Антитела против триптазы, их композиции и применения



Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
Антитела против триптазы, их композиции и применения
C07K2317/24 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2771485:

ДЖЕНЕНТЕК, ИНК. (US)

Изобретение относится к области биотехнологии. Предложены антитела, которые связываются с триптазой бета 1 человека, и включающие их фармацевтические композиции. Также предложены нуклеиновые кислоты, экспрессионные векторы и клетки-хозяева, предназначенные для получения указанных антител. Изобретение обеспечивает связывание с триптазой бета 1 человека с высокой аффинностью и ингибирование активности триптазы in vivo. 17 н. и 55 з.п. ф-лы, 32 ил., 17 табл., 6 пр.

 

Перекрестная ссылка на родственные заявки

Данная заявка заявляет приоритет по предварительной заявке США №62/457722, поданной 10 февраля 2017 года, содержание которой в полном объеме включено в данный документ посредством ссылки.

Перечень последовательностей

Данная заявка содержит Перечень последовательностей, представленный в электронном виде в формате ASCII и в полном объеме включенный в данный документ посредством ссылки. Указанная копия ASCII, созданная 9 февраля 2018 года, называется 50474-112WO2_Sequence_Listing_2. 9. 18_ST25 и имеет размер 108967 байт.

Область техники

Данное изобретение относится к антителам против триптазы, фармацевтическим композициям и способам их применения.

Уровень техники

Триптаза бета человека представляет собой трипсиноподобную сериновую протеазу, которая широко распространена в тучных клетках и, в меньшей степени, в базофилах. Триптаза бета человека (три подтипа которой существует: триптаза бета 1, триптаза бета 2 и триптаза бета 3), продуцируемая локусами TPSAB1 и TPSB2, является преобладающей активной триптазой, продуцируемой тучными клетками человека. Эти два локуса продуцируют четыре изоформы триптазы; TPSAB1 продуцирует триптазу альфа и триптазу бета 1, тогда как TPSB2 продуцирует триптазу бета 2 и триптазу бета 3. Триптаза альфа, а также другие изоформы, такие как триптаза гамма, триптаза дельта и триптаза эпсилон, являются в основном неактивными.

Протеолитически обработанная активная триптаза бета хранится в секреторных гранулах тучных клеток в виде тетрамера в комплексе с гепарином. Дегрануляция тучных клеток, которая может быть вызвана IgE-зависимыми стимулами (например, аллергенами) или не-IgE-зависимыми стимулами (например, веществом Р или активной триптазой), приводит к высвобождению триптазы бета наряду с другими гранулярными ферментами и гистамином. В предыдущих исследованиях наблюдали увеличение числа тучных клеток в гладкой мускулатуре и эпителии бронхов у пациентов с астмой, а также повышение уровня триптазы бета в жидкости бронхоальвеолярного лаважа. Кроме того, триптаза способствует бронхоконстрикции дыхательных путей и гиперреактивности, а также было сделано предположение о роли триптазы в развитии фиброза и метаболизме внеклеточного матрикса, которые являются отличительными признаками процесса ремоделирования дыхательных путей.

Предполагается, что триптаза вовлечена в патогенез различных заболеваний и нарушений, включая астму и другие легочные, воспалительные, аутоиммунные и фиброзные нарушения, относительно которых остается потребность в разработке улучшенных терапевтических средств, включая терапевтические антагонисты против триптазы, и новых способов лечения. Предпринимались попытки разработать низкомолекулярные ингибиторы триптазы (см., например, Cairns, J.А., 2005, Pulmonary Pharmacology & Therapeutics 18: 55-66); однако, насколько нам известно, о биологических терапевтических средствах, явлющихся антагонистами триптазы, особенно об антагонистических антителах против триптазы, не сообщалось.

Сущность изобретения

Данное изобретение относится к антителам против триптазы, их фармацевтическим композициям, а также способам их применения.

В одном аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой бета 1 человека, или его антигенсвязывающему фрагменту, при этом указанное антитело содержит следующие шесть гипервариабельных областей (HVR): (a) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащую аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащую аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6). В некоторых вариантах осуществления данного изобретения указанное антитело определяется шестью HVR, содержащими аминокислотные последовательности SEQ ID NO: 7, 2, 8, 4, 5 и 6. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит S43, Р46 и W47 в каркасной области L2 вариабельного домена (VL) легкой цепи (FR-L2) (нумерация по Кабату). В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) вариабельный домен (VH) тяжелой цепи, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 9; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности с аминокислотной последовательностью SEQ ID NO: 10; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие каркасные области (FR) домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 11); (b) FR-H2, содержащую аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 12); (с) FR-H3, содержащую аминокислотную последовательность RFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 13); и (d) FR-H4, содержащую аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 14). В некоторых вариантах осуществления данного изобретения домен VH содержит аминокислотную последовательность SEQ ID NO: 9. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 15); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGKSPKPWIY (SEQ ID NO: 16); (с) FR-L3, содержащую аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 17); и (d) FR-L4, содержащую аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 18). В некоторых вариантах осуществления данного изобретения домен VL содержит аминокислотную последовательность SEQ ID NO: 10. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 76, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 77. В других вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 78), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 79.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой бета 1 человека, или его антигенсвязывающему фрагменту, при этом указанное антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 9, и (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 10. В некоторых вариантах осуществления данного изобретения the указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 9, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 76, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 77. В других вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 78), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 79.

В другом аспекте данное изобретение относится к выделенному антителу, содержащему (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 76, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 77.

В другом аспекте данное изобретение относится к выделенному антителу, содержащему (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 78), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 79.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой бета 1 человека, или его антигенсвязывающему фрагменту, при этом указанное антитело содержит следующие шесть HVR: (а) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность RDNYDWYFDV (SEQ ID NO: 29); (d) HVR-L1, содержащую аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащую аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVKLVESGGGSVQPGGSRKLSCAASGFTFS (SEQ ID NO: 21); (b) FR-H2, содержащую аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 22); (с) FR-H3, содержащую аминокислотную последовательность RFTISRDNPKNTLFLQMSSLRSEDTAMYYCAR (SEQ ID NO: 23); и (d) FR-H4, содержащую аминокислотную последовательность WGTGTTVTVSS (SEQ ID NO: 24). В некоторых вариантах осуществления данного изобретения домен VH содержит аминокислотную последовательность SEQ ID NO: 19. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность QIVLTQSPAIMSASPGEKVTISC (SEQ ID NO: 25); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGSSPKPWIY (SEQ ID NO: 26); (с) FR-L3, содержащую аминокислотную последовательность GVPARFSGSGSGTSYSLTISSMEAEDAATYYC (SEQ ID NO: 27); и (d) FR-L4, содержащую аминокислотную последовательность FGAGTKLELK (SEQ ID NO: 28). В некоторых вариантах осуществления данного изобретения домен VL содержит аминокислотную последовательность SEQ ID NO: 20.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой бета 1 человека, или его антигенсвязывающему фрагменту, при этом указанное антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 19; (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 20; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVKLVESGGGSVQPGGSRKLSCAASGFTFS (SEQ ID NO: 21); (b) FR-H2, содержащую аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 22); (с) FR-H3, содержащую аминокислотную последовательность RFTISRDNPKNTLFLQMSSLRSEDTAMYYCAR (SEQ ID NO: 23); и (d) FR-H4, содержащую аминокислотную последовательность WGTGTTVTVSS (SEQ ID NO: 24). В некоторых вариантах осуществления данного изобретения домен VH содержит аминокислотную последовательность SEQ ID NO: 19. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность QIVLTQSPAIMSASPGEKVTISC (SEQ ID NO: 25); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGSSPKPWIY (SEQ ID NO: 26); (с) FR-L3, содержащую аминокислотную последовательность GVPARFSGSGSGTSYSLTISSMEAEDAATYYC (SEQ ID NO: 27); и (d) FR-L4, содержащую аминокислотную последовательность FGAGTKLELK (SEQ ID NO: 28). В некоторых вариантах осуществления данного изобретения домен VL содержит аминокислотную последовательность SEQ ID NO: 20.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой бета 1 человека, или его антигенсвязывающему фрагменту, содержащему (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 19 и (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 20.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело связывается с эпитопом триптазы бета 1 человека, содержащим по меньшей мере один, по меньшей мере два, по меньшей мере три или все четыре остатка, выбранных из группы, состоящей из His51, Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два, по меньшей мере три или все четыре остатка, выбранных из группы, состоящей из His51, Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим His51 и по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать или все двенадцать аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит His51, Gln67, Val80, Lys81, Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать как малую поверхность контакта тетрамерной триптазы бета 1 человека, так и большую поверхность контакта тетрамерной триптазы бета 1 человека.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой бета 1 человека, или его антигенсвязывающему фрагменту, при этом указанное антитело содержит следующие шесть HVR: (а) HVR-H1, содержащую аминокислотную последовательность GYAIT (SEQ ID NO: 30); (b) HVR-H2, содержащую аминокислотную последовательность GISSAATTFYSSWAKS (SEQ ID NO: 31); (с) HVR-H3, содержащую аминокислотную последовательность DPRGYGAALDRLDL (SEQ ID NO: 32); (d) HVR-L1, содержащую аминокислотную последовательность QSIKSVYNNRLG (SEQ ID NO: 33); (е) HVR-L2, содержащую аминокислотную последовательность ETSILTS (SEQ ID NO: 34); и (f) HVR-L3, содержащую аминокислотную последовательность AGGFDRSGDTT (SEQ ID NO: 35). В некоторых вариантах осуществления данного изобретения указанное антитело определяется шестью HVR, содержащими аминокислотную последовательность SEQ ID NO: 30, 31, 32, 33, 34 и 35. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит Arg71 и Val78 в FR-H3 домена VH (нумерация по Кабату). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) FR-H2, содержащую аминокислотную последовательность WIRQPPGKGLEWIG (SEQ ID NO: 42); (с) FR-H3, содержащую аминокислотную последовательность RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); и (d) FR-H4, содержащую аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 41). В некоторых вариантах осуществления данного изобретения домен VH содержит аминокислотную последовательность SEQ ID NO: 36. В некоторых вариантах осуществления данного изобретения указанное антитело содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 65); (с) FR-L3, содержащую аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); и (d) FR-L4, содержащую аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 63). В некоторых вариантах осуществления данного изобретения домен VL содержит аминокислотную последовательность SEQ ID NO: 37. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81. В других вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой бета 1 человека или его антигенсвязывающим фрагментом, при этом указанное антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью любой из SEQ ID NO: 36, 47, 48, 49, 50, 51 и 52; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью любой из SEQ ID NO: 37, 53, 58 или 59; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) FR-H2, содержащую аминокислотную последовательность WIRQPPGKGLEWIG (SEQ ID NO: 42); (с) FR-H3, содержащую аминокислотную последовательность RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); и (d) FR-H4, содержащую аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 41). В некоторых вариантах осуществления данного изобретения домен VH содержит аминокислотную последовательность SEQ ID NO: 36. В некоторых вариантах осуществления данного изобретения указанное антитело содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 65); (с) FR-L3, содержащую аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); и (d) FR-L4, содержащую аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 63). В некоторых вариантах осуществления данного изобретения домен VL содержит аминокислотную последовательность SEQ ID NO: 37. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81. В других вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой человека, или его антигенсвязывающему фрагменту, при этом указанное антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 36 и (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 37. В некоторых вариантах осуществления данного изобретения указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 36, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81. В других вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83.

В другом аспекте данное изобретение относится к выделенному антителу, содержащему (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81.

В другом аспекте данное изобретение относится к выделенному антителу, содержащему (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83.

В другом аспекте данное изобретение относится к выделенному антителу, которое связывается с триптазой человека, или его антигенсвязывающему фрагменту, при этом указанное антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 52, и (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 53.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Gln100, Leu101 и Leu102 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать, по меньшей мере двенадцать, по меньшей мере тринадцать или все четырнадцать аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп содержит Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101, Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к тетрамеру триптазы бета 1 человека и указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или оба из Gln35 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать малую поверхность контакта и/или большую поверхность контакта триптазы бета 1 человека.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело дополнительно связывает триптазу яванского макака (супо). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно связывает триптазу альфа человека. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно связывает триптазу бета 2 человека или триптазу бета 3 человека. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу бета 2 человека и триптазу бета 3 человека.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело связывает триптазу со значением KD, составляющим около 1 нМ или менее. В некоторых вариантах осуществления данного изобретения значение KD измеряют методом поверхностного плазмонного резонанса (SPR). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим от около 120 пм до около 0,5 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим от около 120 пм до около 300 пМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим от около 120 пм до около 200 пМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим около 180 пМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим около 400 пМ. В некоторых вариантах осуществления данного изобретения анализ SPR проводят при 25°С. В некоторых вариантах осуществления данного изобретения значение KD is измеряют с помощью анализа BIACORE®, например, как описано в Примере 1, Раздел (A) (vii). В некоторых вариантах осуществления данного изобретения для анализа SPR можно применять BIAcore® Т200 или эквивалентное устройство. В некоторых вариантах осуществления данного изобретения сенсорные чипы BIAcore® серии S СМ5 (или эквивалентные сенсорные чипы) иммобилизируют моноклональным мышиным антителом против IgG (Fc) человека, и антитела против триптазы впоследствии захватываются в проточной ячейке. Последовательные 3-кратные разведения His-меченого мономера триптазы бета 1 человека (SEQ ID NO: 128) вводят при скорости потока 30 мкл/мин. Каждый образец анализируют с 3-минутной ассоциацией и 10-минутной диссоциацией. Анализ проводили при 25°С. После каждого введения чип регенерировали с применением 3 М MgCl2. Ответ связывания корректируют путем вычитания единиц ответа (RU) из проточной ячейки, захватывающей нерелевантный IgG с аналогичной плотностью. Для анализа кинетики применяли модель Ленгмюра 1: 1 одновременной подгонки kon и koff.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело способно ингибировать ферментативную активность триптазы бета 1 человека. В некоторых вариантах осуществления указанное антитело ингибирует активность триптазы со значением IC50, составляющим около 2,5 нМ или ниже, что определяется с помощью ферментативного анализа триптазы бета человека с применением синтетического пептида S-2288 в качестве субстрата. В некоторых вариантах осуществления данного изобретения указанное антитело ингибирует активность триптазы со значением IC50, составляющим от около 550 пМ до около 2,5 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело ингибирует активность триптазы со значением IC50, составляющим от около 500 пМ до около 2 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело ингибирует активность триптазы со значением IC50, составляющим от около 550 пМ до 1,5 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело ингибирует активность триптазы со значением IC50, составляющим от около 500 пМ до около 700 пМ. В некоторых вариантах осуществления данного изобретения ингибирующую активность антитела определяют, как описано в Примере 1 (A)(viii)(a)). В некоторых вариантах осуществления данного изобретения конечная концентрация гепарина в ферментативном анализе триптазы бета человека с применением синтетического пептида S-2288 составляет 66 мкг/мл. В некоторых вариантах осуществления данного изобретения активный фермент рекомбинантного тетрамера триптазы бета 1 человека разводят до 0,75 нМ в буфере TNH (200 мМ Трис, 150 мМ NaCl, 0,1 мг/мл гепарина, 0,01% TRITON™ X-100, рН 8,0) и объединяют в соотношении 1: 1 с антителами против триптазы (разведенными в PBS) на 384-луночных планшетах. Планшеты инкубируют в течение 1 ч при температуре окружающей среды при осторожном перемешивании. Колориметрический субстрат S-2288 (Chromogenix, Part No. 82-0852-39) или эквивалентный субстрат разбавляют до 1200 мкМ в буфере TNH и добавляют на планшет. В некоторых вариантах осуществления данного изобретения конечные концентрации в лунках составляют 400 мкМ S-2288, 0,25 нМ рекомбинантного тетрамера триптазы бета 1 человека, 66 мкг/мл гепарина и от 0,10 до 222 нМ антитела против триптазы. Планшеты инкубируют в течение 40 мин при температуре окружающей среды с осторожным перемешиванием, а затем считывают при А405. Значение IC50 антител против триптазы определяют по четырехпараметрическому соответствию их соответствующих кривых.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело способно ингибировать ферментативную активность триптазы бета 1 человека при рН 6. В частности, ингибирующая активность антитела может быть определена при рН 6.

В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать опосредованную триптазой стимуляцию пролиферации и/или коллаген-зависимое сокращение клеток гладких мышц бронхов. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать высвобождение гистамина из тучных клеток. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать высвобождение гистамина, запускаемое посредством IgE, и/или высвобождение гистамина, запускаемое триптазой. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать триптазу D1 яванского макака, что оценивали с помощью ИФА для определения активной триптазы. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы в образцах бронхоальвеолярного лаважа (BAL) или в назосорбционных образцах яванского макака. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета 1 человека. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета 1 человека в моновалентном формате. В некоторых вариантах осуществления данного изобретения указанный моновалентный формат представляет собой Fab формат. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета 1 человека в присутствии гепарина. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета человека в присутствии 66 мкг/мл гепарина.

В другом аспекте настоящего изобретения предлагается антитело, которое связывается с тем же эпитопом, что и любое из вышеописанных антител. В некоторых вариантах осуществления данного изобретения определение того, связывается ли антитело с тем же эпитопом или конкурирует за связывание с триптазой бета 1 человека, осуществляют с помощью анализа связывания эпитопа. В некоторых вариантах осуществления данного изобретения анализ связывания эпитопа представляет собой анализ связывания эпитопа OCTET®, например, как описано в Примере 3, Раздел С. В некоторых вариантах осуществления данного изобретения мономерный белок триптазы бета 1 человека биотинилируют на остатке Lys путем взаимодействия с NHS-PEG4-биотином. Биотинилированный мономер разбавляют до 5 мкг/мл в кинетическом буфере (ForteBio, Inc.) и иммобилизируют на наконечниках стрептавидинового сенсора (ForteBio, Inc.). После этапа иммобилизации, сенсоры, иммобилизованные триптазой бета 1 человека, насыщают первым антителом, разбавленным до 10-20 мкг/мл, с последующим связыванием со вторым антителом, разведенным до 2,5 мкг/мл. В некоторых вариантах осуществления данного изобретения анализ связывания эпитопа проводят при 30°С.

В другом аспекте данного изобретения предлагается антитело, которое конкурирует за связывание с триптазой бета 1 человека, или перекрестно блокирует, или перекрестно блокируется любым из вышеописанных антител.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело является моноклональным, человеческим, гуманизированным или химерным. В некоторых вариантах осуществления данного изобретения указанное антитело является гуманизированным.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело представляет собой фрагмент антитела, который связывает триптазу. В некоторых вариантах осуществления данного изобретения указанный фрагмент антитела выбирают из группы, состоящей из фрагментов Fab, Fab'-SH, Fv, scFv и (Fab')2.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело является полноразмерным антителом. В некоторых вариантах осуществления данного изобретения указанное антитело представляет собой антитело IgG. В некоторых вариантах осуществления настоящего изобретения антитело IgG представляет собой антитело IgG1. В некоторых вариантах реализации настоящего изобретения антитело IgG представляет собой антитело IgG4. В некоторых вариантах осуществления данного изобретения указанное антитело IgG4 содержит мутацию в шарнирной области. В некоторых вариантах осуществления данного изобретения указанная мутация представляет собой мутацию по типу замены. В некоторых вариантах осуществления данного изобретения указанная мутация по типу замены приходится на аминокислотный остаток S228 (нумерация EU). В некоторых вариантах осуществления данного изобретения указанное антитело IgG4 содержит мутацию S228P (нумерация EU).

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело является моноспецифическим антителом.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело является мультиспецифическим антителом. В некоторых вариантах осуществления данного изобретения указанное антитело является биспецифическим антителом. В некоторых вариантах осуществления данного изобретения указанное антитело содержит первый связывающий домен, который связывается с триптазой, и второй связывающий домен, который связывается со второй биологической молекулой, при этом вторую биологическую молекулу выбирают из группы, состоящей из интерлейкина-13 (IL-13), интерлейкина-4 (IL-4), интерлейкин-5 (IL-5), интерлейкина-17 (IL-17), IgE и интерлейкина-33 (IL-33). В некоторых вариантах осуществления данного изобретения указанная вторая биологическая молекула представляет собой IL-13. В некоторых вариантах осуществления данного изобретения указанная вторая биологическая молекула представляет собой IL-33. В некоторых вариантах осуществления данного изобретения указанная вторая биологическая молекула представляет собой IgE.

В другом аспекте данного изобретения предлагается выделенная нуклеиновая кислота, которая кодирует любое из антител, описанных в данном документе, или набор выделенных нуклеиновых кислот, совместно кодирующих указанное антитело.

В другом аспекте данное изобретение относится к выделенной нуклеиновой кислоте, кодирующей антитело, содержащее домен VH, содержащий аминокислотную последовательность SEQ ID NO: 9, и/или домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10, или набор выделенных нуклеиновых кислот, совместно кодирующих указанное антитело, при этом нуклеиновая кислота содержит последовательность, которая по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 99% идентична последовательности SEQ ID NO: 104 и/или SEQ ID NO: 105. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 76, и/или (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 77, и при этом нуклеиновая кислота или набор содержит последовательность, которая по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 99% идентична последовательности SEQ ID NO: 106 и/или SEQ ID NO: 107. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 78, и/или (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 79, и при этом нуклеиновая кислота или набор содержит последовательность, которая по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 99% идентична последовательности SEQ ID NO: 108 и/или SEQ ID NO: 107. В некоторых вариантах осуществления данного изобретения указанная нуклеиновая кислота или набор содержит последовательность SEQ ID NO: 108 и/или SEQ ID NO: 107.

