее чем около 5%.

8. Способ по п. 7, где способ включает введение терапевтически эффективного количества пептида согласно п. 7 и носителя.

9. Способ по п. 7, где способ включает введение терапевтически эффективного количества пептида согласно п.7 и по меньшей мере от одной до 25 дополнительных аминокислот, фланкирующих N-конец или С-конец выделенного пептида, указанного в п. 7.

10. Способ по п. 7, отличающийся тем, что способ уменьшает прогрессирование рака предстательной железы до показателя, который находится в диапазоне от около 0% до около 1%.

11. Способ по п. 7, отличающийся тем, что способ уменьшает прогрессирование рака предстательной железы до показателя около 0%.

12. Способ по п. 7, отличающийся тем, что млекопитающее, склонное к развитию рака предстательной железы, имеет на исходном уровне показатель ПСА (простат-специфический антиген) ≥2,5.

13. Способ по п.1, где выделенный пептид водят более одного раза.

14. Способ по п.7, где выделенный пептид водят более одного раза.



 

Похожие патенты:

Настоящее изобретение относится к области биотехнологии, конкретно к иммуногенным пептидам, и может быть использовано для понижения или блокирования иммунного ответа к антигену, входящему в состав иммуногенного пептида.

Изобретение относится к полипептидам, которые ковалентно связаны с молекулярными каркасами, так что две или более пептидные петли замыкаются между точками присоединения к каркасу.

Изобретение относится к использованию пептидов, содержащих аминокислотную последовательность KFARLWTEIPTAIT (SEQ ID NO: 1), FTEIPTI (SEQ ID NO: 3), для ингибирования ангиогенеза и лечения нарушений, связанных с ФРЭС-индуцированной сосудистой проницаемостью, где пациент страдает нарушением зрения или потерей зрения (слепотой), дегенерацией макулы, окклюзией центральной вены сетчатки, окклюзией ветви вены сетчатки, пролиферативной диабетической ретинопатией, неоваскулярной возрастной дегенерацией макулы (ВДМ), ретинопатией недоношенных, ишемической ретинопатией, внутриглазной неоваскуляризацией, неоваскуляризацией роговицы, неоваскуляризацией сетчатки, неоваскуляризацией хориоидеи, диабетическим отеком макулы, диабетической ишемией сетчатки, диабетическим отеком сетчатки и пролиферативной диабетической ретинопатией, рубеозом радужным оболочки, неоваскулярной глаукомой, ретинобластомой, увеитом и неоваскуляризацией трансплантата роговицы.

Изобретение относится к лиофилизированным составам активных средств, в частности, TAT-NR2B9c, в виде хлоридной соли, в которой более 99% анионов в соли представляют собой хлорид.

Согласно некоторым аспектам в настоящем изобретении предложены клеточно-реактивные аналоги компстатина и композиции, содержащие клеточно-реактивные аналоги компстатина.Аналог компстатина длительного действия содержит снижающий клиренс фрагмент, присоединенный к двум фрагментам аналога компстатина, причем каждый фрагмент аналога компстатина содержит циклический пептид, удлиненный остатком лизина или последовательностью, содержащей остаток лизина на N-конце, С-конце или на обоих концах, причем указанный остаток лизина отделен от циклической части указанного пептида жестким или гибким спейсером, содержащим фрагмент олиго(этиленгликоля), и при этом указанный циклический пептид содержит аминокислотную последовательность, представленную в любой из SEQ ID NOs: 3-36, 71, 72, 73 или 74; указанный снижающий клиренс фрагмент содержит линейный полимер, причем указанный линейный полимер представляет собой полиэтиленгликоль (ПЭГ) со средней молекулярной массой от примерно 30 кДа до примерно 40 кДа, причем каждый конец указанного линейного полимера связан с одним из фрагментов аналога компстатина карбаматом, причем (i) указанный спейсер содержит -(CH2)m- и -(O-CH2-CH2-)n, соединенные ковалентно, где m составляет от 1 до 10, и n составляет от 1 и 10; и/или(ii) указанный спейсер содержит 8-амино-3,6-диоксаоктановую кислоту (AEEAc) или 11-амино-3,6,9- триоксаундекановую кислоту.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая линкерное звено, содержащее центральную сердцевину, связывающие ветви и, необязательно, соединяющую ветвь (варианты).

Изобретение относится к области биотехнологии, конкретно к иммуногенным эпитопам URLC10, и может быть использовано в медицине для лечения пациента, страдающего раком.

Изобретение относится к области фармакологии. Предложены новые аналоги апелина и их терапевтическое применение.

Изобретение относится к области биотехнологии, конкретно к способу получения конъюгатов терапевтического соединения с пролонгированным периодом полувыведения, и может быть использовано в медицине.

Изобретение относится к пептидам, которые могут эффективно и специфически реактивировать мутантные белки р53. В частности, предлагаются пептиды, реактивирующие мутантный белок р53, которые могут восстанавливать нативное складывание белка р53 дикого типа и, следовательно, активность супрессоров опухоли по отношению к мутантному белку р53.

Группа изобретений относится к медицине и касается пероральной композиции для лечения рака, содержащей металл, связанный с по меньшей мере одним опухолевым антигеном и по меньшей мере одним аллоантигеном или их фрагментами, где указанный металл представляет собой магний, кальций или стронций или их комбинацию и где указанный аллоантиген выбран из альбумина, сывороток, смешанных из периферической крови здоровых людей, или сывороток, смешанных из периферической крови пациентов с диагностированным рассматриваемым раком.

Изобретение относится к новому соединению - 1-((3S,4R)-4-(3-фторфенил)-1-(2-метоксиэтил)пирролидин-3-ил)-3-(4-метил-3-(2-метилпиримидин-5-ил)-1-фенил-1Н-пиразол-5-ил)мочевине формулы I или ее дигидрохлоридной соли.

Группа изобретений относится к медицине и касается способа лечения или замедления прогрессирования неплоскоклеточного немелкоклеточного рака легкого (НМРЛ) у индивидуума, включающего введение индивидууму эффективного количества антагониста, связывающегося с компонентом сигнального пути PD-1, таксана и химиотерапевтического агента на основе платины, причем таксан представляет собой наб-паклитаксел или паклитаксел.

Изобретение относится к новому соединению, представленному общей формулой (I), и его фармацевтически приемлемой соли. Соединения обладают ингибирующей активностью в отношении Brk и могут быть использованы в качестве средства для предотвращения и/или лечения рака, опосредованного Brk активностью.

Изобретение относится к фармацевтической композиции для профилактики и/или лечения вирусных заболеваний, включающей соединение формулы 11 в эффективном количестве или его фармацевтически приемлемую соль.

Изобретение относится к соединению формулы (I) или его фармацевтически приемлемой соли. В формуле (I) R1 выбран из группы, состоящей из , , , , , и ,R2 представляет собой H, R3 представляет собой H.

Изобретение относится к конкретным соединениям, указанным в п.1 формулы изобретения, а также к соединению, имеющему общую формулу, приведенную ниже, где R4 выбран из водорода, галогена и C1-C6 алкила; и Y представляет собой группу, имеющую формулу, приведенную ниже, где L отсутствует, каждый R313 независимо выбран из H, галогена и C1-C6 алкила и R'' выбран из H и C1-C6 алкила или к их фармацевтически приемлемым солям.

Настоящее изобретение относится к индазольному соединению, а именно к соединению формулы I или его фармацевтически приемлемой соли I. В формуле I: L выбран из группы, состоящей из: H, тетрагидропиранила (ТГП); каждый X независимо выбран из группы, состоящей из: Cl, F и H; каждый из W и Z независимо выбран из: N или CH; Y представляет собой CH; кольцо А отсутствует или представляет собой незамещенную или замещенную 6-8-членную ариленовую группу, или незамещенную или замещенную 5-8-членную гетероариленовую группу, при этом указанная гетероариленовая группа содержит по меньшей мере один гетероатом, представляющий собой азот; или , R представляет собой Н или замещенную или незамещенную группу, выбранную из группы, состоящей из: где М представляет собой незамещенный C1-C6-алкилен или М отсутствует.

Изобретение относится к новому соединению формулы (I), его фармацевтически приемлемой соли или стереоизомеру. Соединения обладают свойствами ингибирования активности орфанного рецептора, связанного с рецептором ретиноевой кислоты (ROR), и могут быть использованы в терапии для лечения воспалительных, метаболических и аутоиммунных заболеваний.

Группа изобретений относится к области фармации, в частности к композиции для присоединения радиоизотопа к полипептиду с ковалентно присоединенным хелатором и к способу присоединения радиоизотопа к полипептиду с ковалентно присоединенным хелатором.

Изобретение относится к области биохимии и может быть использовано в медицине. Новый антимикробный пептид лексицин-1 сконструирован на основе специфических паттернов, найденных в аминокислотных последовательностях природных антимикробных пептидов.

Изобретение относится к способу снижения возникновения или уменьшения прогрессирования рака простаты у млекопитающего, склонного к развитию рака простаты, что установлено с помощью одного или более методов скрининга для выявления рака предстательной железы, включающий введение млекопитающему, склонному к развитию рака простаты, терапевтически эффективного количества выделенного пептида, состоящего из аминокислотной последовательности SEQ ID NO. 66, где пептид вводят в центральную часть простаты, в которой рак является менее распространенным, где способ снижает возникновение рака простаты более чем на около 15 по сравнению с млекопитающими, получающими плацебо, или уменьшает прогрессирование рака предстательной железы до показателя, который находится в диапазоне от около 0 до менее чем около 5. 2 н. и 12 з.п. ф-лы, 6 табл., 3 пр.

Наверх