В другом аспекте данное изобретение относится к выделенной нуклеиновой кислоте, кодирующей указанное антитело, содержащее домен VH, содержащий аминокислотную последовательность SEQ ID NO: 36 и/или домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37, или набор выделенных нуклеиновых кислот, совместно кодирующих антитело, при этом нуклеиновая кислота содержит последовательность, которая по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 99% идентична последовательности SEQ ID NO: 109 и/или SEQ ID NO: 110. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80, и/или (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81, и при этом нуклеиновая кислота или набор содержит последовательность, которая по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 99% идентична последовательности SEQ ID NO: 111 и/или SEQ ID NO: 112. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и/или (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83, и при этом нуклеиновая кислота или набор содержит последовательность, которая по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или по меньшей мере на 99% идентична последовательности SEQ ID NO: 113 и/или SEQ ID NO: 112. В некоторых вариантах осуществления данного изобретения указанная нуклеиновая кислота или набор содержит последовательность SEQ ID NO: 113 и/или SEQ ID NO: 112.

В другом аспекте данного изобретения предлагается вектор (например, экспрессионный вектор) или набор векторов, содержащих любую из выделенных нуклеиновых кислот или набор выделенных нуклеиновых кислот, описанных в данном документе. В другом аспекте данного изобретения предлагается клетки-хозяева, содержащие вышеописанные нуклеиновые кислоты и/или векторы и/или наборы нуклеиновых кислот и/или наборы векторов. В некоторых вариантах осуществления данного изобретения клетка-хозяин представляет собой клетку млекопитающего. В некоторых вариантах осуществления данного изобретения клетка млекопитающего представляет собой клетку яичника китайского хомяка (СНО). В некоторых вариантах осуществления данного изобретения клетка-хозяина представляет собой прокариотическую клетку. В некоторых вариантах осуществления данного изобретения прокариотическая клетка представляет собой клетку Е. coli.

В другом аспекте данного изобретения предлагается способ получения любого из антител, описанных в данном документе, при этом указанный способ включает культивирование клетки-хозяина, которая содержит любой из вышеописанных векторов (например, экспрессионный вектор) или набора векторов в культуральной среде при подходящих условиях, которые позволяют продуцировать указанное антитело. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает выделение антитела из клетки-хозяина или культуральной среды.

В другом аспекте данного изобретения предлагается композиция (например, фармацевтическая композиция), содержащая любое из вышеописанных антител. В некоторых вариантах осуществления данного изобретения указанная композиция дополнительно содержит фармацевтически приемлемый носитель, вспомогательное вещество или разбавитель.

В другом аспекте данного изобретения предлагается фармацевтическая композиция, содержащая выделенное моноклональное антитело, которое связывается с триптазой бета 1 человека или его антигенсвязывающий фрагмент, и фармацевтически приемлемый носитель, вспомогательное вещество или разбавитель, при этом указанное антитело связывается с мономерной триптазой бета 1 со значением KD, составляющим от около 0,1 нМ до около 1 нМ, и/или при этом указанное антитело способно ингибировать ферментативную активность триптазы с половинной максимальной ингибирующей концентрацией (IC50) от около 0,1 нМ до около 5 нМ, что определяется с помощью ферментативного анализа триптазы in vitro с применением S-2288 в качестве субстрата.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело связывает триптазу со значением KD, составляющим от около 0,5 до около 1 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим от около 0,1 нМ до около 0,5 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим около 0,4 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим около 0,2 нМ. В некоторых вариантах осуществления данного изобретения значение KD измеряют методом поверхностного плазмонного резонанса (SPR). В некоторых вариантах осуществления данного изобретения анализ SPR проводят при 25°С. В некоторых вариантах осуществления данного изобретения значение KD измеряют с помощью анализа BIACORE® SPR, например, как описано в Примере 1, Раздел (A) (vii). В некоторых вариантах осуществления данного изобретения для анализа SPR можно применять BIAcore® Т200 или эквивалентное устройство. В некоторых вариантах осуществления данного изобретения сенсорные чипы BIAcore® серии S СМ5 (или эквивалентные сенсорные чипы) иммобилизмруют моноклональным мышиным антителом против IgG (Fc) человека, и антитела против триптазы впоследствии захватываются в проточной ячейке. Последовательные 3-кратные разведения His-меченого мономера триптазы бета 1 человека (SEQ ID NO: 128) вводят при скорости потока 30 мкл/мин. Каждый образец анализируют с 3-минутной ассоциацией и 10-минутной диссоциацией. Анализ проводили при 25°С. После каждого введения чип регенерировали с применением 3 М MgCl2. Ответ связывания корректируют путем вычитания единиц ответа (RU) из проточной ячейки, захватывающей нерелевантный IgG с аналогичной плотностью. Для анализа кинетики применяли модель Ленгмюра 1: 1 одновременной подгонки kon и koff.

В некоторых вариантах осуществления любого из предшествующих аспектов указанное антитело способно ингибировать активности триптазы со значением IC50 от около 0,5 нМ до около 5 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы со значением IC50, составляющим от около 0,1 нМ до около 2 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением 1С50 составляющим от около 4 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы со значением IC50, составляющим около 0,6 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы при рН 6 в ферментативном анализе триптазы in vitro с применением S-2288 в качестве субстрата. В некоторых вариантах осуществления данного изобретения ингибирующую активность антитела определяют, как описано в Примерах (например, Пример 1, Раздел (A) (viii) (а)). В некоторых вариантах осуществления данного изобретения активный фермент рекомбинантного тетрамера триптазы бета 1 человека разводят до 0,75 нМ в буфере TNH (200 мМ Трис, 150 мМ NaCl, 0,1 мг/мл гепарина, 0,01% TRITON™ Х-100, рН 8,0) и объединяют в соотношении 1:1 с антителами против триптазы (разведенными в PBS) на 384-луночных планшетах. Планшеты инкубируют в течение 1 ч при температуре окружающей среды при осторожном перемешивании. Колориметрический субстрат S-2288 (Chromogenix, Part No. 82-0852-39) или эквивалентный субстрат разбавляют до 1200 мкМ в буфере TNH и добавляют на планшет.В некоторых вариантах осуществления данного изобретения конечные концентрации в лунках составляют 400 мкМ S-2288, 0,25 нМ рекомбинантного тетрамера триптазы бета 1 человека, 66 мкг/мл гепарина и от 0,10 до 222 нМ антитела против триптазы. Планшеты инкубируют в течение 40 мин при температуре окружающей среды с осторожным перемешиванием, а затем считывают при А405. Значение IC50 антител против триптазы определяют по четырехпараметрическому соответствию их соответствующих кривых. В некоторых вариантах осуществления данного изобретения конечная концентрация гепарина в ферментативном анализе триптазы бета человека с применением синтетического пептида S-2288 составляет 66 мкг/мл.

В некоторых вариантах осуществления предшествующего аспекта указанное антитело способно ингибировать опосредованную триптазой стимуляцию пролиферации и/или коллаген-зависимое сокращение клеток гладких мышц бронхов. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать высвобождение гистамина из тучных клеток. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать высвобождение гистамина, запускаемое посредством IgE, и/или высвобождение гистамина, запускаемое триптазой. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы в образцах бронхоальвеолярного лаважа (BAL) или в назосорбционных образцах яванского макака. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета 1 человека. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета 1 человека в моновалентном формате. В некоторых вариантах осуществления данного изобретения указанный моновалентный формат представляет собой Fab формат. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета 1 человека в присутствии гепарина. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать тетрамерную триптазу бета человека в присутствии 66 мкг/мл гепарина.

В некоторых вариантах осуществления предшествующего аспекта указанное антитело содержит следующие гипервариабельные области (HVR): (а) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащую аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащую аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6). В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) вариабельный домен (VH) тяжелой цепи, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 9; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности с аминокислотной последовательностью SEQ ID NO: 10; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 11); (b) FR-H2, содержащую аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: (с) FR-H3, содержащую аминокислотную последовательность RFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 13); и (d) FR-H4, содержащую аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 14). В некоторых вариантах осуществления данного изобретения домен VH указанного антитела содержит аминокислотную последовательность SEQ ID NO: 9. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 15); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGKSPKPWIY (SEQ ID NO: 16); (с) FR-L3, содержащую аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 17); и (d) FR-L4, содержащую аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 18). В некоторых вариантах осуществления данного изобретения домен VL указанного антитела содержит аминокислотную последовательность SEQ ID NO: 10. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 76, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 77. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 78), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 79. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два, по меньшей мере три или все четыре остатка, выбранных из группы, состоящей из His51, Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим His51 и по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать или все двенадцать аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg105, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит His51, Gln67, Val80, Lys81, Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать как малую поверхность контакта тетрамерной триптазы бета 1 человека, так и большую поверхность контакта тетрамерной триптазы бета 1 человека.

В других вариантах осуществления предшествующего аспекта указанное антитело содержит следующие шесть HVR: (a) HVR-H1, содержащую аминокислотную последовательность GYAIT (SEQ ID NO: 30); (b) HVR-H2, содержащую аминокислотную последовательность GISSAATTFYSSWAKS (SEQ ID NO: 31); (с) HVR-H3, содержащую аминокислотную последовательность DPRGYGAALDRLDL (SEQ ID NO: 32); (d) HVR-L1, содержащую аминокислотную последовательность QSIKSVYNNRLG (SEQ ID NO: 33); (e) HVR-L2, содержащую аминокислотную последовательность ETSILTS (SEQ ID NO: 34); и (f) HVR-L3, содержащую аминокислотную последовательность AGGFDRSGDTT (SEQ ID NO: 35). В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью любой из SEQ ID NO: 36, 47, 48, 49, 50, 51 и 52; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью любой из SEQ ID NO: 37, 53, 58 или 59; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) FR-H2, содержащую аминокислотную последовательность WIRQPPGKGLEWIG (SEQ ID NO: 42); (с) FR-H3, содержащую аминокислотную последовательность RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); и (d) FR-H4, содержащую аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 41). В некоторых вариантах осуществления данного изобретения домен VH указанного антитела содержит аминокислотную последовательность SEQ ID NO: 36. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 65); (с) FR-L3, содержащую аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); и (d) FR-L4, содержащую аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 63). В некоторых вариантах осуществления данного изобретения домен VL указанного антитела содержит аминокислотную последовательность SEQ ID NO: 37. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Gln100, Leu101 и Leu102 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать, по меньшей мере двенадцать, по меньшей мере тринадцать или все четырнадцать аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп содержит Gln35, Тгр55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101, Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к тетрамеру триптазы бета 1 человека и указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или оба из Gln35 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать малую поверхность контакта и/или большую поверхность контакта триптазы бета 1 человека.

В другом аспекте данного изобретение предлагается композиция (например, фармацевтическая композиция), содержащая выделенное моноклональное антитело, которое связывается с триптазой бета 1 человека или его антигенсвязывающий фрагмент, и фармацевтически приемлемый носитель, вспомогательное вещество или разбавитель, при этом указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два, по меньшей мере три или все четыре остатка, выбранные из группы, состоящей из His51, Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим His51 и по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать или все двенадцать аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит His51, Gln67, Val80, Lys81, Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать как малую поверхность контакта тетрамерной триптазы бета 1 человека, так и большую поверхность контакта тетрамерной триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанное антитело содержит следующие гипервариабельные области (HVR): (a) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащую аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащую аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6). В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) вариабельный домен (VH) тяжелой цепи, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью SEQ ID NO: 9; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности с аминокислотной последовательностью SEQ ID NO: 10; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO: 11); (b) FR-H2, содержащую аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: (с) FR-H3, содержащую аминокислотную последовательность RFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 13); и (d) FR-H4, содержащую аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 14). В некоторых вариантах осуществления данного изобретения домен VH указанного антитела содержит аминокислотную последовательность SEQ ID NO: 9. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 15); (b) FR-L2, содержащую аминокислотную последовательность WYQQKPGKSPKPWIY (SEQ ID NO: 16); (с) FR-L3, содержащую аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 17); и (d) FR-L4, содержащую аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 18). В некоторых вариантах осуществления данного изобретения домен VL указанного антитела содержит аминокислотную последовательность SEQ ID NO: 10. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 76, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 77. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 78), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 79.

В другом аспекте данного изобретение предлагается композиция (например, фармацевтическая композиция), содержащая выделенное моноклональное антитело, которое связывается с триптазой бета 1 человека или его антигенсвязывающий фрагмент, и фармацевтически приемлемый носитель, вспомогательное вещество или разбавитель, при этом указанное антитело связывается с эпитопом триптазы бета 1 человека, содержащим по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Gln100, Leu101 и Leu102 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать, по меньшей мере двенадцать, по меньшей мере тринадцать или все четырнадцать аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп содержит Gln35, Tgr55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101, Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к тетрамеру триптазы бета 1 человека и указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или оба из Gln35 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать малую поверхность контакта и/или большую поверхность контакта триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанное антитело содержит следующие шесть HVR: (a) HVR-H1, содержащую аминокислотную последовательность GYAIT (SEQ ID NO: 30); (b) HVR-H2, содержащую аминокислотную последовательность GISSAATTFYSSWAKS (SEQ ID NO: 31); (с) HVR-H3, содержащую аминокислотную последовательность DPRGYGAALDRLDL (SEQ ID NO: 32); (d) HVR-L1, содержащую аминокислотную последовательность QSIKSVYNNRLG (SEQ ID NO: 33); (е) HVR-L2, содержащую аминокислотную последовательность ETSILTS (SEQ ID NO: 34); и (f) HVR-L3, содержащую аминокислотную последовательность AGGFDRSGDTT (SEQ ID NO: 35). В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью любой из SEQ ID NO: 36, 47, 48, 49, 50, 51 и 52; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90%, по меньшей мере 95% или по меньшей мере 99% идентичности последовательности с аминокислотной последовательностью любой из SEQ ID NO: 37, 53, 58 или 59; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VH: (a) FR-H1, содержащую аминокислотную последовательность EVQLVESGPGLVKPSETLSLTCTVSRFSLI (SEQ ID NO: 38); (b) FR-H2, содержащую аминокислотную последовательность WIRQPPGKGLEWIG (SEQ ID NO: 42); (с) FR-H3, содержащую аминокислотную последовательность RVTISRDTSKNQVSLKLSSVTAADTAVYYCAR (SEQ ID NO: 43); и (d) FR-H4, содержащую аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 41). В некоторых вариантах осуществления данного изобретения домен VH указанного антитела содержит аминокислотную последовательность SEQ ID NO: 36. В некоторых вариантах осуществления данного изобретения указанное антитело дополнительно содержит следующие FR домена VL: (a) FR-L1, содержащую аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 64); (b) FR-H2, содержащую аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 65); (с) FR-L3, содержащую аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 66); и (d) FR-L4, содержащую аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 63). В некоторых вариантах осуществления данного изобретения домен VL указанного антитела содержит аминокислотную последовательность SEQ ID NO: 37. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80), и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81. В некоторых вариантах осуществления данного изобретения указанное антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83.

В некоторых вариантах осуществления данного изобретения указанное антитело способно к дополнительному связыванию триптазы альфа, триптазы бета 2 или триптазы бета 3 человека и/или триптазы D1 яванского макака.

В любой из вышеописанных композиций (например, фармацевтических композиций) указанное антитело может быть моноклональным, человеческим, гуманизированным или химерным. В некоторых вариантах осуществления данного изобретения указанное антитело является гуманизированным.

В любой из вышеописанных композиций (например, фармацевтических композиций) указанная композиция может быть применена для человека.

Любая из вышеописанных композиций (например, фармацевтических композиций) может быть лиофилизирована. В других вариантах осуществления данного изобретения, любая из вышеописанных композиций (например, фармацевтических композиций) может представлять собой жидкость.

В любой из вышеописанных композиций (например, фармацевтических композиций) вспомогательное вещество может представлять собой антиоксидант. В некоторых вариантах осуществления данного изобретения указанная композиция содержит один или большее количество антиоксидантов, выбранных из группы, состоящей из N-ацетилтриптофана, триптофана, метионина, цистеина, глутатиона, тиосорбита, аскорбиновой кислоты, монотиоглицерина, циклодекстринов, тролокса (6-гидрокси-2,5,7,8-тетраметилхроман-2-карбоновая кислота), пиридоксина, маннита и металлохелатора. В некоторых вариантах осуществления данного изобретения указанная композиция содержит N-ацетилтриптофан или метионин. В некоторых вариантах осуществления данного изобретения указанная композиция содержит N-ацетилтриптофан и метионин.

В другом аспекте данного изобретения предлагается композиция (например, фармацевтическая композиция), содержащая: (i) выделенное антитело, которое связывается с триптазой бета 1 человека, или его антигенсвязывающий фрагмент, при этом указанное антитело содержит следующие шесть гипервариабельных областей (HVR): (a) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащую аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащую аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6), при этом окисление триптофана в положении 6 HVR-H3 (SEQ ID NO: 8) не более 30%. В некоторых вариантах осуществления данного изобретения окисление триптофана в положении 6 HVR-Н3 (SEQ ID NO: 8) составляет не более 28%, 25%, 20%, 15%, 10% или 6%. В некоторых вариантах осуществления данного изобретения окисление триптофана в положении 6 HVR-H3 (SEQ ID NO: 8) определяется после стресс-теста ААРН. В некоторых вариантах осуществления данного изобретения окисление триптофана в положении 6 HVR-H3 (SEQ ID NO: 8) определяется в течение одного года с момента первоначального изготовления композиции.

Любая из вышеописанных композиций (например, фармацевтических композиций) может содержать N-ацетилтриптофан в концентрации от около 0,1 до около 5 мМ. В некоторых вариантах осуществления данного изобретения концентрация N-ацетилтриптофана составляет от около 0,1 мМ до около 1 мМ. В некоторых вариантах осуществления данного изобретения концентрация N-ацетилтриптофана составляет около 0,3 мМ. В некоторых вариантах осуществления данного изобретения указанная композиция содержит метионин в концентрации от около 1 до около 20 мМ. В некоторых вариантах осуществления данного изобретения концентрация метионина составляет от около 1 мМ до около 10 мМ. В некоторых вариантах осуществления данного изобретения концентрация метионина составляет около 5 мМ.

В другом аспекте данного изобретения предлагается композиция (например, фармацевтическая композиция), содержащая: (i) выделенное антитело, которое связывается с триптазой человека, или его антигенсвязывающий фрагмент, при этом указанное антитело содержит следующие шесть гипервариабельных областей (HVR): (a) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащую аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащую аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и

(f) HVR-L3, содержащую аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6); (ii) N-ацетилтриптофан в концентрации от около 0,1 до около 1 мМ; и (iii) метионин в концентрации от около 1 до около 10 мМ.

В любой из вышеописанных композиций (например, фармацевтических композиций) концентрация антител может составлять от около 1 мг/мл до около 250 мг/мл. В некоторых вариантах осуществления данного изобретения концентрация антител составляет около 150 мг/мл.

Любая из вышеописанных композиций (например, фармацевтических композиций) может дополнительно включать одно или большее количество дополнительных вспомогательных веществ, выбранных из группы, состоящей из стабилизатора, буфера, поверхностно-активного вещества и регулятора тоничности. В некоторых вариантах осуществления данного изобретения указанная композиция дополнительно содержит буфер. В некоторых вариантах осуществления данного изобретения буфер представляет собой сукцинат аргинина и/или сукцинат гистидина. В некоторых вариантах осуществления данного изобретения буфер содержит сукцинат аргинина и сукцинат гистидина. В некоторых вариантах осуществления данного изобретения концентрация сукцината аргинина составляет от около 50 мМ до около 500 мМ. В некоторых вариантах осуществления данного изобретения концентрация сукцината аргинина составляет от около 100 мМ до около 300 мМ. В некоторых вариантах осуществления данного изобретения концентрация сукцината аргинина составляет около 200 мМ. В некоторых вариантах осуществления данного изобретения концентрация сукцината гистидина составляет от около 1 мМ до около 50 мМ. В некоторых вариантах осуществления данного изобретения концентрация сукцината гистидина составляет от около 15 мМ до около 25 мМ. В некоторых вариантах осуществления данного изобретения концентрация сукцината гистидина составляет около 20 мМ. В некоторых вариантах осуществления данного изобретения указанная композиция дополнительно содержит поверхностно-активное вещество. В некоторых вариантах осуществления данного изобретения поверхностно-активное вещество представляет собой полоксамер 188 или полисорбат 20. В некоторых вариантах осуществления данного изобретения поверхностно-активное вещество представляет собой полоксамер 188. В некоторых вариантах осуществления данного изобретения концентрация полоксамера 188 составляет от около 0,005% до около 0,1%. В некоторых вариантах осуществления данного изобретения концентрация полоксамера 188 составляет от около 0,005% до около 0,05%. В некоторых вариантах осуществления данного изобретения концентрация полоксамера 188 составляет около 0,02%. В некоторых вариантах осуществления данного изобретения рН композиции составляет от около 4,5 до около 7,0. В некоторых вариантах осуществления данного изобретения рН композиции составляет от около 4,5 до около 6,5. В некоторых вариантах осуществления данного изобретения рН композиции составляет около 5,5. В некоторых вариантах осуществления данного изобретения указанная композиция находится в светонепроницаемом контейнере. В некоторых вариантах осуществления данного изобретения указанная композиция находится в предварительно заполненном шприце.

Любая из вышеописанных композиций (например, фармацевтических композиций) может дополнительно включать антагонист связывания оси IL-13, антагонист связывания оси IL-5, антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Th2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13, представляет собой антитело против IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-33 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых вариантах осуществления данного изобретения антагонист основного М1 представляет собой квилизумаб. В некоторых случаях антагонист IgE представляет собой омализумаб (КСОЛАР®).

Любая из вышеописанных композиций (например, фармацевтических композиций) может быть составлена для введения человеку. В определенных вариантах осуществления данного изобретения фармацевтические композиции содержат антитела, которые не содержат нечеловеческих последовательностей константной области. В определенных вариантах осуществления данного изобретения фармацевтические композиции содержат антитела, которые не содержат нечеловеческого каркаса и нечеловеческих последовательностей константной области. В определенных вариантах осуществления данного изобретения фармацевтические композиции содержат антитела, которые являются человеческими антителами, гуманизированными антителами или химерными антителами.

В некоторых аспектах любое из вышеописанных антител может применяться в качестве лекарственного средства.

В некоторых аспектах любое из вышеописанных антител может применяться в лечении нарушения. В некоторых вариантах осуществления данного изобретения указанное нарушение выбирают из группы, состоящей из легочного нарушения, аутоиммунного нарушения, воспалительного нарушения, фиброзного нарушения, гранулоцитарного (нейтрофильного или эозинофильного) нарушения, моноцитарного нарушения, лимфоцитарного нарушения или нарушения, ассоциированного с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение. В некоторых вариантах осуществления данного изобретения легочное нарушение выбирают из группы, состоящей из астмы, гиперчувствительности дыхательных путей и хронического обструктивного заболевания легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2 или астму с низким уровнем Th2. В некоторых вариантах осуществления данного изобретения аутоиммунное нарушение выбирают из группы, состоящей из ревматоидного артрита, псориаза, эозинофильного эзофагита, воспалительного заболевания кишечника (ВЗК) и болезни Крона. В некоторых вариантах осуществления данного изобретения воспалительное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК, также известную как хроническая спонтанная крапивница, ХСК), анафилаксию, анафилактический шок, атопический дерматит или аллергический ринит. В некоторых вариантах осуществления данного изобретения фиброзное нарушение представляет собой идиопатический легочной фиброз (ИЛФ). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой мастоцитоз. В некоторых вариантах осуществления данного изобретения указанное антитело предназначено для применения в комбинации с дополнительным терапевтическим агентом. В некоторых вариантах осуществления данного изобретения дополнительный терапевтический агент представляет собой антагонист связывания оси IL-13, антагонист связывания оси IL-5, антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Th2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13, представляет собой антитело против IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-33 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых вариантах осуществления данного изобретения антагонист основного М1 представляет собой квилизумаб. В некоторых вариантах осуществления данного изобретения указанное антитело предназначено для введения подкожно, внутривенно, внутримышечно, местно, перорально, трансдермально, внутрибрюшинно, внутриорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально. В некоторых вариантах осуществления данного изобретения указанное антитело предназначено для подкожного введения. В некоторых вариантах осуществления данного изобретения указанное антитело предназначено для применения у субъекта-человека.

В некоторых аспектах любая из вышеописанных композиций (например, фармацевтических композиций) может применяться в качестве лекарственного средства.

В некоторых аспектах любая из вышеописанных композиций (например, фармацевтических композиций) может применяться в лечении нарушения. В некоторых вариантах осуществления данного изобретения указанное нарушение выбирают из группы, состоящей из легочного нарушения, аутоиммунного нарушения, воспалительного нарушения, фиброзного нарушения, гранулоцитарного (нейтрофильного или эозинофильного) нарушения, моноцитарного нарушения, лимфоцитарного нарушения или нарушения, ассоциированного с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток(например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение. В некоторых вариантах осуществления данного изобретения легочное нарушение выбирают из группы, состоящей из астмы, гиперчувствительности дыхательных путей и хронического обструктивного заболевания легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2 или астму с низким уровнем Th2. В некоторых вариантах осуществления данного изобретения аутоиммунное нарушение выбирают из группы, состоящей из ревматоидного артрита, псориаза, эозинофильного эзофагита, воспалительного заболевания кишечника (ВЗК) и болезни Крона. В некоторых вариантах осуществления данного изобретения воспалительное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК или ХСК), анафилаксию, анафилактический шок, атопический дерматит или аллергический ринит. В некоторых вариантах осуществления данного изобретения фиброзное нарушение представляет собой идиопатический легочной фиброз (ИЛФ). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой мастоцитоз. В некоторых вариантах осуществления данного изобретения указанная композиция (например, фармацевтическая композиция) предназначена для применения в комбинации с дополнительным терапевтическим агентом. В некоторых вариантах осуществления данного изобретения дополнительный терапевтический агент представляет собой антагонист связывания оси IL-13, антагонист связывания оси IL-5, антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Th2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13, представляет собой антитело против IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-33 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых вариантах осуществления данного изобретения антагонист основного М1 представляет собой квилизумаб. В некоторых вариантах осуществления данного изобретения указанная композиция (например, фармацевтическая композиция) предназначена для введения подкожно, внутривенно, внутримышечно, местно, перорально, трансдермально, внутрибрюшинно, внутриорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально. В некоторых вариантах осуществления данного изобретения указанная композиция (например, фармацевтическая композиция) предназначена для подкожного введения. В некоторых вариантах осуществления данного изобретения указанная композиция (например, фармацевтическая композиция) предназначена для применения у субъекта-человека.

В некоторых аспектах любое из вышеописанных антител может применяться при изготовлении лекарственного средства для лечения нарушения. В некоторых вариантах осуществления данного изобретения указанное нарушение выбирают из группы, состоящей из легочного нарушения, аутоиммунного нарушения, воспалительного нарушения, фиброзного нарушения, гранулоцитарного (нейтрофильного или эозинофильного) нарушения, моноцитарного нарушения, лимфоцитарного нарушения или нарушения, ассоциированного с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток(например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение. В некоторых вариантах осуществления данного изобретения легочное нарушение выбирают из группы, состоящей из астмы, гиперчувствительности дыхательных путей и хронического обструктивного заболевания легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2 или астму с низким уровнем Th2. В некоторых вариантах осуществления данного изобретения аутоиммунное нарушение выбирают из группы, состоящей из ревматоидного артрита, псориаза, эозинофильного эзофагита, воспалительного заболевания кишечника (ВЗК) и болезни Крона. В некоторых вариантах осуществления данного изобретения воспалительное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК или ХСК), анафилаксию, анафилактический шок, атопический дерматит или аллергический ринит. В некоторых вариантах осуществления данного изобретения фиброзное нарушение представляет собой идиопатический легочной фиброз (ИЛФ). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой мастоцитоз. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для применения в комбинации с дополнительным терапевтическим агентом. В некоторых вариантах осуществления данного изобретения дополнительный терапевтический агент представляет собой антагонист связывания оси IL-13, антагонист связывания оси IL-5, антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Th2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13, представляет собой антитело против IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-33 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых вариантах осуществления данного изобретения антагонист основного М1 представляет собой квилизумаб. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для введения подкожно, внутривенно, внутримышечно, местно, перорально, трансдермально, внутрибрюшинно, внутриорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для подкожного введения. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для применения у субъекта-человека.

В некоторых аспектах любая из вышеописанных композиций (например, фармацевтических композиций) может применяться при изготовлении лекарственного средства для лечения нарушения. В некоторых вариантах осуществления данного изобретения указанное нарушение выбирают из группы, состоящей из легочного нарушения, аутоиммунного нарушения, воспалительного нарушения, фиброзного нарушения, гранулоцитарного (нейтрофильного или эозинофильного) нарушения, моноцитарного нарушения, лимфоцитарного нарушения или нарушения, ассоциированного с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток(например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение. В некоторых вариантах осуществления данного изобретения легочное нарушение выбирают из группы, состоящей из астмы, гиперчувствительности дыхательных путей и хронического обструктивного заболевания легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2 или астму с низким уровнем Th2. В некоторых вариантах осуществления данного изобретения аутоиммунное нарушение выбирают из группы, состоящей из ревматоидного артрита, псориаза, эозинофильного эзофагита, воспалительного заболевания кишечника (ВЗК) и болезни Крона. В некоторых вариантах осуществления данного изобретения воспалительное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК или ХСК), анафилаксию, анафилактический шок, атопический дерматит или аллергический ринит. В некоторых вариантах осуществления данного изобретения фиброзное нарушение представляет собой идиопатический легочной фиброз (ИЛФ). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой мастоцитоз. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для применения в комбинации с дополнительным терапевтическим агентом. В некоторых вариантах осуществления данного изобретения дополнительный терапевтический агент представляет собой антагонист связывания оси IL-13, антагонист связывания оси IL-5, антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Тп2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13, представляет собой антитело против IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-33 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых вариантах осуществления данного изобретения антагонист основного М1 представляет собой квилизумаб. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для введения подкожно, внутривенно, внутримышечно, местно, перорально, трансдермально, внутрибрюшинно, внутриорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для подкожного введения. В некоторых вариантах осуществления данного изобретения указанное лекарственное средство составляют для применения у субъекта-человека.

В другом аспекте данное изобретение относится к способу лечения нарушения у субъекта, который в этом нуждается, при этом указанный способ включает введение субъекту терапевтически эффективного количества любого из вышеописанных антител. В некоторых вариантах осуществления данного изобретения указанное нарушение выбирают из группы, состоящей из легочного нарушения, аутоиммунного нарушения, воспалительного нарушения, фиброзного нарушения, гранулоцитарного (нейтрофильного или эозинофильного) нарушения, моноцитарного нарушения, лимфоцитарного нарушения или нарушения, ассоциированного с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток(например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение. В некоторых вариантах осуществления данного изобретения легочное нарушение выбирают из группы, состоящей из астмы, гиперчувствительности дыхательных путей и хронического обструктивного заболевания легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2 или астму с низким уровнем Th2. В некоторых вариантах осуществления данного изобретения аутоиммунное нарушение выбирают из группы, состоящей из ревматоидного артрита, псориаза, эозинофильного эзофагита, воспалительного заболевания кишечника (ВЗК) и болезни Крона. В некоторых вариантах осуществления данного изобретения воспалительное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК или ХСК), анафилаксию, анафилактический шок, атопический дерматит или аллергический ринит. В некоторых вариантах осуществления данного изобретения фиброзное нарушение представляет собой идиопатический легочной фиброз (ИЛФ). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой мастоцитоз. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение субъекту дополнительного терапевтического агента. В некоторых вариантах осуществления данного изобретения дополнительный терапевтический агент представляет собой антагонист связывания оси IL-13, антагонист связывания оси IL-5, антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Th2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13, представляет собой антитело против IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-33 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых вариантах осуществления данного изобретения антагонист основного М1 представляет собой квилизумаб. В некоторых вариантах осуществления данного изобретения указанный антагонист IgE представляет собой омализумаб (Ксолар®). В некоторых вариантах осуществления данного изобретения указанное антитело вводят подкожно, внутривенно, внутримышечно, местно, перорально, трансдермально, внутрибрюшинно, внутриорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально. В некоторых вариантах осуществления данного изобретения субъект представляет собой человека.

В другом аспекте данное изобретение относится к способу лечения нарушения у субъекта, который в этом нуждается, при этом указанный способ включает введение субъекту терапевтически эффективного количества любой из вышеописанных композиций (например, фармацевтических композиций). В некоторых вариантах осуществления данного изобретения указанное нарушение выбирают из группы, состоящей из легочного нарушения, аутоиммунного нарушения, воспалительного нарушения, фиброзного нарушения, гранулоцитарного (нейтрофильного или эозинофильного) нарушения, моноцитарного нарушения, лимфоцитарного нарушения или нарушения, ассоциированного с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение. В некоторых вариантах осуществления данного изобретения легочное нарушение выбирают из группы, состоящей из астмы, гиперчувствительности дыхательных путей и хронического обструктивного заболевания легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2 или астму с низким уровнем Th2. В некоторых вариантах осуществления данного изобретения аутоиммунное нарушение выбирают из группы, состоящей из ревматоидного артрита, псориаза, эозинофильного эзофагита, воспалительного заболевания кишечника (ВЗК) и болезни Крона. В некоторых вариантах осуществления данного изобретения воспалительное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК или ХСК), анафилаксию, анафилактический шок, атопический дерматит или аллергический ринит. В некоторых вариантах осуществления данного изобретения фиброзное нарушение представляет собой идиопатический легочной фиброз (ИЛФ). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или аномальной ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой мастоцитоз. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение субъекту дополнительного терапевтического агента. В некоторых вариантах осуществления данного изобретения дополнительный терапевтический агент представляет собой антагонист связывания оси IL-13, антагонист связывания оси IL-5, антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Th2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13, представляет собой антитело против IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-33 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых вариантах осуществления данного изобретения антагонист основного М1 представляет собой омализумаб (Ксолар®). В некоторых вариантах осуществления данного изобретения указанную композицию вводят подкожно, внутривенно, внутримышечно, местно, перорально, трансдермально, внутрибрюшинно, внутриорбитально, путем имплантации, путем ингаляции, интратекально, интравентрикулярно или интраназально. В некоторых вариантах осуществления данного изобретения субъект представляет собой человека.

Краткое описание графических материалов

Фиг. 1 представляет собой выравнивание последовательностей VH и VL доменов антител hu31A.v11 и huE104.v2, демонстрирующее определяющие комплементарность области (CDR) в соответствии с обозначениями по Кабату, Чотиа и Contact. Гипервариабельные области (HVR) подчеркнуты.

Фиг. 2А представляет собой серию графиков, демонстрирующих результаты анализа ингибирования hu31A.v11 и huE104.v2 IgG, определенные с помощью ферментативного анализа триптазы человека. Оба антитела полностью ингибировали ферментативную активность триптазы.

Фиг. 2В и 2С представляют собой графики, демонстрирующие результаты анализов пролиферации (Фиг. 2В) и сокращения (Фиг. 2С) первичных гладкомышечных клеток (ГМК) дыхательных путей человека. Добавление триптазы бета стимулировало пролиферацию первичных ГМК дыхательных путей человека, которая ингибировалась дозозависимым образом при добавлении антитела против триптазы hu31A.v11 или huE104.v2 IgG4 (Фиг. 2В). Добавление триптазы также стимулировало сокращение первичных ГМК дыхательных путей человека, которое также ингибировалось при добавлении hu31A.v11 IgG4 и huE104.v2 IgG4 (Фиг. 2C).

Фиг. 2D и 2Е представляют собой графики, демонстрирующие результаты анализов дегрануляции тучных клеток, в которых тучные клетки стимулировали in vitro путем добавления триптазы бета или анти-4-гидрокси-3-нитрофенилацетила (NP) IgE и NP. Добавление триптазы приводило к высвобождению гистамина, которое блокировалось при добавлении hu31A.v11 (Фиг. 2D). Каталитически неактивная мутантная триптаза (S195A) служила в качестве контроля. Добавление IgE и NP также приводило к высвобождению гистамина, которое ингибировалось (30-50%) при добавлении низкомолекулярного ингибитора триптазы (SMI) или hu31A.v11 (Фиг. 2Е).

Фиг. 3А представляет собой график, демонстрирующий результаты диссоциации тетрамера триптазы бета 1 человеческого с применением Fab hu31A.v11, проанализированного с помощью эксклюзионной хроматографии (SEC). С помощью SEC анализировали три прогона: прогон 1 содержал только тетрамерную триптазу WT, в результате чего получали пик 1 с временем удерживания Tr=26 мин, объемом удерживания Vr=13 мл; прогон 2 содержал тетрамерную триптазу WT + Fab hu31A.v11 + гепарин, в результате чего получали пик 2 (Tr=27,6 мин, Vr=13,8 мл) и пик 4 (Tr=31 мин, Vr=15,5 мл); прогон 3 содержал тетрамерную триптазу WT + Fab hu31A.v11 без гепарина, в результате чего получали пик 3 (Tr=28,1 мин, Vr=14 мл) и пик 4 (Tr=31 мин, Vr=15,5 мл).

Фиг. 3В представляет собой график, демонстрирующий результаты диссоциации тетрамера триптазы бета 1 человека с применением huE104.v2 Fab. С помощью SEC проанализировали три прогона: прогон 1 содержал His-меченую мономерную триптазу + Fab huE104.v2, в результате чего получали пик 2 (Tr=25,8 мин) и пик 6 (31,6 мин); прогон 2 содержал тетрамерную триптазу WT + Fab huE104.v2, в результате чего получали пик 3 (Tr=26 мин) и пик 7 (Tr=31,8 мин); и прогон 3 содержал тетрамерную триптазу WT + Fab huE104.v2 + гепарин, в результате чего получали пик 1 (Tr=21 мин), пик 4 (Tr=27,2 мин) и пик 5 (Tr=31,2 мин).

Фиг. 4А и 4В представляют собой серии графиков, демонстрирующих результаты фармакокинетического (ФK) моделирования, в котором сравнивается ФК и нейтрализующая активность диссоциирующего антитела против триптазы со специфическим для тетрамера триптазы стабилизирующим антителом при исходном уровне триптазы (4 нг/мл сыворотки), 10 нг/мл легочной ткани, Фиг. 4А) или при высоком уровне триптазы (10 нг/мл сыворотки, 40 нг/мл легочной ткани, Фиг. 4В).

Фиг. 4С представляет собой серию графиков, демонстрирующих результаты моделирования нейтрализующей активности, сравнивающие диссоциирующее антитело против триптазы и специфическое для тетрамера триптазы стабилизирующее антитело при исходном уровне триптазы или при высоком уровне триптазы.

На Фиг. 5А и 5В продемонстрированы изображения, полученные при анализе методом электрофореза в полиакриламидном геле в присутствии додецилсульфата натрия (ДСН-ПААГ) с окрашиванием Кумасси синим (верхние панели), иллюстрирующие, что триптаза бета 1 человека расщепляет фибриноген на пептидные фрагменты как при рН 6 (Фиг. 5А), так и при рН 7,5 (Фиг. 5В). Антитело против триптазы hu31A.v11 Fab блокировало расщепление фибриногена как при рН 6, так и при рН 7,5, тогда как huE102.v2 Fab этого не делал в условиях эксперимента с высокой концентрацией гепарина. Полоса 1, только фибриноген, демонстрирующая альфа-, бета- и гамма-цепи нерасщепленного фибриногена; полоса 2, фибриноген и триптаза бета; полоса 3, фибриноген, триптаза бета и hu31A.v11 Fab; полоса 4, фибриноген, триптаза бета и IgG В12; полоса 5, фибриноген, триптаза бета 1 и huE104.v2 Fab; и полоса 6, демонстрирующая только В12 mIgG1. Снижение интенсивности альфа-цепи указывает на протеолитическую активность триптазы, которая была проанализирована и количественно определена в нижних панелях.

Фиг. 6А представляет собой график, демонстрирующий результаты диссоциации тетрамера WT или мутантного тетрамера при применении hu31A.v11 Fab. С помощью SEC проанализировали четыре прогона: прогон 1 содержал тетрамер WT + huE104.v1 Fab, в результате чего получали контрольный пик (Tr=21,6 мин); прогон 2 содержал тетрамерный вариант Y75C + hu31A.v11 Fab, в результате чего получали пик 1 (Tr=25,6 мин) и пик 4 (Tr=31,6 мин); прогон 3 содержал тетрамерный вариант I99C + hu31A.v11 Fab, чв результате чего получали пик 2 (Tr=23,9 мин) и пик 4 (Tr=31,6 мин); и прогон 4 содержал тетрамер WT + hu31A.v11 Fab, в результате чего получали пик 3 (Tr=28,1 мин) и пик 4 (Tr=31,6 мин).

Фиг. 6В демонстрирует результаты анализа ДСН-ПААГ с окрашиванием Кумасси синим пиков эксклюзионной хроматографии, представленных на Фиг. 6А. hu31A.v11 Fab образовывал комплексы с мутантными вариантами Y75C и I99C триптазы и диссоциировал тетрамер на ковалентно связанные димеры.

Фиг. 6С представляет собой график, демонстрирующий результаты диссоциации тетрамера WT или мутантного тетрамера при применении huE104.v2 Fab. С помощью SEC проанализировали три прогона: прогон 1 содержал тетрамерный вариант Y75C + huE104.v2 Fab, в результате чего получали пик 1 (Tr=21,6 мин) и пик 4 (Tr=31 мин); прогон 2 содержал тетрамер тетрамерный вариант I99C + huE104.v2 Fab, в результате чего получали пик 2 и пик 5 (Tr=31 мин); и прогон 3 содержал тетрамер WT + huE104.v2 Fab, в результате чего получали пик 3 (Tr=26 мин) и пик 6 (Tr=31,8 мин). Полученные результаты демонструют, что антитело huE104.v2 Fab образовывало комплексы с мутантными вариантами Y75C и I99C триптазы и диссоциировал только тетрамер I99C, связанный с большой поверхностью контакта, на ковалентно связанные димеры. Все пики 4, 5 и 6 содержат избыток Fab, что определялось с помощью ДСН-ПААГ (данные не показаны).

На Фиг. 7 продемонстрирована аминокислотная последовательность зрелой триптазы бета 1 человека отдельно, а также последовательная нумерация генов и система нумерации химотрипсиногена («химо-номер»), обычно применяемая для серина трипсина млекопитающих.

На Фиг. 8 продемонстрировано связывание эпитопа Fab hu31A.v11 на триптазе бета 1 человека (все остатки триптазы пронумерованы по системе нумерации химотрипсиногена).

Фиг. 9 представляет собой визуализацию, демонстрирующую моделирование Fab hu31A.v11 на тетрамере триптазы. Мономеры триптазы в комплексе с Fab hu31A.v11 были совмещены с протомерами А и С в тетрамере триптазы. Обозначены тяжелые цепи и легкие цепи. Переплетения между легкими цепями Fab hu31A.v11 на соседних протомерах триптазы в этой модели выделены пунктирным овалом.

Фиг. 10 демонстрирует конформационные изменения в петле 60s триптазы, обнаруженные в сложной структуре. Val60c и Val90 (показаны в виде стиков) создают гидрофобный карман для связывания Tyr173d с соседнего протомера как часть межбелкового взаимодействия в большой поверхности контакта тетрамерной триптазы. Обозначены протомеры триптазы в конформации тетрамера. Триптаза, связанная с Fab hu31A.v11, накладывается на один протомер тетрамерного комплекса. Конформация Val60c изменяется, когда Fab hu31A.v11 связывается, что создает стерическое препятствие, которое, как ожидается, не позволит Tyr173d связываться с этим карманом (все остатки триптазы пронумерованы по системе нумерации химотрипсиногена).

Фиг. 11 демонстрирует конформационные изменения в петле 30s триптазы, локализованные на малой поверхности контакта, обнаруженные в сложной структуре после связывания с hu31A.v11.

Фиг. 12А представляет собой визуализацию кристаллической структуры тетрамера триптазы WT в комплексе с четырьмя huE104.v1 Fab. Протромеры триптазы обозначены в соответствии с буквенной маркировкой или протомерами (см. Pereira et al. Nature 392: 306-311, 1998).

Фиг. 12В представляет собой визуализацию эффекта связывания huE104.v1 на малой поверхности контакта тетрамера триптазы, оцененного по водород-дейтериевому обмену (HDX).

Фиг. 13 представляет собой график, демонстрирующий результаты фармакокинетического (ФK) анализа гуманизированных антител против триптазы huE104.v2 и hu31A.v11, каждое из которых вводили с помощью внутривенной (в/в) инъекции мышам C57BL/6 в дозе 1 мг/кг или 10 мг/кг. График демонстрирует концентрацию антител против триптазы (мкг/мл) как функцию времени (дни). Приведенные результаты получены от трех животных.

Фиг. 14 представляет собой график, демонстрирующий результаты ФK анализа гуманизированных антител против триптазы huE104.v2 и hu31A.v11 по сравнению с контрольным антителом IgG4 против gD. Каждое антитело вводили внутривенно (в/в) в дозе 30 мг/кг яванским макакам (cyno). График демонстрирует концентрацию антител против триптазы (мкг/мл) как функцию времени (дни).

Фиг. 15 представляет собой схематическую диаграмму анализов для измерения количества активной триптазы (левая панель) и общей триптазы (правая панель) в образце. Обозначены мономеры и тетрамеры триптазы. На левой панели добавлен ингибитор трипсина из соевых бобов (SBTI). Затем к образцу, содержащему триптазу (например, к жидкости бронхоальвеолярного лаважа (BAL)) добавляли типовый биотинилированный зонд, ориентированный на активность (АВР), для мечения активной триптазы. Мечение останавливали добавлением типового низкомолекулярного ингибитора G02849855 (например, BMS-262084, Sutton et al. Bioorg. Med. Chem. Lett. 12: 3229-33,2002, Qian et al., J. Org. Chem. 2002, 67: 3595-3600). Антитело hu31A.v11 добавляли для диссоциации тетрамеров триптазы. Меченую триптазу затем детектировали в иммуноферментном анализе (ИФА) с применением пероксидазы хрена, конъюгированной со стрептавидином. В анализе общей триптазы, hu31A.v11 добавляли к образцу для диссоциации тетрамеров триптазы в образце. Количество триптазы затем определяли с помощью ИФА.

Фиг. 16 демонстрирует результаты анализа активной триптазы, выполненного на образцах BAL, полученных от яванских макаков, которым вводили антитело против триптазы hu31A.v11 путем внутривенной (в/в) инъекции в дозе 30 мг/кг. Верхняя панель демонстрирует схематическую диаграмму экспериментального протокола.

Фиг. 17 представляет собой схематическую диаграмму, демонстрирующую экспериментальный протокол модели заражения яванского макака аскаридой, описанный в Примере 6.

На Фиг. 18А и 18В представлены графики, демонстрирующие результаты анализа активной триптазы (Фиг. 18А) и анализа общей триптазы (Фиг. 18В), проведенных на BAL, полученном от отдельных животных в эксперименте из заражением яванского макака аскаридой, описанном в Примере 6.

На Фиг. 18С представлен график, демонстрирующий результаты анализа общей триптазы для определения количества общей триптазы в секрете слизистой оболочки носа (MLF), полученной путем назосорбции с применением синтетической абсорбционной матрицы (SAM) от отдельных животных в эксперименте из заражением яванского макака аскаридой, описанном в Примере 6.

На Фиг. 19 представлен график, демонстрирующий, что введение антитела hu31A.v11 против триптазы ингибировало IgE-опосредованную пассивную системную анафилаксию у мышей, получавших человеческое антитело. После введения IgE у мышей, получавших антитело hu31A.v11 против триптазы, наблюдалось улучшенное поддержание температуры тела по сравнению с мышами, получавшими контрольное антитело против gD. *** Р < 0,0001 (двусторонний критерий Стьюдента (Т test)).

Подробное изложение вариантов осуществления данного изобретения

I. Определения

В данном контексте термин "около" относится к обычному диапазону ошибок для соответствующего значения, хорошо известному специалисту в данной области техники. Ссылка на "около" для значения или параметра включает в себя (и описывает) варианты осуществления данного изобретения, которые направлены на это значение или параметр как таковой.

В контексте данного документа "акцепторная каркасная область человека" представляет собой каркасную область, которая содержит аминокислотную последовательность каркасной области вариабельного домена легкой цепи (VL) или каркасной области вариабельного домена тяжелой цепи (VH), которая получена из каркасной области иммуноглобулина человека или консенсусной каркасной области человека, как определено ниже. Акцепторная каркасная область человека, "полученная из" каркасной области иммуноглобулина человека или консенсусной каркасной области человека, может содержать такую же самую аминокислотную последовательность, как и указанная, или может содержать изменения в аминокислотной последовательности. В некоторых вариантах осуществления данного изобретения количество аминокислотных изменений составляет 10 или менее, 9 или менее, 8 или менее, 7 или менее, 6 или менее, 5 или менее, 4 или менее, 3 или менее, или 2 или менее. В некоторых вариантах осуществления данного изобретения последовательность акцепторной каркасной области VL человека идентична последовательности каркасной области VL иммуноглобулина человека или консенсусной последовательности каркасной области человека.

Термин "аффинность" относится к силе общей суммы нековалентных взаимодействий между одиночным сайтом связывания молекулы (например, антитела) и ее партнера по связыванию (например, антигена). Если не указано иное, в данном документе термин "аффинность связывания" относится к присущей молекуле аффинности связывания, отражающей взаимодействие между членами пары связывающихся компонентов (например, антителом и антигеном) при их соотношении 1:1. Аффинность молекулы X к ее партнеру по связыванию Y в целом можно представить в виде константы диссоциации (KD). Аффинность можно измерить с помощью общепринятых способов, известных в данной области техники, в том числе тех, которые описаны в данном документе. Конкретные иллюстративные и типовые варианты осуществления настоящего изобретения, связанные с измерением аффинности связывания, описаны в данном документе.

Фраза "KD измеряют с помощью анализа поверхностного плазмонного резонанса", при применении в контексте формулы изобретения означает, что KD измеряют согласно способу, описанному в примере 1 (A) (vii), в котором измеряют кинетические параметры для связывания антител против триптазы с мономером триптазы бета 1 человека, например, His6-меченым мономером триптазы, как продемонстрировано в SEQ ID NO: 128, который самопроизвольно не образует тетрамер триптазы. Для указанного анализа можно применять BIAcore® Т200 или эквивалентное устройство. Вкратце, сенсорные чипы BIAcore® серии S СМ5 (или эквивалентные сенсорные чипы) иммобилизовали моноклональным мышиным антителом против IgG (Fc) человека, и антитела против триптазы впоследствии захватывались в проточной ячейке. Последовательные 3-кратные разведения мономера триптазы бета 1 человека вводили при скорости потока 30 мкл/мин. Каждый образец анализировали с 3-минутной ассоциацией и 10-минутной диссоциацией. Анализ проводили при 25°С. После каждого введения чип регенерировали с применением 3 М MdCl2. Ответ связывания корректируют путем вычитания единиц ответа (RU) из проточной ячейки, захватывающей нерелевантный IgG с аналогичной плотностью. Для анализа кинетики применяли модель Ленгмюра 1:1 одновременной подгонки kon и koff.

Антитело "с созревшей аффинностью" представляет собой антитело, содержащее одно или большее количество изменений в одной или большем количестве HVR и/или каркасных областей, приводящих к усилению аффинности антитела к антигену по сравнению с исходным антителом, не содержащим указанного(ых) изменения(й). Предпочтительные антитела с созревшей аффинностью будут иметь наномолярные или даже пикомолярные значения аффинности к антигену-мишени. Антитела с созревшой аффинностью получают с помощью методик, известных в данной области техники. Например, в работе Marks et al., Bio/Technology 10: 779-783 (1992) описано созревание аффинности путем перетасовки доменов VH и VL. Случайный мутагенез HVR и/или каркасных остатков описан, например, в: Barbas et al. Proc. Natl. Acad. Sci. USA 91: 3809-3813, 1994; Schier et al. Gene 169: 147-155, 1995; Yelton et al. J. Immunol. 155: 1994-2004, 1995; Jackson et al. J. Immunol. 154(7): 3310-3319, 1995; и Hawkins et al. J. Mol. Biol. 226: 889-896, 1992.

Термин "антитело" в данном документе применяется в самом широком смысле и охватывает различные структуры антител, включая, но не ограничиваясь ими, моноклональные антитела, поликлональные антитела, мультиспецифические антитела (например, биспецифические антитела) и фрагменты антител, при условии, что они проявляют требуемую антигенсвязывающую активность.

В данном контексте термин "триптаза" относится к любой нативной триптазе из любого источника, относящегося к позвоночным, включая млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), если не указано иное. Триптаза также известна в данной области техники как триптаза тучных клеток, протеаза тучных клеток II, триптаза кожи, триптаза легких, триптаза гипофиза, нейтральная протеиназа тучных клеток и сериновая протеиназа тучных клеток II. Термин «триптаза» охватывает триптазу альфа (кодируется у человека с помощью TPSAB1), триптазу бета (кодируется у человека с помощью TPSAB1 и TPSB2; см. ниже), триптазу дельта (кодируется у человека с помощью TPSD1), триптазу гамма (кодируется у человека с помощью TPSG1) и триптазу эпсилон (кодируется у человека с помощью PRSS22). Белки триптазы альфа, бета и гамма являются растворимыми, тогда как белки триптазы эпсилон являются заякоренными в мембрану. Триптаза бета и триптаза гамма являются активными сериновыми протеазами, хотя они имеют разные специфичности. Белки триптазы альфа и триптазы дельта являются в значительной степени неактивными протеазами, поскольку они имеют остатки в критическом положении, которые отличаются от типичных активных сериновых протеаз. Типовые последовательности полноразмерного белка триптазы альфа можно найти в NCBI GenBank, номер доступа ACZ98910. 1 (SEQ ID NO: 118). Типовые последовательности полноразмерного белка триптазы гамма можно найти под номером доступа Q9NRR2 в Uniprot или под номерами доступа Q9NRR2.3, AAF03695.1, NP_036599.3 или AAF76457.1 в GenBank. Типовые последовательности полноразмерного белка триптазы дельта можно найти под номером доступа Q9BZJ3 в Uniprot или под номером доступа NP_036349.1 в GenBank. Несколько генов триптазы сгруппированы на хромосоме человека 16р13.3. Термин охватывает "полноразмерную" необработанную триптазу, а также любую форму триптазы, которая является результатом обработки в клетке. Триптаза бета является основной триптазой, экспрессируемой в тучных клетках, тогда как триптаза альфа является основной триптазой, экспрессируемой в базофилах. Триптаза альфа и триптаза бета обычно включают лидерную последовательность приблизительно из 30 аминокислот и каталитическую последовательность из приблизительно 245 аминокислот (см., например, Schwartz, Immunol. Allergy Clin. N. Am. 26: 451-463, 2006).

В данном контексте термин "триптаза бета" относится к любой нативной триптазе бета из любого источника, относящегося к позвоночным, включая млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), если не указано иное. Триптаза бета представляет собой сериновую протеазу, которая является основным компонентом секреторных гранул тучных клеток. В данном контексте указанный термин включает триптазу бета 1 (кодируемую геном TPSAB1, который также кодирует триптазу альфа 1), триптазу бета 2 (кодируемую геном TPSB2) и триптазу бета 3 (также кодируемую геном TPSB2). Типовая последовательность триптазы бета 1 человека продемонстрирована в SEQ ID NO: 71 (см. также номер доступа NP_003285.2 в GenBank). Типовая последовательность бета 2 триптазы человека продемонстрирована в SEQ ID NO: 72 (см. также номер доступа No. AAD13876.1 в GenBank). Типовая последовательность триптазы бета 3 человека продемонстрирована в SEQ ID NO: 73 (см. также номер доступа NP_077078.5 в GenBank). Термин триптаза бета охватывает "полноразмерную" необработанную триптазу бета, а также триптазу бета, полученную в результате посттрансляционных модификаций, включая протеолитическую обработку. Предполагается, что полноразмерная триптаза бета обрабатывается в два протеолитических этапа. Во-первых, происходит автокаталитическое межмолекулярное расщепление в R-3, особенно при кислотном рН и в присутствии полианиона (например, гепарина или декстрансульфата). Затем оставшийся про-дипептид удаляется (по всей вероятности, с помощью дипептидилпептидазы I). Для полноразмерной триптазы бета 1 человека со ссылкой на SEQ ID NO: 71 ниже, подчеркнутые аминокислотные остатки соответствуют нативной лидерной последовательности, а выделенные жирным шрифтом и серым цветом аминокислотные остатки соответствуют про-домену, который расщепляется с образованием зрелого белка (см., например, Sakai et al. J Clin. Invest. 97: 988-995, 1996)

Зрелая, ферментативно активная триптаза бета обычно представляет собой гомотетрамер или гетеротетрамер, хотя сообщалось об активном мономере (см., например, Fukuoka et al. J. Immunol. 176: 3165, 2006). Субъединицы тетрамера триптазы бета удерживаются вместе посредством гидрофобных и полярных взаимодействий между субъединицами и стабилизируются полианионами (в частности, гепарином и декстрансульфатом). Термин триптаза может относиться к тетрамеру триптазы или мономеру триптазы. Типовый последовательности для зрелой триптазы бета 1, бета 2 и бета 3 человека продемонстрированы в SEQ ID NO: 97, SEQ ID NO: 116, и SEQ ID NO: 117 соответственно. Активный сайт каждой субъединицы обращен в центральную пору тетрамера, которая измеряется приблизительно в 50×30 ангстрем (см., например, Pereira et al. Nature 392: 306-311, 1998). Размер центральной поры обычно ограничивает доступ активных сайтов ингибиторами. Типовые субстраты триптазы бета включают, но не ограничиваются ими, PAR2, С3, фибриноген, фибронектин и кининоген.

Термины "антитело против триптазы", "антитело, которое связывается с триптазой" и "антитело, которое специфически связывает триптазу" относятся к антителу, которое способно связывать триптазу с достаточной аффинностью, чтобы антитело можно было применять в качестве диагностического и/или терапевтического агента для нацеливания на триптазу. В одном варианте осуществления данного изобретения степень связывания антитела против триптазы с неродственным, не являющимся триптазой белком составляет менее около 10% от связывания антитела с триптазой согласно данным, например, радиоиммуноанализа (РИА). В некоторых вариантах осуществления данного изобретения антитело, которое связывается с триптазой, имеет константу диссоциации (KD) ≤ 1 мкМ, ≤ 100 нМ, ≤ 10 nM, ≤ 1 нМ, ≤ 0,1 нМ, ≤ 0,01 нМ, или ≤ 0,001 нМ (например, 10-8 М или менее, например, от 10-8 М до 10-13 М, например, от 10-9 М до 10-13 М). В определенных вариантах осуществления данного изобретения антитело против триптазы связывается с эпитопом триптазы, который является консервативным для триптазы от разных видов.

"Антитело, которое связывается с тем же эпитопом", что и эталонное антитело, относится к антителу, которое связывается с перекрывающимся набором аминокислотных остатков антигена по сравнению с эталонным антителом или блокирует связывание эталонного антитела с его антигеном в конкурентном анализе на 50% или более, на 60% или более, на 70% или более, на 80% или более, или на 90% или более. В некоторых вариантах осуществления данного изобретения указанный набор аминокислотных остатков, с которыми связывается антитело, может полностью перекрываться или частично перекрываться с набором аминокислотных остатков, с которыми связывается эталонное антитело. В некоторых вариантах осуществления данного изобретения антитело, которое связывается с тем же эпитопом, что и эталонное антитело, блокирует связывание эталонного антитела с его антигеном в конкурентном анализе на 50% или более, на 60% или более, на 70% или более, на 80% или более, или на 90% или более, и наоборот, эталонное антитело блокирует связывание антитела с его антигеном в конкурентном анализе на 50% или более, на 60% или более, на 70% или более, на 80% или более, или на 90% или более. Типовый конкурентный анализ представлен в данном документе.

Термин "определяется с помощью анализа связывания эпитопа" в контексте формулы изобретения означает, что антитело связывается с тем же эпитопом и/или конкурирует за связывание с эталонным антителом против триптазы (например, hu31A.v11 или huE104.v2) с применением анализа связывания эпитопа OCTET®, так как описано в Разделе С Примера 3. Вкратце, белок мономера триптазы бета 1 человека биотинилируется на остатке Lys путем взаимодействия с NHS-PEG4-биотином. Биотинилированный мономер разбавляют до 5 мкг/мл в кинетическом буфере (ForteBio, Inc.) и иммобилизируют на наконечниках стрептавидинового сенсора (ForteBio, Inc.). После этапа иммобилизации, сенсоры, иммобилизованные триптазой бета 1 человека, насыщают первым антителом, разбавленным до 10-20 мкг/мл, с последующим связыванием со вторым антителом, разведенным до 2,5 мкг/мл. Температура проведения таких анализов связывания эпитопа составляет 30°С. Сигнал связывания вторым антителом подразумевает, что два антитела могут связывать антиген одновременно на разных неперекрывающихся эпитопах, тогда как сигнал связывания не подразумевает, что антитела связывают антиген на общем эпитопе. В некоторых случаях наблюдается частичный сигнал от второго антитела (то есть сигнал является более слабым по сравнению с сигналом, наблюдаемым, если первое антитело не было добавлено, но более высоким по сравнению с фоновым сигналом), что означает частичное перекрытие эпитопов.

"Фрагменты антитела" содержат часть интактного антитела, предпочтительно антигенсвязывающую или вариабельную область интактного антитела. Примеры фрагментов антител включают Fab-, Fab'-, F(ab')2-, и Fv-фрагменты; диатела; линейные антитела (см. патент США №5613870, Пример 2; Zapata et al. Protein Eng. 8(10): 1057-1062, 1995); молекулы одноцепочечных антител; и мультиспецифичные антитела, образованные из фрагментов антител.

При расщеплении антител папаином образуются два идентичных антигенсвязывающих фрагмента, называемые "Fab"-фрагментами, и остаточный "Fc"-фрагмент, название которого отражает его способность легко кристаллизироваться. Fab-фрагмент состоит из целой L-цепи вместе с доменом вариабельной области Н-цепи (VH), и первым константным доменом из одной тяжелой цепи (СН1). Обработка антитела пепсином дает один большой F(ab')2-фрагмент, который условно соответствует двум дисульфидносвязанным Fab-фрагментам, имеющим дивалентную антигенсвязывающую активность и по-прежнему способным к перекрестному связыванию антигена. Fab'-фрагменты отличаются от Fab-фрагментов тем, что имеют несколько дополнительных остатков на карбоксильном конце СН1-домена, включая один или большее количество цистеинов из шарнирной области антитела. В данном документе Fab'-SH представляет собой обозначение Fab', в котором цистеиновый(е) остаток(и) константных доменов несет свободную тиольную группу. F(ab')2-фрагменты антител первоначально получали в виде пар Fab'-фрагментов, между которыми находятся шарнирные остатки цистеина. Известны также другие варианты химического связывания фрагментов антител.

Термин "Fc-область" в данном документе применяется для обозначения С-концевой области тяжелой цепи иммуноглобулина, которая содержит по меньшей мере часть константной области. Указанный термин включает Fc-области с нативными последовательностями и вариантные Fc-области. В одном варианте осуществления данного изобретения Fc-область тяжелой цепи IgG человека продолжается от Cys226 или от Pro230 до карбоксильного конца тяжелой цепи. Однако Fc-область может содержать или не содержать С-концевой лизин (Lys447). Если в данном документе не указано иное, нумерация аминокислотных остатков в Fc-области или константной области соответствует системе нумерации EU, также называемой индексом EU, как это описано в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.

"Fv" состоит из димера одного домена вариабельного участка тяжелой цепи и одного вариабельного участка домена легкой цепи, соединенных жесткой нековалентной связью. В результате фолдинга этих двух доменов получаются шесть гипервариабельных петель (по 3 петли из Н- и L-цепи), которые вносят аминокислотные остатки для связывания антигена и придают антигенсвязывающую специфичность антителу. В то же время даже один вариабельный домен (или половина Fv, содержащая только три Hs, специфичные к антигену) обладает способностью распознавать и связывать антиген, хотя часто с более низкой аффинностью, чем целый сайт связывания.

"Одноцепочечные Fv", также имеющие аббревиатуру "sFv" или "scFv", представляют собой фрагменты антител, которые содержат домены VH и VL антител, связанные в одну полипептидную цепь. Предпочтительно полипептид sFv дополнительно содержит полипептидный линкер между доменами VH и VL, который дает возможность sFv формировать желаемую структуру для связывания антигена. Для обзора sFv, см. публикацию Pluckthun в The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).

Термин "диатела" относится к малым фрагментам антител, полученным конструированием sFv-фрагментов (см. предыдущий параграф) с короткими линкерами (около 5-10 остатков) между доменами VH и VL, с целью обеспечения спаривания V-доменов между цепями, но не внутри цепей, в результате чего образуется двухвалентный фрагмент, то есть фрагмент, имеющий два антигенсвязывающих сайта. Биспецифические антитела представляют собой гетеродимеры двух "кроссоверных" sFv-фрагментов, в которых домены VH и VL двух антител представлены на разных полипептидных цепях. Диатела описаны более подробно, например, в ЕР 404,097; WO 93/11161; и в Hollinger et al. Proc. Natl. Acad. Sci. USA 90: 6444-6448, 1993.

Под "связывающим доменом" следует понимать часть соединения или молекулы, которая специфически связывается с целевым эпитопом, антигеном, лигандом или рецептором. Связывающие домены включают, но не ограничиваются этим, антитела (например, моноклональные, поликлональные, рекомбинантные, гуманизированные и химерные антитела), фрагменты антител или их части (например, Fab-фрагменты, Fab'2-фрагменты, scFv-антитела, SMIP, домены антител, диатела, мини-антитела, scFv-Fc, аффитела, нанотела и VH- и/или VL-домены антител), рецепторы, лиганды, аптамеры и другие молекулы, имеющие определенного партнера по связыванию.

"Блокирующее" антитело или "антагонистическое" антитело представляет собой антитело, ингибирующее или уменьшающее биологическую активность антигена, с которым оно связывается. Определенные блокирующие антитела или антагонистические антитела по существу или полностью ингибируют биологическую активность антигена. В некоторых вариантах осуществления данного изобретения указанная активность может представлять собой ферментативную активность триптазы, например, активность протеазы. В других случаях указанная активность может представлять собой опосредованную триптазой стимуляцию пролиферации и/или коллаген-зависимое сокращение клеток гладких мышц бронхов. В других случаях указанная активность может представлять собой высвобождение гистамина тучными клетками (например, высвобождение гистамина, запускаемое IgE, и/или высвобождение гистамина, запускаемое триптазой). Антитело по данному изобретению может ингибировать биологическую активность триптазы на по меньшей мере около 1%, около 5%, около 10%, около 20%, около 25%, около 30%, около 35%, около 40%, около 45%, около 50%, около 55%, около 60%, около 65%, около 70%, около 75%, около 80%, около 85%, около 90%, около 95%, около 96%, около 97%, около 98%, около 99% или около 100%.

Термин "что определяется с помощью ферментативного анализа триптазы бета человека с применением синтетического пептида S-2288 в качестве субстрата" в контексте формулы изобретения означает, что ингибирующую активность измеряют в соответствии с анализом, описанным в Примере 1 (A)(viii)(a). Вкратце, активный фермент рекомбинантного тетрамера триптазы бета 1 человека разводят до 0,75 нМ в буфере TNH (200 мМ Трис, 150 мМ NaCl, 0,1 мг/мл гепарина, 0,01% TRITON™ Х-100, рН 8,0) и объединяют в соотношении 1:1 с антителами против триптазы (разведенными в PBS) на 384-луночных планшетах. Планшеты инкубируют в течение 1 ч при температуре окружающей среды при осторожном перемешивании. Колориметрический субстрат S-2288 (Chromogenix, Part No. 82-0852-39) или эквивалентный субстрат разбавляют до 1200 мкМ в буфере TNH и добавляют на планшет. Конечные концентрации в лунках составляют 400 мкМ S-2288, 0,25 нМ рекомбинантного тетрамера триптазы бета 1 человека, 66 мкг/мл гепарина и от 0,10 до 222 нМ антитела против триптазы. Планшеты инкубируют в течение 40 мин при температуре окружающей среды с осторожным перемешиванием, а затем считывают при А405. Значение IC50 антител против триптазы определяют по четырехпараметрическому соответствию их соответствующих кривых.

"Класс" антитела относится к типу константного домена или константной области его тяжелой цепи. Существует пять основных классов антител: IgA, IgD, IgE, IgG и IgM, и некоторые из них дополнительно делятся на подклассы (изотипы), например, IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2. Константные домены тяжелой цепи, соответствующие различным классам иммуноглобулинов, называются α, δ, ε, γ и μ, соответственно.

"Эффекторные "функции антитела" относятся к биологическим видам активности, присущим Fc-области (Fc-область с нативной последовательностью или вариант аминокислотной последовательности Fc-области) антитела, и изменяются в зависимости от изотипа антитела. Примеры эффекторных функций антитела включают в себя: Связывание C1q и комплементзависимую цитотоксичность; связывание с рецептором Fc; антителозависимую клеточно-опосредованную цитотоксичность (АЗКЦ); фагоцитоз; снижение уровня экспрессии рецепторов клеточной поверхности (например, рецептора В-клетки) и активацию В-клетки.

"Антителозависимая клеточно-опосредованная цитотоксичность" или "АЗКЦ" относится к форме цитотоксичности, при которой секретируемый Ig связывается с Fc-рецепторами (FcR), присутствующими на некоторых цитотоксических клетках (например, клетки естественные киллеры (NK), нейтрофилы и макрофаги), позволяя этим цитотоксическим эффекторным клеткам специфически связываться с антигенсодержащей клеткой-мишенью и впоследствии уничтожать клетку-мишень цитотоксинами. Антитела "вооружают" цитотоксические клетки и являются абсолютно необходимыми для такого уничтожения. Первичные клетки для опосредования АЗКЦ, NK-клетки, экспрессируют только FcγRIII, тогда как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. Сводная информация об экспрессии FcR на кроветворных клетках приведена в Таблице 3 на странице 464 в публикации Ravetch et al. Annu. Rev. Immunol. 9: 457-492, 1991. Для оценки активности АЗКЦ молекулы, представляющей интерес, можно провести анализ АЗКЦ in vitro, такой как описанный в патенте в патенте США №5500362 или 5821337. В качестве эффекторных клеток в таких анализах можно применять мононуклеарные клетки периферической крови (МКПК) и клетки-натуральные киллеры (NK). В альтернативном или дополнительном варианте активность АЗКЦ молекулы, представляющей интерес, можно оценить in vivo, например, на модели животного, например, как описано в публикации Clynes et al., PNAS USA 95: 652-656 (1998). Термин "Fc-рецептор" или "FcR" описывает рецептор, который связывается с Fc-областью антитела. Предпочтительным FcR является FcR человека с нативной последовательностью. Более того, предпочтительный FcR представляет собой рецептор, который связывает антитело IgG (гамма рецептор) и включает рецепторы подклассов FcγRI, FcγRII и FcγRIII, включая аллельные варианты и альтернативно сплайсированные формы этих рецепторов. Рецепторы FcγRII включают FcγRIIA ("активирующий рецептор") и FcγRIIB ("ингибирующий рецептор"), которые имеют сходные аминокислотные последовательности, которые отличаются главным образом по их цитоплазматическим доменам. Активирующий рецептор FcγRIIA содержит иммунорецепторный тирозиновый ингибирующий мотив (ITAM) в его цитоплазматическом домене. Ингибирующий рецептор FcγRIIB содержит в своем цитоплазматическом домене иммунорецепторный ингибирующий мотив на основе тирозина (ITIM) (см. обзор М. in Annu. Rev. Immunol. 15: 203-234, 1997). Обзор относительно FcR содержится, например, в Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-492, 1991; Capel et al. Immunomethods 4: 25-34, 1994; and de Haas et al. J. Lab. Clin. Med. 126: 330-41, 1995. Другие FcR, включая те, которые будут определены в дальнейшем, в данном документе охватываются термином "FcR". Указанный термин также включает неонатальный рецептор FcRn, который отвечает за перенос материнских IgG к плоду (см., например, Guyer et al. J. Immunol. 117: 587, 1976; и Kim et al. J. Immunol. 24: 249, 1994).

"Эффекторные клетки человека" представляют собой лейкоциты, которые экспрессируют один или большее количество FcR и выполняют эффекторные функции. Предпочтительно, указанные клетки экспрессируют по меньшей мере FcγRIII и выполняют эффекторную функцию АЗКЦ. Примеры лейкоцитов человека, которые медиируют АЗКЦ, включают мононуклеарные клетки периферийной крови (МКПК), естественные клетки-киллеры (NK), моноциты, цитотоксические Т-клетки и нейтрофилы; предпочтительными являются МКПК и NK-клетки. Эффекторные клетки могут быть выделены из нативного источника, например, из крови.

"Комплементзависимая цитотоксичность" или "CDC" относится к лизису клетки-мишени в присутствии комплемента. Активация классического пути комплемента инициируется связыванием первого компонента системы комплемента (C1q) с антителами (соответствующего подкласса), которые связаны с их родственным антигеном. Для оценки активации комплемента может быть проведен анализ КЗЦ, например, как описано в публикации Gazzano-Santoro et al. J. Immunol. Methods 202: 163, 1996

"Эпитоп" представляет собой часть антигена, с которой селективно связывается антитело. Для полипептидного антигена, линейный эпитоп может представлять собой пептидную часть, составляющую около 4-15 (например, 4, 5, 6, 7, 8, 9, 10, 11, 12) аминокислотных остатков. Нелинейный конформационный эпитоп может содержать остатки полипептидной последовательности, расположенные в непосредственной близости в трехмерной (3D) структуре белка. В некоторых вариантах осуществления данного изобретения указанный эпитоп содержит аминокислоты, которые находятся в пределах 4 ангстремов (А) от любого атома антитела. В некоторых вариантах осуществления данного изобретения указанный эпитоп содержит аминокислоты протомера триптазы, которые находятся в пределах 4 от любого атома партнера Fab. В определенных вариантах осуществления данного изобретения указанный эпитоп содержит аминокислоты, которые находятся в пределах 3,5 , 3 , 2,5 или 2 от атома антитела. Аминокислотные остатки антитела, которые связываются с антигеном (то есть паратопом), могут быть определены, например, путем определения кристаллической структуры антитела в комплексе с антигеном или путем осуществления водород/дейтериевого обмена.

Термин "эпитоп определяется с помощью модели по рентгеновской кристаллографии," в контексте формулы изобретения означает, что атом аминокислотного остатка триптазы (например, остатка триптазы бета 1 человека) находится в пределах 4 от любого атома антитела против триптазы (например, любого антитела против триптазы, описанного в данном документе, например, hu31A.v11 или huE104.v2) в модели по рентгеновской кристаллографии, например, как описано в Примере 3. В различных вариантах осуществления данного изобретения модель рентгеновской кристаллографии имеет разрешение около 3,5 или менее, около 3 или менее, около 2,5 или менее, около 2,15 или менее или около 2 или менее.

В данном контексте термины "полноразмерное антитело", "интактное антитело" и "целое антитело" являются взаимозаменяемыми и относятся к антителу, структура которого по существу аналогична структуре нативного антитела, или которое содержит тяжелые цепи, содержащие Fc-область, описанную в данном документе.

"Антитело человека" представляет собой антитело, обладающее аминокислотной последовательностью, которая соответствует последовательности антитела, продуцированного организмом человека и/или полученной с помощью любой методики создания антител человека. Это определение антитела человека, в частности, не включает гуманизированное антитело, содержащее антигенсвязывающие остатки нечеловеческого происхождения.

"Консенсусная каркасная область человека" представляет собой каркасную область, которая содержит наиболее часто встречающиеся аминокислотные остатки при выборе последовательностей каркасной области VL или VH иммуноглобулина человека. Как правило, последовательности VL или VH иммуноглобулина человека выбирают из последовательностей подгруппы вариабельных доменов. Как правило, подгруппа последовательностей представляет собой подгруппу по классификации Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD, vols. 1-3, 1991. В одном варианте осуществления данного изобретения, для VL, указанная подгруппа представляет собой подгруппу каппа III или каппа IV, как описано в публикации Kabat et al., выше. В одном варианте осуществления данного изобретения, для VH, указанная подгруппа представляет собой подгруппу III, как описано в публикации Kabat et al., выше.

"Гуманизированные"» формы нечеловеческих антител (например, грызуна) представляют собой химерные антитела, которые содержат минимальную последовательность, полученную из нечеловеческого иммуноглобулина. В большинстве случаев, гуманизированные антитела представляют собой иммуноглобулины человека (реципиентное антитело), в которых остатки гипервариабельного участка реципиента заменены остатками гипервариабельного участка нечеловеческого вида (донорское антитело), такого как мышь, крыса, кролик или примат кроме человека, имеющего требуемую специфичность, аффинность и характеристику антитела. В некоторых примерах остатки каркасной области (FR) иммуноглобулина человека заменены на соответствующие остатки иммуноглобулина нечеловеческого происхождения. Кроме того, гуманизированные антитела могут содержать остатки, не встречающиеся в реципиентном антителе или донорском антителе. Эти модификации осуществляют для дополнительного улучшения характеристик антител. В большинстве случаев, гуманизированное антитело будет содержать по существу все или по меньшей мере один, а обычно два вариабельных домена, в которых все или по существу все гипервариабельные петли соответствуют гипервариабельным петлям иммуноглобулина нечеловеческого происхождения, а все или по существу все FR представляют собой те, которые относятся к последовательности иммуноглобулина, человека. Гуманизированное антитело, необязательно, также содержит по меньшей мере участок константной области иммуноглобулина (Fc), как правило, иммуноглобулина человека. Для получения дополнительной информации см. Jones et al., Nature 321. 522-525, 1986; Riechmann et al. Nature 332: 323-329, 1988; и Presta, Curr. Op. Struct. Biol. 2: 593-596, 1992.

"Иммуноконъюгат" представляет собой антитело, конъюгированное с одной или большим количеством гетерологичных молекул (молекулами), включая, но не ограничиваясь этим, цитотоксический агент.

Термин "выделенный" при применении для описания различных антител, охарактеризованных в данном документе, означает антитело, которое было идентифицировано, отделено и/или выделено из клетки или культуры клеток, в которой оно экспрессировалось. Контаминирующие компоненты природного окружения представляют собой вещества, которые как правило могут препятствовать диагностическому или терапевтическому применению полипептида, и могут включать ферменты, гормоны и другие белковые или небелковые растворенные вещества. В некоторых вариантах осуществления данного изобретения антитело является очищенным до более чем 95% или 99% чистоты, определяемой, например, с помощью электрофореза (например, электрофорез в полиакриламидном геле с додецилсульфатом натрия (ДСН-ПААГ-электрофорез), изоэлектрическое фокусирование (ИЭФ), капиллярный электрофорез) или способов хроматографии (например, ионообменная или обращенно-фазовая ВЭЖХ). Обзор способов оценки чистоты антител см., например, в публикации Flatman et al. J. Chromatogr. В 848: 79-87, 2007. В предпочтительных вариантах осуществления данного изобретения указанное антитело будет очищено (1) до степени, достаточной для получения по меньшей мере 15 остатков на N-концевой или внутренней аминокислотной последовательности при помощи секвенатора с вращающимся стаканом или (2) до гомогенности, полученной методом ДСН-ПААГ электрофореза в невосстанавливающих или восстанавливающих условиях, с применением окрашивания Кумасси синим или, предпочтительно, серебром. Выделенное антитело включает антитела, полученные in situ внутри рекомбинантных клеток, поскольку по меньшей мере один компонент из полипептидного природного окружения будет отсутствовать. В то же время, выделенный полипептид получают по меньшей мере в результате одного этапа очистки.

В данном контексте термин "моноклональное антитело" относится к антителу, полученному из популяции по существу гомогенных антител, то есть отдельные антитела, составляющие популяцию, являются идентичными и/или связывают один и тот же эпитоп на антигене, за исключением возможных вариантных антител, например, содержащих мутации природного происхождения или возникающих в процессе изготовления препарата моноклонального антитела, при этом такие вариантные антитела, как правило, присутствуют в незначительных количествах. В отличие от препаратов поликлональных антител, которые обычно содержат различные антитела против различных детерминант (эпитопов), каждое моноклональное антитело из препарата моноклонального антитела направлено против одной детерминанты антигена. Определение "моноклональное" указывает на характеристику антитела, полученного по существу из однородной популяции антител, и не должно быть истолковано как необходимость получения антитела каким-либо конкретным способом. Например, моноклональные антитела для применения согласно данному изобретению можно получить с помощью различных технологий, включая, без ограничений, метод гибридомы, методы рекомбинантных ДНК, методы фагового дисплея и методы с использованием трансгенных животных, полностью или частично содержащих локусы иммуноглобулина человека, причем такие способы и другие типовые способы получения моноклональных антител описаны в данном документе. В определенных вариантах осуществления данного изобретения термин "моноклональное антитело" охватывает биспецифичные антитела.

Термин "двухвалентное антитело" относится к антителу, которое имеет два сайта связывания с антигеном. Двухвалентное антитело может быть, без ограничения, в формате IgG или в F(ab')2 формате.

Термин "мультиспецифическое антитело»" применяется в самом широком смысле и охватывает антитело, которое связывается с двумя или большим количеством детерминант или эпитопов на одном антигене или двумя или большим количеством детерминант или эпитопов на более чем одном антигене. Такие мультиспецифические антитела включают, но не ограничиваются ими, полноразмерные антитела, антитела, обладающие двумя или большим количеством доменов VL и VH, фрагменты антител, такие как Fab, Fv, dsFv, scFv, диатела, биспецифические диатела и триатела, фрагменты антител, которые ковалентно или нековалентно связаны. "Полиэпитопная специфичность" предполагает способность специфически связываться с двумя или большим количеством разных эпитопов на одной и той же или отличающейся мишени(ях). В определенных вариантах осуществления данного изобретения мультиспецифическое антитело представляет собой биспецифическое антитело. "Двойная специфичность" или "биспецифичность" относится к способности специфически связываться с двумя разными эпитопами на одной и той же или отличающейся мишени(ях). Однако, в отличие от биспецифических антител, антитела с двойной специфичностью имеют два антигенсвязывающих плеча, которые являются идентичными по аминокислотной последовательности и каждое Fab-плечо способно к распознаванию двух антигенов. Двойная специфичность дает возможность антителам взаимодействовать с высокой аффинностью с двумя разными антигенами как одна молекула Fab или IgG. Согласно одному варианту осуществления данного изобретения мультиспецифическое антитело связывается с каждым эпитопом с аффинностью от 5 мкМ до 0,001 пМ, от 3 мкМ до 0,001 пМ, от 1 мкМ до 0,001 пМ, от 0,5 мкМ до 0,001 пМ или от 0,1 мкМ до 0,001 пМ. Термин "моноспецифический" относится к способности связывать только один эпитоп.

Термин "голое антитело" относится к антителу, неконъюгированному с гетерологичной группой (например, цитотоксической группой) или радиоактивной меткой. Указанное голое антитело может присутствовать в фармацевтической композиции.

Применительно к связыванию антитела с молекулой-мишенью, термин "связывает" или "связывание" или "специфическое связывание" или "специфически связывается с" или является "специфическим к" конкретному полипептиду или эпитопу на конкретной полипептидной мишени означает связывание, которое измеряемо отличается от неспецифического взаимодействия. Специфическое связывание можно измерить, например, путем определения связывания молекулы по сравнению со связыванием контрольной молекулы. Например, специфическое связывание можно определить с помощью конкурентного анализа с контрольной молекулой, которая является подобной с мишенью, например, с избытком немеченой мишени. В этом случае, специфическое связывание имеет место, если связывание меченой мишени с зондом конкурентно ингибируется избытком немеченой мишени. В данном контексте термин "специфическое связывание" или "специфически связывается с" или является "специфичным для" конкретного полипептида или эпитопа на конкретной полипептидной мишени, может описывать, например, молекулу, характеризующуюся значением KD для мишени, составляющим 10-4 М или ниже, в альтернативном варианте 10-5 М или ниже, в альтернативном варианте 10-6 М или ниже, в альтернативном варианте 10-7 М или ниже, в альтернативном варианте 10-8 М или ниже, в альтернативном варианте 10-9 М или ниже, в альтернативном варианте 10-10 М или ниже, в альтернативном варианте 10-11 М или ниже, в альтернативном варианте 10-12 М или ниже, или значение KD в диапазоне от 10-4 М до 10-6 М или от 10-6 М до 10-10 М или от 10-7 М до 10-9 М. Как будет понятно специалисту в данной области техники, значения аффинности и KD связаны обратной зависимостью. Высокая аффинность для антигена измеряется низким значением KD. В одном варианте осуществления данного изобретения термин "специфическое связывание" относится к связыванию, при котором молекула связывается с конкретным полипептидом или эпитопом на конкретном полипептиде без значительного связывания с любым другим полипептидом или эпитопом полипептида.

Под термином "паратоп" следует понимать часть антитела, которая связывает эпитоп антигена. Как правило, паратоп представляет собой область из около 15-22 аминокислотных остатков Fv-области антитела и может содержать аминокислоты из цепей VH и VL антитела.

Термин "вариабельный" относится к тому факту, что среди антител некоторые сегменты вариабельных доменов сильно различаются по последовательностям. Вариабельный или "V"-домен опосредует связывание антигена и определяет специфичность конкретного антитела к его конкретному антигену. В то же время вариабельность не является равномерно распределенной на промежутке из 110 аминокислот вариабельных доменов. Вместо этого V-области состоят из относительно инвариантных фрагментов, называемых каркасными областями (FR), состоящих из 15-30 аминокислот, разделенных более короткими областями чрезвычайной вариабельности, называемыми "гипервариабельными областями", каждая из которых имеет длину 9-12 аминокислот. В данном контексте термин "гипервариабельная область", относится к аминокислотным остаткам антитела, которые отвечают за связывания антигена. Гипервариабельная область, как правило, содержит аминокислотные остатки, например, из примерно около 24-34 (L1), 50-56 (L2) и 89-97 (L3) остатков в VL и примерно около 26-35 (Н1), 49-65 (Н2) и 95-102 (Н3) остатков в VH (в одном варианте осуществления данного изобретения Н1 составляет примерно около 31-35 остатков); Kabat et al. выше), и/или содержит те остатки из "гипервариабельной петли" (например, остатки 26-32 (L1), 50-52 (L2) и 91-96 (L3) в VL и 26-32 (Н1), 53-55 (Н2) и 96-101 (Н3) в VH; Chothia et al. J. Mol. Biol. 196: 901-917, 1987. Каждый из вариабельных доменов нативных тяжелых и легких цепей содержит четыре FR, преимущественно принимающих конфигурацию бета-листа и соединенных тремя гипервариабельными областями, образующими петли, соединяющие структуры бета-листа, а в некоторых случаях - являющиеся структуры бета-листа. Гипервариабельные области каждой цепи объединены друг с другом в непосредственной близости с помощью FR и, вместе с гипервариабельными областями другой цепи, участвуют в образовании антигенсвязывающего сайта антител (см. Kabat et al. выше), Соответственно, последовательности HVR и FR в составе VH (или VL), как правило, появляются в следующей последовательности: FR1-Н1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4. Константные домены не принимают непосредственного участия в связывании антитела с антигеном, однако проявляют различные эффекторные функции, например, участие антитела в антителозависимой клеточно-опосредованной цитотоксичности (АЗКЦ).

Термин "нумерация остатков вариабельных доменов по Кабату" или "нумерация положений аминокислот по Кабату" и их вариации, относятся к системе нумерации, применяемой для вариабельных доменов тяжелой цепи или вариабельных доменов легкой цепи компиляции антител в Kabat et al., выше. При применении этой системы нумерации конкретная линейная аминокислотная последовательность может содержать меньшее количество аминокислот или дополнительные аминокислоты, соответствующие укорачиванию или вставке в FR или HVR вариабельного домена. Например, вариабельный домен тяжелой цепи может включать вставку одной аминокислоты (остаток 52а согласно нумерации Кабата) после остатка 52 Н2 и вставленные остатки (например, остатки 82а, 82b и 82с и т.д. согласно нумерации Кабата) после остатка 82 тяжелой цепи FR. Нумерация остатков по Кабату может быть определена для данного антитела при выравнивании в областях гомологии последовательности антитела с помощью "стандартной" последовательности, нумерованной по Кабату.

Система нумерации по Кабату обычно применяется для названия остатка в вариабельном домене (приблизительно остатки 1-107 легкой цепи и остатки 1-113 тяжелой цепи) (например, Kabat et al. выше). Как правило, "система нумерации EU" или "индекс EU" применяется, когда речь идет об остатке в константной области тяжелой цепи иммуноглобулина (например, индекс EU, описанный в Kabat et al., выше). "Индекс EU согласно нумерации Кабата" относится к нумерации EU остатков антитела IgG1 человека. Если в данном документе не указано иное, ссылки на номера остатков в вариабельном домене антител означают нумерацию остатков согласно системе нумерации Кабата. Если в данном документе не указано иное, ссылки на номера остатков в константном домене антител означают нумерацию остатков согласно системе нумерации EU (например, см. предварительную заявку США №60/640323, Фигуры для нумерации EU).

"Нарушение" или "заболевание" представляет собой любое патологическое состояние, при котором было бы полезным лечение антителом (например, любое антитело против триптазы, описанное в данном документе). Этот термин охватывает хронические и острые нарушения или заболевания, включая те патологические состояния, которые увеличивают предрасположенность млекопитающего к рассматриваемому нарушению. В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение, аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение, лимфоцитарное нарушение или нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или патологической ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение. В некоторых примерах нарушение может представлять собой нарушение, ассоциированное с триптазой, или нарушение, опосредованное триптазой.

В данном контексте термины "нарушение, ассоциированное с триптазой" и "нарушение, опосредованное триптазой" относятся к любому нарушению или патологическому состоянию, опосредованному или ассоциированному с триптазой. В некоторых вариантах осуществления данного изобретения, нарушения, ассоциированные с триптазой, являются ассоциированными с избыточными уровнями или активностью триптазы, при которых из-за повышенных уровней или активности триптазы локально и/или системно в организме могут проявляться атипичные симптомы.

В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой персистирующую хроническую тяжелую астму с острыми проявлениями ухудшающихся симптомов (обострений или вспышек), которые могут быть опасными для жизни. В некоторых вариантах осуществления данного изобретения астма представляет собой атопическую (также известную как аллергическую) астму, неаллергическую астму (например, часто обусловленную инфицированием респираторным вирусом (например, вирусом гриппа, парагриппа, риновирусом, метапневмовирусом человека и респираторно-синцитиальным вирусом) или вдыхаемым раздражителем (загрязнители воздуха, дым, частицы дизельного топлива, летучие химические вещества и газы в помещении или на открытом воздухе, или даже на холодном сухом воздухе).

В некоторых вариантах осуществления данного изобретения астма представляет собой интермитирующую или вызванную физической нагрузкой астму, астму, обусловленную коротким или длительным первичным или вторичным воздействием «дыма» (обычно сигарет, сигар, трубок), вдыханием или "курением электронных сигарет" (табак, марихуана или другие подобные вещества), или астму, обусловленную недавним приемом аспирина или родственных НПВП. В некоторых вариантах осуществления данного изобретения астма представляет собой легкую астму, или нелеченую кортикостероидами астму, недавно диагностированную и нелеченую астму, или астму, не требующую до этого длительного применения ингаляционных топических или системных стероидов для контроля симптомов (кашель, хрипение, одышка/удушье или боль в грудной клетке). В некоторых вариантах осуществления данного изобретения астма представляет собой хроническую астму, резистентную к кортикостероидам астму, рефрактерную к кортикостероидам астму, астмой, неконтролируемую приемом кортикостероидов или других препаратов, разработанных для контроля хронической астмы.

В некоторых вариантах осуществления данного изобретения астма представляет собой астму от средней до тяжелой степени тяжести. В определенных вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2. В некоторых вариантах осуществления данного изобретения астма представляет собой тяжелую астму. В некоторых вариантах осуществления данного изобретения астма представляет собой атопическую астму, аллергическую астму, неаллергическую астму (например, обусловленную инфекцией и/или респираторно-синцитиальным вирусом (RSV)), астму, вызванную физическими нагрузками, астму, чувствительную/обостряющуюся при приеме аспирина, легкую астму, астму от средней до тяжелой степени тяжести, астму, не леченную кортикостероидами, хроническую астму, резистентную к кортикостероидам астму, рефрактерную к кортикостероидам астму, недавно диагностированную и не леченную астму, астму, вызванную курением, и астму, не контролируемую приемом кортикостероидов. В некоторых вариантах осуществления данного изобретения астма представляет собой астму, обусловленную Т-хелперными лимфоцитами типа 2 (Th2), или астму с высоким уровнем Т-хелперных лимфоцитов типа 2 (Th2), или астму, индуцируемую Т-хелперными лимфоцитами типа 2 (Т2). В некоторых вариантах осуществления данного изобретения астма представляет собой эозинофильную астму. В некоторых вариантах осуществления данного изобретения астма представляет собой аллергическую астму. В некоторых вариантах осуществления данного изобретения индивидуум был определен как положительный относительно эозинофильного воспаления (EIP). См., WO 2015/061441. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем периостина (например, с уровнем периостина, составляющим по меньшей мере около 20 нг/мл, 25 нг/мл или 50 нг/мл сыворотки). В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким количеством эозинофилов (например, по меньшей мере около 150, 200, 250, 300, 350, 400 эозинофилов/мл крови). В определенных вариантах осуществления данного изобретения астма представляет собой астму с низким уровнем Th2, или астму, не индуцируемую Th2. В некоторых вариантах осуществления данного изобретения индивидуум был определен как отрицательный относительно эозинофильного воспаления (EIN). См., WO 2015/061441. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с низким уровнем периостина (например, с уровнем периостина, составляющим менее чем около 20 нг/мл сыворотки). В некоторых вариантах осуществления данного изобретения астма представляет собой астму с низким количеством эозинофилов (например, менее чем около 150 эозинофов/мл крови).

В данном контексте термин "астма с высоким уровнем Th2" относится к астме, которая характеризуется высокими уровнями одного или большего количества цитокинов, связанных с клетками Th2, например, IL13, IL4, IL9, IL5, или которая характеризуется воспалением, ассоциированным с цитокинами Th2. В определенных вариантах осуществления данного изобретения термин "астма с высоким уровнем Th2" может применяться взаимозаменяемо с термином "астма с высоким уровнем эозинофилов". В определенных вариантах осуществления данного изобретения астма с высоким уровнем Th2 представляет собой астму, индуцируемую Th2. В некоторых вариантах осуществления данного изобретения пациент с астмой был определен как положительный относительно эозинофильного воспаления (EIP). См., например, публикацию международной патентной заявки № WO 2015/061441, которая в полном объеме включена в данный документ посредством ссылки. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет повышенные уровни по меньшей мере одного из генов эозинофильного профиля по сравнению с контрольным или эталонным уровнем. См. WO 2015/061441. В определенных вариантах осуществления данного изобретения астма с высоким уровнем Th2 представляет собой астмус высоким уровнем периостина. В некоторых вариантах осуществления данного изобретения индивидуум имеет высокий уровень периостина в сыворотке. В некоторых вариантах осуществления данного изобретения индивидууму восемнадцать лет или больше. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет повышенный уровень периостина в сыворотке по сравнению с контрольным или эталонным уровнем. В определенных вариантах осуществления данного изобретения контрольный или эталонный уровень представляет собой средний уровень периостина в популяции. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет уровень периостина в сыворотке 20 нг/мл или выше. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет уровень периостина в сыворотке 25 нг/мл или выше. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет уровень периостина в сыворотке 50 нг/мл или выше. В определенных вариантах осуществления данного изобретения контрольный или эталонный уровень периостина в сыворотке составляет 20 нг/мл, 25 нг/мл или 50 нг/мл. В определенных вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем эозинофилов. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет повышенное количество эозинофилов по сравнению с контрольным или эталонным уровнем. В определенных вариантах осуществления данного изобретения контрольный или эталонный уровень представляет собой средний уровень в популяции. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 150 /в мкл крови или больше. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 200/мкл крови или больше. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 250/мкл крови или больше. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 300/мкл крови или больше. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 350/мкл крови или больше. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 400/мкл крови или больше. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 450/мкл крови или больше. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 500/мкл крови или больше. В определенных предпочтительных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет 300/мкл крови или больше. В некоторых вариантах осуществления данного изобретения эозинофилы представляют собой эозинофилы периферической крови. В некоторых вариантах осуществления данного изобретения эозинофилы представляют собой эозинофилы мокроты. В определенных вариантах осуществления данного изобретения у индивидуума наблюдается повышенный уровень FeNO (фракция оксида азота в выдыхаемом воздухе) и/или повышенный уровень IgE. Например, в некоторых случаях у индивидуума наблюдается уровень FeNO выше около 250 частей на миллиард (ppb), выше около 275 ppb, выше около 300 ppb, выше около 325 ppb, выше около 325 ppb или выше около 350 ppb. В некоторых случаях индивидуум имеет уровень IgE, который является выше 50 МЕ/мл.

В данном контексте термин "астма с низким уровнем Th2" или "астма с невысоким уровнем Th2" относится к астме, которая характеризуется низкими уровнями одного или большего количества цитокинов, связанных с клетками Th2, например, IL13, IL4, IL9, IL5, или которая характеризуется воспалением, не ассоциированным с цитокинами Th2. В определенных вариантах осуществления данного изобретения термин "астма с низким уровнем Th2" может применяться взаимозаменяемо с термином "астма с низким уровнем эозинофилов". В некоторых вариантах осуществления данного изобретения пациент с астмой был определен как отрицательный относительно эозинофильного воспаления (EIP). См., например, WO 2015/061441. В определенных вариантах осуществления данного изобретения астма с низким уровнем Th2 представляет собой астму, индуцируемую Th17. В определенных вариантах осуществления данного изобретения астма с низким уровнем Th2 представляет собой астму с низким уровнем периостина. В некоторых вариантах осуществления данного изобретения индивидууму восемнадцать лет или больше. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет пониженный уровень периостина в сыворотке по сравнению с контрольным или эталонным уровнем. В определенных вариантах осуществления данного изобретения контрольный или эталонный уровень представляет собой средний уровень периостина в популяции. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет уровень периостина в сыворотке 20 нг/мл или выше. В определенных вариантах осуществления данного изобретения астма представляет собой астму с низким уровнем эозинофилов. В определенных вариантах осуществления данного изобретения установлено, что индивидуум имеет пониженное количество эозинофилов по сравнению с контрольным или эталонным уровнем. В определенных вариантах осуществления данного изобретения контрольный или эталонный уровень представляет собой средний уровень в популяции. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет менее чем 150/мкл крови. В определенных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет менее чем 100/мкл крови. В определенных предпочтительных вариантах осуществления данного изобретения установлено, что у индивидуума количество эозинофилов составляет менее чем 300/мкл крови.

В некоторых вариантах осуществления данного изобретения аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой эзофагит (например, эозинофильный эзофагит), аллергический ринит, неаллергический ринит, риносинусит с полипами, полипы носа, бронхит, хроническую пневмонию, аллергический бронхолегочный аспергиллез, воспаление дыхательных путей, аллергический ринит, бронхоэктазию и/или хронический бронхит.

В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой артрит. В некоторых вариантах осуществления данного изобретения артрит представляет собой ревматоидный артрит. В некоторых вариантах осуществления данного изобретения артрит представляет собой остеоартрит, ревматоидный артрит, ювенильный артрит, ювенильный ревматоидный артрит, ранний артрит, полиартикулярный ревматоидный артрит, ревматоидный артрит с системным началом, энтеропатический артрит, реактивный артрит, псориатический артрит и/или артрит в результате травмы.

В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой воспалительное состояние желудочно-кишечного тракта.. В некоторых вариантах осуществления данного изобретения воспалительное состояние желудочно-кишечного тракта представляет собой ВЗК (воспалительное заболевание кишечника), язвенный колит (ЯК), болезнь Крона (БК), колит (например, колит, вызванный воздействием окружающей среды (например, вызванный или ассоциированный со способом лечения, таким как как химиотерапия, лучевая терапия и т.д.)), инфекционный колит, ишемический колит, коллагеновый или лимфоцитарный колит, некротический энтероколит, колит при таких патологических состояниях, как хроническое гранулематозное заболевание или целиакия, пищевые аллергии, гастрит, гастроэнтерит, инфекционный гастрит или энтероколит (например, хронический активный гастрит с инфекцией Helicobacter pylori), эзофагит и другие формы воспаления желудочно-кишечного тракта, вызванные инфекционным агентом, или неуточненный колит.

В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой воспалительное состояние желудочно-кишечного тракта. В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой ВЗК (воспалительное заболевание кишечника). В некоторых вариантах осуществления данного изобретения воспалительное заболевание кишечника представляет собой язвенный колит (ЯК) или болезнь Крона (БК). В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой колит (например, колит, вызванный воздействием окружающей среды (например, вызванный или ассоциированный со способом лечения, таким как как химиотерапия, лучевая терапия и т.д.)), инфекционный колит, ишемический колит, коллагеновый или лимфоцитарный колит, некротический энтероколит, колит при таких патологических состояниях, как хроническое гранулематозное заболевание или целиакия, пищевые аллергии, гастрит, гастроэнтерит, инфекционный гастрит или энтероколит (например, хронический активный гастрит с инфекцией Helicobacter pylori) и другие формы воспаления желудочно-кишечного тракта, вызванные инфекционным агентом, или неуточненный колит. В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой язвенный колит (ЯК) или болезнь Крона (БК). В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой язвенный колит (ЯК). В некоторых вариантах осуществления данного изобретения язвенный колит представляет собой дистальный колит от легкой до средней степени тяжести. В некоторых вариантах осуществления данного изобретения язвенный колит представляет собой обширный колит от легкой до средней степени тяжести. В некоторых вариантах осуществления данного изобретения язвенный колит представляет собой тяжелый колит. В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой болезнь Крона (БК). В некоторых вариантах осуществления данного изобретения болезнь Крона находится в стадии острого заболевания. В некоторых вариантах осуществления данного изобретения болезнь Крона находится в стадии индуцированной клинической ремиссии. В некоторых вариантах осуществления данного изобретения болезнь Крона находится в стадии поддержания ответа/ремиссии. В некоторых вариантах осуществления данного изобретения болезнь Крона характеризуется легкой или средней степенью тяжести. В некоторых вариантах осуществления данного изобретения болезнь Крона характеризуется средней или тяжелой степенью тяжести. В некоторых вариантах осуществления данного изобретения болезнь Крона является тяжелым/фулиминантным заболеванием. В некоторых вариантах осуществления данного изобретения болезнь Крона характеризуется поражением подвздошной кишки, подвздошной и ободочной кишки, или ободочной кишки.

В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение, или лимфоцитарное нарушение или нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или патологической ткани (таких как тучные клетки, макрофаги или лимфоциты) или стромальных клеток (таких как фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий) представляют собой волчанку или системную красную волчанку (СКВ), или одно или большее количество органоспецифических проявлений волчанки (например, волчаночный нефрит (ВН), поражающий почку, или внепочечная волчанка (ВПВ), поражающая кровь и/или лимфоидные органы (лимфатические узлы, селезенку, тимус и связанные с ними лимфатические сосуды), и/или суставы, и/или другие органы, но не обязательно почки).

В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение связано с сепсисом и/или травмой, ВИЧ-инфекцией или является идиопатическим (неизвестной этиологии), например, ANCA-ассоциированные васкулиты (AAV), гранулематоз с полиангиитом (ранее известным как гранулематоз Вегенера), болезнь Бехчета, сердечно-сосудистые заболевания, эозинофильный бронхит, синдром Рейтера, синдром SEA (серонегативность, энтезопатия, синдром артропатии), анкилозирующий спондилит, дерматомиозит, склеродермия, например, системная склеродермия, также называемая системным склерозом, васкулит (например, гигантоклеточный артериит (ГКА), также называемый височным артериитом, краниальным артериитом или болезнью Гортона), миозит, полимиозит, дерматомиозит, узелковый полиартериит, артериит, ревматическая полимиалгия, саркоидоз, первичный билиарный склероз, склерозирующий холангит, синдром Шегрена, псориаз, бляшечный псориаз, каплевидный псориаз, псориаз сгибательных поверхностей и кожных складок, пустулезный псориаз, эритродермический псориаз, дерматит, атопический дерматит, пузырчатка, например, пузырчатка обыкновенная, атеросклероз, волчанка, болезнь Стилла, миастения, глютеновая болезнь, рассеянный склероз (PC) рецидивирующе-ремиттирующего (РРРС) или первично-прогрессирующего (ППРС) или вторично-прогрессирующего (ВПРС) подтипов, болезнь Гийена-Барре, сахарный диабет I типа (СД1т), или СД инсулинозависимого (ИЗСД) или юношеского типа, тиреоидит (например, болезнь Грейвса), целиакия, синдром Шурга-Штрауса, синдром миалгии, гиперэозинофильный синдром, отечные реакции в том числе эпизодический ангионевротический отек, гельминтозы, онхоциркозный дерматит, эозинофильный эзофагит, эозинофильный энтерит, эозинофильный колит, синдром обструктивного апноэ во сне, эндомиокардиальная фиброз, болезнь Аддисона, болезнь и феномен Рейно, аутоиммунный гепатит, болезнь «трансплантат против хозяина» (БТПХ), или отторжения трансплантата.

В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой воспалительное заболевание кожи. В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой атопический дерматит или онхоцеркальный дерматит. В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК или ХСК).

В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой фиброзное нарушение. В некоторых вариантах осуществления данного изобретения фиброзные нарушения включают фиброз легких, фиброз печени (например, фиброз, ассоциированный с циррозом печени (например, цирроз печени, вызванный алкоголем, цирроз печени, вызванный вирусом, цирроз печени после гепатита С и первичный билиарный цирроз), шистосомоз, холангит (например, склерозирующий холангит) и аутоиммунно-индуцированный гепатит), фиброз почки (например, тубулоинтерстициальный фиброз, склеродермия, диабетический нефрит и клубочковый нефрит), фиброз кожи (например, склеродермия, гипертрофические и келоидные рубцы, нефрогенная фиброзирующая дерматопатия и ожоги), миелофиброз, нейрофиброматоз, фиброма, фиброз кишечника и фиброзные спайки в результате хирургических процедур), фиброз сердца (например, фиброз, ассоциированный с инфарктом миокарда), фиброз сосудов (например, фиброз, ассоциированный с артериальным рестенозом после ангиопластики и атеросклерозом), фиброз глаза (например, фиброз, ассоциированный с операцией по поводу катаракты, пролиферативная витреоретинопатия и ретроорбитальный фиброз), а также фиброз костного мозга (например, идиопатический миелофиброз и миелофиброз, индуцированный лекарственными средствами). Фиброз может быть органоспецифичным или системным (например, системный склероз и фиброз, ассоциированный с БТПХ). В некоторых вариантах осуществления данного изобретения указанное фиброзное нарушение представляет собой легочной фиброз. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой фиброзирующую интерстициальную пневмонию. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой идиопатический легочной фиброз (ИЛФ), также известный как криптогенный фиброзирующий альвеолит. В некоторых вариантах осуществления данного изобретения ИЛФ характеризуется I стадией по шкале GAP (пол, возраст и физиология). В некоторых вариантах осуществления данного изобретения ИЛФ характеризуется II стадией по шкале GAP. В некоторых вариантах осуществления данного изобретения ИЛФ характеризуется III стадией по шкале GAP. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой спорадический ИЛФ. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой семейный легочный фиброз. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой комбинированный легочный фиброз и эмфизему. В некоторых вариантах осуществления легочный фиброз ассоциирован с одним или большим количеством из следующих патологических состояний: обычная интерстициальная пневмония; идиопатическая интерстициальная пневмония; десквамативная интерстициальная пневмония; респираторный бронхиолит - интерстициальное легочное заболевание; острая интерстициальная пневмония; неспецифическая интерстициальная пневмония; саркоидоз; криптогенная организующая пневмония; эозинофильная пневмония; инфекция; воздействие профессиональных или экологических факторов; курение сигарет; интерстициальное легочное заболевание, индуцированное лекарственными средствами или радиацией; интерстициальное легочное заболевание, ассоциированное с ревматическим заболеванием; лимфоидная интерстициальная пневмония; плевропульмональный фиброэластоз; гистиоцитоз клеток Лангерганса; системный склероз интерстициальное легочное заболевание; синдром Германского-Пудлака; а также теломеропатия.

В некоторых вариантах осуществления данного изобретения указанное легочное нарушение, аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой хроническое обструктивное заболевание легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией А согласно Глобальной инициативе по хроническому обструктивному заболеванию легких (GOLD). В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией В согласно GOLD. В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией С согласно GOLD. В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией D согласно GOLD. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой хронический бронхит. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой эмфизему. В некоторых вариантах осуществления данного изобретения эмфизема представляет собой проксимальную ацинарную, панацинарную или дистальную ацинарную эмфизему. В некоторых вариантах осуществления данного изобретения эмфизема представляет собой эмфизему, индуцированную курением сигарет. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоциированным с воздействием пыли, химических паров и/или загрязнением воздуха. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоиированным с нарушением развития легких. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой хроническую обструктивную астму. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоциированным с дефицитом альфа-1 антитрипсина. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоциированным с кладой Е ингибитора сериновой протеазы, представителя 2 (SERPINE2) разрушения. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с персистирующим системным воспалением. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с высоким уровнем эозинофилов или Т-хелперов типа 2 (ТН2). В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с персистирующей бактериальной колонизацией. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с частыми обострениями. В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой перекрестный синдром ХОЗЛ-астма (ПСХА). В некоторых вариантах осуществления данного изобретения ПСХА представляет собой ПСХА с преобладанием эозинофилов, ПСХА с преобладанием нейтрофилов, ПСХА смешанного типа или ПСХА без воспаления (пауцигранулоцитарный). В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой перекрестный синдром ХОЗЛ - обструктивное апноэ во сне (ОАС).

Вышеприведенный перечень не является всеобъемлющим и специалисту в данной области техники должно быть понятно, что любое заболевание или нарушение может попадать в различные категории.

Термин "вкладыш в упаковку" относится к инструкциям, которые обычно вкладывают в коммерческие упаковки терапевтических продуктов, и которые содержат информацию о показаниях, применении, дозах, введении, комбинированной терапии, противопоказаниях и/или предупреждениях, касающихся применения таких терапевтических продуктов.

Термины "фармацевтический состав" и "фармацевтическая композиция" применяются взаимозаменяемо и относятся к препарату, который находится в такой форме, которая обеспечивает эффективную биологическую активность содержащегося в ней активного ингредиента, и не содержит других компонентов, обладающих неприемлемой токсичностью для субъекта, которому будут вводить указанный состав. Такие составы являются стерильными. В предпочтительном варианте осуществления данного изобретения указанную фармацевтическую композицию или фармацевтический состав вводят субъекту-человеку.

"Стерильный" фармацевтический состав является асептическим или не содержащим или по существу не содержащим каких-либо живых микроорганизмов и их спор.

"Стабильный" фармацевтический состав представляет собой такой состав, в котором белок (например, антитело, такое как антитело против триптазы) по существу сохраняет свою физическую стабильность и/или химическую стабильность и/или биологическую активность при хранении. Предпочтительно, состав по существу сохраняет свою физическую и химическую стабильность, а также свою биологическую активность при хранении. В большинстве случаев период хранения выбирают на основе предполагаемого срока годности состава. Различные аналитические методы для измерения стабильности белка доступны в данной области техники и рассматриваются в публикации Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993), например. Стабильность можно измерить при выбранной степени воздействия света и/или температуры в течение выбранного периода времени. Стабильность можно оценить качественно и/или количественно с помощью различных способов, включая оценку образования агрегатов (например, с помощью эксклюзионной хроматографии по размеру, путем измерения мутности и/или при визуальном контроле); оценку образования АФК (например, с использованием анализа легкого стресса или анализа стресса ААРН); окисления специфических аминокислотных остатков белка (например, остатка Trp и/или остатка Met моноклонального антитела); с помощью оценки неоднородности заряда с помощью катионообменной хроматографии, изоэлектрического фокусирования изображения (icIEF) или капиллярно-зонального электрофореза; анализа аминоконцевой или карбоксиконцевой последовательности; масс-спектрометрического анализа; анализа методом ДСН-ПААГ-электрофореза для сравнения восстановленного и интактного антитела; анализа пептидной карты (например, триптический или LYS-C); оценки биологической активности или функции целевого связывания белка (например, антигенсвязывающей функции антитела); и тому подобное. Нестабильность может включать в себя одно или большее количество из следующих состояний: агрегация, дезамидирование (например, дезамидирование Asn), окисление (например, окисление Met и/или окисления Trp), изомеризация (например, изомеризация Asp), отсечение/гидролиз/фрагментация (например, фрагментация шарнирной области), образование сукцинимида, неспаренный цистеин(ы), удлинение N-конца, процессирование С-конца, различия гликозилирования и тому подобное.

Антитело (например, антитело против триптазы) "сохраняет свою физическую стабильность" в фармацевтическом составе, если оно совсем не проявляет или проявляет очень мало признаков агрегации, осаждения, фрагментации и/или денатурации при визуальном исследовании цвета и/или прозрачности, или при измерении с помощью рассеяния УФ-света или с помощью эксклюзионной хроматографии.

Антитело (например, антитело против триптазы) "сохраняет свою химическую стабильность" в фармацевтическом составе, если химическая стабильность в данный момент времени такова, что считается, что антитело все еще сохраняет свою биологическую активность, как определено ниже. Химическая стабильность может быть оценена путем обнаружения и количественного определения химически измененных форм антитела. Химическое изменение может включать окисление белка, которое можно оценить, например, с помощью картирования триптического пептида, высокоэффективной жидкостной хроматографии с обращенной фазой (ВЭЖХ) и жидкостной хроматографии-масс-спектрометрии (ЖХ/МС). Другие типы химического изменения включают изменение заряда антитела, которое можно оценить, например, с помощью ионообменной хроматографии или icIEF.

Антитело (например, антитело против триптазы) "сохраняет свою биологическую активность" в фармацевтическом составе, если биологическая активность антитела в данный момент времени находится в пределах около 20% (например, в пределах около 10%) от биологической активности, проявляемой во время приготовления фармацевтического состава (в пределах погрешностей анализа), что определяется, например, в анализе связывания антигена или анализе ингибирования in vitro для моноклонального антитела (например, моноклонального антитела против триптазы). В некоторых вариантах осуществления данного изобретения биологическая активность антитела в данное время находится в пределах около 25%, около 30%, около 35%, около 40%, около 45%, около 50% от биологической активности, проявляемой во время приготовления фармацевтического состава.

В данном контексте термин "биологическая активность" антитела (например, антитела против триптазы) относится к способности антитела связываться со своей мишенью, например, к способности моноклонального антитела связываться с антигеном. Кроме того, термин "биологическая активность" может включать биологический ответ, который может быть измерен in vitro или in vivo. Такая активность может быть антагонистической или агонистической.

Белок (например, антитело, такое как антитело против триптазы), который "восприимчив к окислению", представляет собой белок, содержащий один или большее количество остатков, которые, как было установлено, являются склонными к окислению, таких как, но не ограничиваясь ими, метионин (Met), цистеин (Cys), гистидин (His), триптофан (Trp) и тирозин (Tyr). Например, аминокислота триптофан в Fab-части моноклонального антитела или аминокислота метион в Fc-части моноклонального антитела могут быть подвержены окислению.

Термин "процент окисления" относится к проценту антител в составе (например, фармацевтической композиции), которые являются окисленными на определенном аминокислотном остатке, например, остатке Trp (например, Trp100 в HVR-H3 hu31A.v11) или остатке Met. Процент окисления можно определить, например, с помощью масс-спектрометрического (МС) анализа одного или большего количества триптических пептидов, в которых находятся один или большее количество конкретных подверженных окислению аминокислотных остатков. В некоторых вариантах осуществления данного изобретения процент окисления Trp100 в HVR-H3 hu31A.v11 определяют по массе окисленного триптического пептида, в котором находится Trp 100, по отношению к массе всего (окисленного и не окисленного) триптического пептида, что определяется по данным МС анализа. Процент окисления можно определить, например, в течение 9 месяцев, 12 месяцев, 18 месяцев или двух лет от первоначальной продукции антитела или его фармацевтической композиции.

В данном контексте термин "определяется после стресс-теста ААРН" означает, что процент окисления на определенном аминокислотном остатке (например, на Trp100 в HVR-H3 hu31A.v11) определяют с помощью масс-спектрометрического анализа триптических пептидов после составления антитела в концентрации 150 мг/мл в 5 мМ ААРН в течение 25 часов при 40°C, например, как описано в Примере 5. Антитело, подвергнутое стресс-тесту, расщепляют трипсином, а расщепленные пептиды подвергают ультра-высокоэффективной жидкостной хроматографии и масс-спектрометрии высокого разрешения (УВЭЖХ-МСВР), чтобы определить процент окисления.

В данном контексте "буфер" относится к забуференному раствору, который противостоит изменениям рН благодаря действию его компонентов кислотно-основного конъюгата. Буфер по данному изобретению предпочтительно имеет рН в диапазоне от около 4,5 до около 8,0 (например, около 4,5, около 5, около 5,5, около 6, около 6,5, около 7, около 7,5 или около 8), например, около рН 5,5. Например, ацетат гистидина является примером буфера, который будет контролировать рН в этом диапазоне. Другим пригодным буфером является сукцинат аргинина и/или сукцинат гистидина.

"Консервант" представляет собой соединение, которое может быть необязательно включено в состав для существенного снижения бактериального действия в нем, таким образом, облегчая, например, получение многоцелевого состава. Примеры потенциальных консервантов включают в себя хлорид октадецилдиметилбензиламмония, хлорид гексаметония, хлорид бензалкония (смесь хлоридов алкилбензилдиметиламмония, в которых алкильные группы представляют собой соединения с длинной цепью) и хлорид бензетония. Другие типы консервантов включают в себя ароматические спирты, такие как фенол, бутил и бензиловый спирт; алкилпарабены, такие как метил или пропилпарабен; катехол; резорцин; циклогексанол; 3-пентанол и м-крезол. В одном варианте осуществления данного изобретения консервант в данном документе представляет собой бензиловый спирт.

В данном контексте термин "поверхностно-активное вещество" относится к поверхностно-активному агенту, предпочтительно неионогенному поверхностно-активному веществу. Примеры поверхностно-активных веществ в данном документе включают полисорбат (например, полисорбат 20 и полисорбат 80); полоксамер (например, полоксамер 188); TRITON®; додецилсульфат натрия (ДСН); лаурел сульфат натрия; октилгликозид натрия; лаурил-, миристил-, линолеил- или стеарилсульфобетаин; лаурил-, миристил-, линолеил- или стеарилсаркозин; линолеил-, миристил- или цетилбетаин; лауроамидопропил-, кокамидопропил-, линолеамидопропил-, миристамидопропил-, пальмидопропил- или изостеарамидопропилбетаин (например, лауроамидопропил); миристамидопропил-, пальмидопропил- или изостеарамидопропилдиметиламин; метилкокоил- или динатрийметилолеилтаурат; и серии MONAQUAT™ (Mona Industries, Inc., Paterson, N.J.); полиэтилгликоль, полипропилгликоль и сополимеры этилена и пропиленгликоля (например, блоксополимеры типа PLURONIC®, например PLURONIC® F-68); и тому подобное. В одном варианте осуществления данного изобретения поверхностно-активное вещество представляет собой полисорбат 20. В еще одном варианте осуществления данного изобретения поверхностно-активное вещество представляет собой полоксамер 188.

Термин "фармацевтически приемлемый носитель" относится к ингредиенту фармацевтического препарата, отличающемуся от активного ингредиента, который является нетоксичным для субъекта. Фармацевтически приемлемый носитель включает, но не ограничивается перечисленным, буфер, вспомогательное вещество, стабилизатор или консервант.

В контексте данной заявки термин "пролекарство" относится к прекурсорной или дериватизированной форме фармацевтически активного вещества, которая является менее цитотоксичной для опухолевых клеток по сравнению с исходным лекарственным средством и способна ферментативно активироваться или превращаться в более активную исходную форму. См., например, Wilman, "Prodrugs in Cancer Chemotherapy" Biochemical Society Transactions, 14, pp. 375-382, 615th Meeting Belfast (1986) и Stella et al. "Prodrugs: A Chemical Approach to Targeted Drug Delivery," Directed Drug Delivery, Borchardt et al. (ed.), pp. 247-267, Humana Press (1985). Пролекарства по данному изобретению включают, но не ограничиваются ими, фосфатсодержащие пролекарства, тиофосфатсодержащие пролекарства, сульфатсодержащие пролекарства, пептидсодержащие пролекарства, пролекарства, модифицированные D-аминокислотами, гликозилированные пролекарства, β-лактамсодержащие пролекарства, необязательно замещенные феноксиацетамидсодержащие пролекарства или необязательно замещенные фенилацетамидсодержащие пролекарства, 5-фторцитозин и другие 5-фторуридиновые пролекарства, которые могут быть превращены в более активный свободный цитотоксический препарат. Примеры цитотоксических препаратов, которые можно дириватизировать в пролекарственную форму для применения в данном изобретении, включают, но не ограничиваются ими, те химиотерапевтические агенты, которые описаны выше.

"Субъект" является позвоночным, предпочтительно млекопитающим, более предпочтительно человеком. Млекопитающие включают, но не ограничиваются ими, сельскохозяйственных животных (таких как коровы и овцы), спортивных животных, домашних животных (таких как кошки, собаки и лошади), приматов (например, людей и приматов, не являющихся людьми, таких как обезьяны (например, яванский макак)) и грызунов (например, мышей и крыс).

В данном контексте термин "введение" означает способ введения субъекту дозы соединения (например, антитела против триптазы по данному изобретению или дополнительного терапевтического агента) или композиции (например, фармацевтической композиции, например, фармацевтической композиции, включающей антитело против триптазы по данному изобретению, необязательно также включающеей дополнительный терапевтический агент, который может включать вспомогательное вещество, такое как антиоксидант (например, N-ацетилтриптофан и/или метионин)). Композиции, применяемые в описанных в данном документе способах, можно вводить, например, интравитреально, внутримышечно, внутривенно, интрадермально, чрескожно, внутриартериально, внутрибрюшинно, внутриочагово, интракраниально, внутрисуставно, внутрь простаты, внутриплеврально, интратрахеально, интратрахеально, интраназально, интравитреально, интравагинально, ректально, местно, внутриопухолево, перитонеально, подкожно, субконъюнктивально, интравезикулярно, мукозально, интраперикардиально, внутрипуповинно, интраокулярно, интраорбитально, перорально, местно, трансдермально, периокулярно, конъюнктивально, субтенонально, внутрикамерно, субретинально, ретробульбарно, внутриканально, путем ингаляции, путем инъекции, путем имплантации, путем инфузии, путем длительной инфузии, путем локализованной перфузии непосредственно через клетки-мишени, при помощи катетера, при помощи лаважа, в кремах или в липидных композициях. Композиции, используемые в описанных в данном документе способах, также можно вводить системно или местно. Способ введения может изменяться в зависимости от различных факторов (например, соединения или композиции для введения, степени тяжести патологического состояния, заболевания или нарушения, подлежащего лечению).

"Эффективное количество" или "терапевтически эффективное количество" агента, например антитела против триптазы или фармацевтического состава (например, фармацевтического состава, который включает антитело против триптазы, которое может включать вспомогательное вещество, такой как антиоксидант (например, N-ацетилтриптофан и/или метионин) относится к количеству, эффективному в дозировках и в течение периодов времени, необходимых для достижения желаемого терапевтического или профилактического результата. Терапевтически эффективное количество антитела или фрагмента антитела (например, антитела против триптазы) или его композиции может ослаблять или лечить нарушение или заболевание, или предотвращать, уменьшать, ослаблять или лечить симптомы, ассоциированные с нарушением или заболеванием.

В данном документе термин "лечение" (и его грамматические варианты, например, "лечить" или "воздействовать") относится к клиническому вмешательству при попытке изменить естественное течение заболевания у индивидуума, подвергаемого лечению, и может осуществляться для профилактики или в ходе клинического проявления патологии. Желательные эффекты лечения включают, но не ограничиваются ими, предотвращение возникновения или рецидива заболевания, ослабление симптомов, уменьшение каких-либо прямых или косвенных патологических последствий заболевания, предотвращение метастазирования, снижение скорости прогрессирования заболевания, улучшение или временное облегчение болезненного состояния, а также ремиссию или улучшение прогноза. В некоторых вариантах осуществления данного изобретения антитела согласно данному изобретению применяют для задержки развития заболевания или замедления прогрессирования заболевания. Пациент может успешно "лечиться" от астмы, если, например, после приема противоастматической терапии у указанного пациента наблюдается заметное и/или измеримое уменьшение или отсутствие одного или большего количества из следующих факторов: рецидивирующие хрипы, кашель, проблемы с дыханием, стеснение в грудной клетке, симптомы, которые возникают или ухудшаются ночью, симптомы, обусловленные холодным воздухом, физическими упражнениями или воздействием аллергенов.

В данном контексте термин "интерлейкин-5 (IL-5)" относится к любому нативному IL-5 из любого источника, относящегося к позвоночным, включая млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), если не указано иное. Термин охватывает "полноразмерный" необработанный IL-5, зрелый IL-5, а также любую форму IL-5, полученную в результате посттрансляционных модификаций. Термин также охватывает встречающиеся в природе варианты IL-5, такие как сплайсинговые варианты или аллельные варианты. Аминокислотную последовательность типового IL-5 можно найти, например, в UniProtKB под номером доступа Р05113.

Термин "антагонист связывания оси IL-5" относится к молекуле, которая снижает, блокирует, ингибирует, подавляет или нарушает сигнальную трансдукцию, возникающую из-за взаимодействия IL-5 с одним или большим количеством его партнеров по связыванию, таким как рецептор IL-5, альфа (IL5RA). Типовые антагонисты связывания оси IL-5, которые можно применять в способах по данному изобретению, включают, например, антагонисты связывания IL-5 (например, антитела против IL-5 (например, меполизумаб, бенрализумаб, и реслизумаб) и антагонисты связывания рецептора IL-5 (например, антитела против IL-5R)).

В данном контексте термин "интерлейкин-13 (IL-13)" относится к любому нативному IL-13 из любого источника, относящегося к позвоночным, включая млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), если не указано иное. IL-13 представляет собой цитокин, секретируемый многими типами клеток, включая клетки Т-хелперы типа 2 (Th2). Термин охватывает "полноразмерный" необработанный IL-13, зрелый IL-13, а также любую форму IL-13, полученную в результате посттрансляционных модификаций. Аминокислотную последовательность типового IL-13 человека можно найти, например, в UniProtKB под номером доступа Р35225.

Термин "антагонист связывания оси IL-13" относится к молекуле, которая снижает, блокирует, ингибирует, подавляет или нарушает сигнальную трансдукцию, возникающую из-за взаимодействия IL-13 с одним или большим количеством его партнеров по связыванию, таким как рецептор IL-4 альфа(IL4Rα), рецептор IL-13 альфа 1 (IL13RA1) и рецептор IL-13 альфа 2 (IL13RA2). Антагонисты связывания оси IL-13, включают антагонисты связывания IL-13 (например, антитела против IL-13, например, лебрикизумаб, 228В/С-1, 228А-4, 227-26, и 227-43 (см., например, патенты США №№7674459; 8067199; 8088618; 8318160; и 8734797) и антагонисты связывания рецептора IL-13 (например, антитело против IL4Rα, антитело против IL13RA1 или антитело против IL13RA2).

В данном контексте термин "интерлейкин-17 (IL-17)" относится к любому нативному IL-17 из любого источника, относящегося к позвоночным, включая млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), если не указано иное и включает в себя представителей семейства IL-17А, IL-17B, IL-17C, IL-17D, IL-17E и IL-17F. Термин охватывает "полноразмерный" необработанный IL-17, зрелый IL-17, а также любую форму IL-17, полученную в результате посттрансляционных модификаций. Аминокислотную последовательность типового IL-17A человека можно найти, например, в UniProtKB под номером доступа Р16552. Аминокислотную последовательность типового IL-17В человека можно найти, например, в UniProtKB под номером доступа Q9UHF5. Аминокислотную последовательность типового IL-17C человека можно найти, например, в UniProtKB под номером доступа Q9P0M4. Аминокислотную последовательность типового IL-17D человека можно найти, например, в UniProtKB под номером доступа Q8TAD2. Аминокислотную последовательность типового IL-17Е человека можно найти, например, в UniProtKB под номером доступа Q9H293. Аминокислотную последовательность типового IL-17F человека можно найти, например, в UniProtKB под номером доступа Q96PD4.

Термин "антагонист связывания оси IL-17" относится к молекуле, которая снижает, блокирует, ингибирует, подавляет или нарушает сигнальную трансдукцию, возникающую из-за взаимодействия IL-17 с одним или большим количеством его партнеров по связыванию, таким как белки, являющиеся представителями семейства рецепторов интерлейкина-17 (IL-17R): рецептор А интерлейкина 17 (IL17RA), рецептор В интерлейкина 17 (IL17RB), рецептор С интерлейкина 17 (IL17RC), рецептор D интерлейкина 17 (IL17RD), рецептор Е интерлейкина 17 (IL17RE) и Е-поодбный рецептор интерлейкина 17 (IL17REL). Типовые антагонисты связывания оси IL-17 включают, например, антагонисты связывания IL-17 (например, антитела против IL-17 (например, секукинумаб (AIN417), иксэкизумаб (LY2439821), бимекизумаб и NI-1401) и антагонисты связывания рецептора IL-17 (например, антитела против IL-17R (например, бродалумаб (AMG-827))). См. например, WO 2006/013107, WO 2007/070750, WO 2012/156219, и патент США №8715669.

В данном контексте термин "интерлейкин-33 (IL-33)" относится к любому нативному IL-33 из любого источника, относящегося к позвоночным, включая млекопитающих, таких как приматы (например, люди и яванские макаки) и грызуны (например, мыши и крысы), если не указано иное. IL-33 также упоминается в данной области техники как ядерный фактор наружных эндотелиальных венул (NF-HEV; см., например, Baekkevold et al. Am. J. Pathol. 163(1): 69-79, 2003), DVS27, C9orf26, и представитель 11 семейства интерлейкинов-1 (IL-1F11). Термин охватывает "полноразмерный" необработанный IL-33, зрелый IL-33, а также любую форму IL-33, полученную в результате посттрансляционных модификаций. Полноразмерный необработанный IL-33 человека содержит 270 аминокислот (а.к.) и может также упоминаться как IL-331-270. Обработанные формы IL-33 человека включают, например, IL-3395-270, IL-3399-270, IL-33109-270, IL-33112-270, IL-331-178 и IL-33179-270 ( et al. Proc. Natl. Acad. Sci. 109(5): 1673-1678, 2012 и Martin, Semin. Immunol. 25: 449-457, 2013). В некоторых вариантах осуществления данного изобретения обработанные формы IL-33 человека, например, IL-3395-270, IL-3399-270, IL-33109-270, или другие формы, обработанные протеазами, такими как кальпаин, протеиназа 3, нейтрофильная эластаза и катепсин G, могут иметь повышенную биологическую активность по сравнению с полноразмерным IL-33. Данный термин также включает встречающиеся в природе варианты IL-33, например, сплайсинговые варианты (например, конститутивно активный сплайсинговый вариант splL-33, в котором отсутствует экзон 3, Hong et al. J. Biol. Chem. 286(22): 20078-20086, 2011) или аллельные варианты. IL-33 может присутствовать в клетке (например, в ядре) или находиться в форме секретируемого цитокина. Полноразмерный белок IL-33 содержит ДНК-связывающий мотив спираль-петля-спираль, включая последовательность ядерной локализации (а.к. 1-75 IL-33 человека), которая включает мотив, связывающий хроматин (а.к. 40-58 IL-33 человека). Формы IL-33, которые являются обработанными и секретируются, лишены этих N-концевых мотивов. Аминокислотную последовательность типового IL-33 человека можно найти, например, в UniProtKB под номером доступа O95760.

В данном контексте термины "белок 1, подобный рецептору интерлейкина-1 (IL1RL1)" и "ST2", применяются в данном документе взаимозаменяемо, относятся к любому нативному ST2 из любого источника позвоночных, включая млекопитающих, таких как приматы (например, люди) и грызуны (например, мыши и крысы), если не указано иное. ST2 также упоминается в данной области техники как DER4, Т1 и FIT-1. Термин охватывает "полноразмерный" необработанный ST2, зрелый ST2, а также любую форму ST2, полученную в результате посттрансляционных модификаций. В данной области техники известны по меньшей мере четыре изоформы ST2, включая растворимую (sST2, также известную как IL1RL1-a) и трансмембранную (ST2L, также известную как IL1RL1-b), которые возникают из-за дифференциальной экспрессии мРНК из двойной промоторной системы, и ST2V и ST2LV, которые возникают в результате альтернативного сплайсинга, как описано ниже. Доменная структура ST2L включает три внеклеточных иммуноглобулиноподобных домена С2, трансмембранный домен и цитоплазматический домен рецептора Toll/интерлейкина-1 (TIR). В sST2 отсутствуют трансмембранный и цитоплазматический домены, содержащиеся в ST2L, но при этом он включает уникальную С-концевую последовательность из 9 аминокислот (а.к.) (см., например, Kakkar et al. Nat. Rev. Drug Disc. 7: 827-840,2008). sST2 может функционировать как рецептор-ловушка, чтобы ингибировать растворимый IL-33. Термин также охватывает встречающиеся в природе варианты ST2, например сплайсинговые варианты (например, ST2V, в котором отсутствует третий мотив иммуноглобулина и имеющий уникальный гидрофобный хвост, и ST2LV, в котором отсутствует трансмембранный домен ST2L) или аллельные варианты (например, варианты которые защищают от риска развития астмы или способствуют риску развития астмы, как описано в данном документе). Аминокислотную последовательность типового ST2 человека можно найти, например, в UniProtKB под номером доступа Q01638. ST2 является частью рецептора IL-33 вместе с корецепторным белком IL-1RAcP. Связывание IL-33 с ST2 и корецепторным белком рецептора интерлейкина-1 (IL-1RAcP) образует тройной сигнальный комплекс 1:1:1 для стимуляции нисходящей передачи сигнала (см., например, Lingel et al. Structure 17(10): 1398-1410, 2009, и Liu et al. Proc. Natl. Acad. Sci. 110(37): 14918-14924, 2013).

Под термином "ось IL-33" следует понимать нуклеиновую кислоту (например, ген или мРНК, транскрибируемую с гена) или полипептид, который участвует в трансдукции сигнала IL-33. Например, ось IL-33 может включать лиганд IL-33, рецептор (например, ST2 и/или IL-1RAcP), адаптерные молекулы (например, MyD88) или белки, которые связываются с рецепторными молекулами и/или адапторными молекулами (например, киназы, такие как киназа 1, ассоциированная с рецептором интерлейкина-1 (IRAK1) и киназа 4, ассоциированная с рецептором интерлейкина-1 (IRAK4), или лигазы убиквитина Е3, такие как фактор 6, ассоциированный с рецептором TNF (TRAF6)).

Термин "антагонист связывания оси IL-33" относится к молекуле, которая ингибирует взаимодействие партнера по связыванию оси IL-33 с одним или большим количеством его партнеров по связыванию. В данном контексте антагонист связывания оси IL-33 включает антагонисты связывания IL-33, антагонисты связывания ST2 и антагонисты связывания IL1RAcP. Типовые антагонисты связывания оси IL-33 включают антитела против IL-33 и их антигенсвязывающие фрагменты (например, антитела против IL-33, такие как ANB-020 (AnaptysBio, Inc.) или любое из антител, описанных в публикациях ЕР 1725261, US 8187596, WO 2011031600, WO 2014164959, WO 2015099175 или WO 2015106080, каждая из которых включена в данный документ посредством ссылки в полном объеме); полипептиды, которые связывают IL-33 и/или его рецептор (ST2 и/или IL-1RAcP) и блокируют взаимодействие "лиганд-рецептор" (например, белки ST2-Fc, такие как описаны в публикации WO 2014/152195, которых включена в данный документ посредством ссылки в полном объеме; иммуноадгезины, пептидные антитела и растворимый ST2 или их производные); антитела против рецептора IL-33 (например, антитела против ST2, например, AMG-282 (Amgen) или STLM15 (Janssen) или любое из антител против ST2, описанных в публикациях WO 2013/173761 и WO 2013/165894, каждая из которых включена в данный документ посредством ссылки в полном объеме; или белки ST2-Fc, такие как белки, описанные в публикациях WO 2013/173761; WO 2013/165894 или WO 2014/152195, каждая из которых включена в данный документ посредством ссылки в полном объеме); и антагонисты рецептора IL-33, такие как низкомолекулярные ингибиторы, аптамеры, которые связывают IL-33, и нуклеиновые кислоты, которые гибридизуются в жестких условиях с последовательностями нуклеиновых кислот оси IL-33 (например, короткие интерферирующие РНК (siPHK) или кластеризованные регулярно пересекающиеся короткие РНК с палиндромным повтором (CRISPR-PHK или сгРНК), включая одиночные направляющие РНК (sgPHK), имеющие последовательность crPНК и tracrPHK, как описано в публикации Mali et al. (Science. 339: 823-26, 2013), содержание которой включено в данный документ посредством ссылки в полном объеме).

Термины "антитело против IL-33", "антитело, которое связывается с IL-33" и "антитело, которое специфически связывает IL-33" относятся к антителу, которое способно связывать IL-33 с достаточной аффинностью, чтобы антитело можно было применять в качестве диагностического и/или терапевтического агента для нацеливания на IL-33. В одном варианте реализации изобретения степень связывания антитела против IL-33 с неродственным, не являющимся IL-33 белком составляет менее около 10% от связывания антитела с IL-33 согласно данным, например, радиоиммуноанализа (РИА). В некоторых вариантах осуществления данного изобретения антитело, которое связывается с IL-33, имеет константу диссоциации (KD)≤1 мкМ, ≤100 нМ, ≤10 нМ, ≤1 нМ, ≤0,1 нМ, ≤0,01 нМ, или ≤0,001 нМ (например, 10-8 М или менее, например, от 10-8 М до 10-13 М, например, от 10-9 М до 10-13 М). В определенных вариантах осуществления данного изобретения антитело против IL-33 связывается с эпитопом IL-33, который является консервативным для IL-33 от разных видов.

Термин "антагонист связывания ST2" относится к молекуле, которая ингибирует взаимодействие ST2 с IL-33, IL1RAcP и/или второй молекулой ST2. Антагонист связывания ST2 может представлять собой белок, такой как "белок ST2-Fc", который включает IL-33-связывающий домен (например, весь или часть белка ST2 или IL1RAcP) и мультимеризирующий домен (например, Fc часть иммуноглобулина, например, Fc-домен IgG, выбранный из изотипов IgG1, IgG2, IgG3 и IgG4, а также любого аллотипа в каждой группе изотипов), которые присоединены друг к другу либо прямо, либо опосредовано через линкер (например, линкер серин-глицин (SG), линкер глицин-глицин (GG) или их вариант (например, линкер SGG, GGS, SGS или GSG)) и включает, но не ограничивается ими, белки ST2-Fc и их варианты, описанные в публикациях WO 2013/173761, WO 2013/165894 и WO 2014/152195, каждая из которых включена в данное описание посредством ссылки во всей своей полноте. В некоторых вариантах осуществления данного изобретения антагонист связывания ST2 может представлять собой антитело против ST2, например, AMG-282 (Amgen) или STLM15 (Janssen), или любое из антител против ST2, описанных в WO 2013/173761 и WO 2013/165894.

Термин "выделенная нуклеиновая кислота" относится к молекуле нуклеиновой кислоты, отделенной от компонента своего природного окружения. Выделенная нуклеиновая кислота содержит молекулу нуклеиновой кислоты, содержавшуюся в клетках, обычно содержащих указанную молекулу нуклеиновой кислоты, однако указанная молекула нуклеиновой кислоты присутствует вне хромосомы или в области хромосомы, отличающейся от ее естественного местоположения в хромосоме.

Термин "регуляторные последовательности" относится к последовательностям ДНК, необходимым для экспрессии функционально связанной кодирующей последовательности в конкретном организме-хозяине. Контрольные последовательности, которые пригодны для введения в прокариоты, к примеру, включают в себя промотор, в некоторых случаях операторную последовательность и участок связывания рибосом. Известно, что в эукариотических клетках используются промоторы, сигналы полиаденилирования и энхансеры.

Термины "клетка-хозяин", "линия клеток-хозяев" и "культура клеток-хозяев" в данном документе применяются взаимозаменяемо и относятся к клеткам, в которые введена экзогенная нуклеиновая кислота, включая потомство таких клеток. Клетки-хозяева включают в себя "трансформанты" и "трансформированные клетки", которые включают в себя первично трансформированные клетки и полученное из них потомство, независимо от числа пассажей. Потомство может не быть полностью идентичным родительской клетке по содержанию нуклеиновых кислот и может содержать мутации. В объем данного описания входит мутантное потомство, полученное путем скрининга или отбора, которое обладает такой же функцией или биологической активностью, как и исходно трансформированная клетка.

Нуклеиновая кислота является "функционально связанной", когда она помещена в функциональную зависимость от другой последовательности нуклеиновой кислоты. К примеру, ДНК предпоследовательности или секреторного лидера является функционально связанной с ДНК полипептида, если она экспрессируется как пребелок, принимающий участие в секреции этого полипептида; промотор или энхансер функционально связан с кодирующей последовательностью, если он влияет на транскрипцию этой последовательности, или участок связывания рибосом функционально связан с кодирующей последовательностью, если он расположен так, чтобы оптимизировать процесс трансляции. В целом, "функционально связанный" означает, что последовательности ДНК, будучи связанными, являются непрерывными и, в случае наличия секреторного лидера, непрерывными и в фазе считывания. Тем не менее, энхансеры не должны быть непрерывными. Связывание осуществляется путем лигирования в удобных рестрикционных участках. Если такие участки не существуют, применяют синтетические адапторы или линкеры в соответствии с традиционной практикой.

"Процент (%) идентичности аминокислотной последовательности" применительно к полипептидным последовательностям, идентифицируемым в данном документе, определяется как процентное содержание аминокислотных остатков в потенциальной последовательности, которые идентичны аминокислотным остаткам в подлежащем сравнению полипептиде, если необходимо, после выравнивания этих последовательностей и введения гэпов для достижения максимального процента идентичности последовательностей и не учитывая любые консервативные замены, как части идентичности последовательности. Выравнивание для целей определения процента идентичности аминокислотных последовательностей можно осуществить различными способами, известными специалистам в данной области техники, например, используя общедоступное компьютерное программное обеспечение, например, программное обеспечение BLAST, BLAST-2, ALIGN или Megalign (DNASTAR). Специалисты в данной области техники могут определить соответствующие параметры для измерения степени выравнивания, включая любые алгоритмы, необходимые для достижения максимального выравнивания на полной длине подлежащих сравнению последовательностей. Однако для целей данного изобретения значения % идентичности аминокислотных последовательностей получают с помощью компьютерной программы для сравнения последовательностей ALIGN-2. Компьютерная программа для сравнения последовательностей ALIGN-2 разработана компанией Genentech Inc., а исходный код представлен в документации пользователя в Бюро регистрации авторских прав США, Washington D.С., 20559, где он зарегистрирован подномером регистрации авторского права США TXU510087. Программа ALIGN-2 является общедоступной в компании Genentech Inc., South San Francisco, California. Программу ALIGN-2 необходимо компилировать для применения на операционной системе UNIX, предпочтительно в цифровой версии UNIX V4. 0D. Все параметры сравнения последовательностей устанавливаются программой ALIGN-2 и остаются неизменными.

В случаях, когда ALIGN-2 используют для сравнения аминокислотных последовательностей, % идентичности данной аминокислотной последовательности А и данной аминокислотной последовательности В (что в альтернативном варианте может быть сформулировано как данная аминокислотная последовательность А, которая имеет или содержит определенный % идентичности аминокислотной последовательности к, с или по отношению к данной аминокислотной последовательности В) рассчитывают следующим образом:

100 умножить на соотношение X/Y,

где X представляет собой число аминокислотных остатков, оцененных программой выравнивания последовательностей ALIGN-2 как идентичные совпадения при программном выравнивании А и В, и где Y представляет общее количество аминокислотных остатков в В. Следует принимать во внимание, что если длина аминокислотной последовательности А не равна длине аминокислотной последовательности В, % идентичности аминокислотной последовательности А по отношению к В не равен % идентичности аминокислотной последовательности В по отношению к А. Если не указано иное, все применяемые в данном документе процентные значения идентичности аминокислотных последовательностей получены, как описано непосредственно в предыдущем абзаце с помощью компьютерной программы ALIGN-2.

Аминокислотные последовательности, описанные в данном документе, являются непрерывными аминокислотными последовательностями, если не указано иное.

В данном контексте термин "вектор" обозначает молекулу нуклеиновой кислоты, способную переносить другую нуклеиновую кислоту, с ней соединенную. Один тип вектора представляет собой "плазмиду", которая относится к циклической двухцепочечной петле ДНК, в которую могут быть лигированы дополнительные сегменты ДНК. Другим типом вектора является фаговый вектор. Другой тип вектора представляет собой вирусный вектор, в котором дополнительные сегменты ДНК могут быть лигированы в вирусный геном. Определенные векторы способны к автономной репликации в клетке-хозяине, в которую они введены (например, бактериальные векторы, имеющие бактериальную точку начала репликации, и эписомальные векторы млекопитающих). Другие векторы (например, не-эписомальные векторы млекопитающих) могут быть интегрированы в геном клетки-хозяина при введении в клетку хозяина и, таким образом, реплицироваться вместе с геномом хозяина. Более того, некоторые векторы способны направлять экспрессию генов, с которыми они функционально связаны. Такие векторы упоминаются в данном документе как "рекомбинантные экспрессионные векторы" (или просто, "рекомбинантные векторы" или "экспрессионные векторы"). В большинстве случаев экспрессионные векторы, используемые в технологиях рекомбинантной ДНК, часто имеют форму плазмид. В данном описании термины "плазмида" и "вектор" могут применяться взаимозаменяемо.

II. Композиции и способы

В одном аспекте данное изобретение частично основано на новых антителах, которые связываются с триптазой. В другом аспекте данного изобретение частично основано на обнаружении того, что конкретные остатки (например, остатки HVR, такие как отсаток HVR-H3 W100, который относится к W100 домена VH антитела hu31A.v11 против триптазы) антител против триптазы могут быть подвержены окислению. В данном изобретении предлагаются фармацевтические композиции, которые включают антиоксиданты (например, N-ацетилтриптофан и/или метионин) для уменьшения или предотвращения окисления антител, описанных в данном документе (например, антител против триптазы). Другие пригодные вспомогательные вещества-антиоксиданты включают, без ограничения, свободный триптофан, циклодекстрины, тролокс (6-гидрокси-2,5,7,8-тетраметилхроман-2-карбоновая кислота), пиридоксин, полиолы (например, маннит) и хелаторы металлов (например, ЭДТК). См., например, Ji et al., Biotechnology 98: 4485-4500, 2009. Антитела и фармацевтические композиции по изобретению являются пригодными, например, для диагностики и/или лечения нарушений (например, легочного нарушения, аутоиммунного нарушения, воспалительного нарушения, фиброзного нарушения, гранулоцитарного (нейтрофильного или эозинофильного) нарушения, моноцитарного нарушения, лимфоцитарного нарушения или нарушения, ассоциированного с увеличенным количеством или распределением резидентных клеток нормальной или патологической ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий) или нарушения, ассоциированного с триптазой, или нарушения, опосредованного триптазой. В другом аспекте данного изобретения предлагаются лиофилизированные фармацевтические композиции для уменьшения или устранения окисления антител, описанных в данном документе (например, антител против триптазы).

А. Типовые антитела против триптазы

В данном изобретеним предлагаются выделенные антитела, которые связываются с триптазой. В определенных вариантах осуществления данного изобретения антитело против триптазы по данному изобретению связывается с триптазой со значением KD, составляющим около 100 нМ или ниже (например, 100 нМ или ниже, 10 нМ или ниже, 1 нМ или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим 10 нМ или ниже (например, 10 нМ или ниже, 1 нМ или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим 1 нМ или ниже (например, 1 нм или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим 0,5 нМ или ниже (например, 0,5 нМ или ниже, 400 пМ или ниже, 300 пМ или ниже, 200 пМ или ниже, 100 пМ или ниже, 50 пМ или ниже, 25 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим от около 0,1 нМ до около 0,5 нМ (например, около 0,1 нМ, около 0,2 нМ, около 0,3 нМ, около 0,4 нМ или около 0,5 нМ). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим от около 1 пМ до около 500 пМ, от около 1 пМ до около 400 пМ, от около 1 пМ до около 300 пМ, от около 1 пМ до около 200 пМ, от около 1 пМ до около 100 пМ, от около 1 пМ до около 50 пМ, от около 25 пМ до 500 пМ, от около 25 пМ до около 400 пМ, от около 25 пМ до около 300 пМ, от около 25 пМ до около 100 пМ, от около 50 пМ до около 500 пМ, от около 50 пМ до около 450 пМ, от около 50 пМ до около 425 пМ, от около 50 пМ до около 400 пМ, от около 50 пМ до около 375 пМ, от около 50 пМ до около 350 пМ, от около 50 пМ до около 325 пМ, от около 50 пМ до около 300 пМ, от около 50 пМ до около 275 пМ, от около 50 пМ до около 250 пМ, от около 50 пМ до около 200 пМ, от около 50 пМ до около 180 пМ, от около 50 пМ до около 175 пМ, от около 50 пМ до около 150 пМ, от около 50 пМ до около 125 пМ от около 50 пМ до около 100 пМ, от около 50 пМ до около 75 пМ, от около 100 пМ до около 500 пМ, от около 100 пМ до около 475 пМ, от около 100 пМ до около 450 пМ, от около 100 пМ до около 425 пМ, от около 100 пМ до около 400 пМ, от около 100 до около 375 пМ, от около 100 пМ до около 350 пМ, от около 100 пМ до около 325 пМ, от около 100 пМ до около 300 пМ, от около 100 пМ до около 275 пМ, от около 100 пМ до около 250 пМ, от около 100 пМ до около 225 пМ, от около 100 пМ до около 200 пМ, от около 100 пМ до около 180 пМ, от около 100 пМ до около 175 пМ, от около 100 пМ до около 150 пМ, от около 100 пМ до около 125 пМ, от около 150 пМ до около 500 пМ, от около 150 пМ до около 475 пМ, от около 150 пМ до около 450 пМ, от около 150 пМ до около 425 пМ, от около 150 пМ до около 400 пМ, от около 150 пМ до около 375 пМ, от около 150 пМ до около 350 пМ, от около 150 пМ до около 325 пМ, от около 150 пМ до около 300 пМ, от около 150 пМ до около 375 пМ, от около 150 пМ до около 350 пМ, от около 150 пМ до около 325 пМ, от около 150 пМ до около 300 пМ, от около 150 пМ до около 275 пМ, от около 150 пМ до около 225 пМ, от около 150 пМ до около 200 пМ, от около 175 пМ до около 500 пМ, от около 175 пМ до около 475 пМ, от около 175 пМ до около 450 пМ, от около 175 пМ до около 425 пМ, от около 175 пМ до около 400 пМ, от около 175 пМ до около 375 пМ, от около 175 пМ до около 350 пМ, от около 175 пМ до около 325 пМ, от около 175 пМ до около 300 пМ или от около 180 пМ до около 400 пМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим около 0,4 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим около 0,2 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу со значением KD, составляющим около 0,18 нМ. В некоторых вариантах осуществления данного изобретения триптаза представляет собой триптазу человека, например, триптазу бета человека (например, триптазу бета 1 человека, триптазу бета 2 человека и/или триптазу бета 3 человека). В некоторых вариантах осуществления данного изобретения значение KD определяют с помощью анализа SPR BIACORE®. В определенных вариантах осуществления данного изобретения триптаза представляет собой триптазу альфа человека. В некоторых вариантах осуществления данного изобретения указанное антитело представляет собой человеческое или гуманизированное антитело.

В другом примере, в некоторых вариантах осуществления данного изобретения антитело против триптазы по данному изобретению (включая любое из вышеописанных антител против триптазы) способно ингибировать активность триптазы. В некоторых вариантах осуществления данного изобретения антитело против триптазы по данному изобретению способно ингибировать протеолитическую активность триптазы, например, что определяется в ферментативном анализе триптазы in vitro. В некоторых вариантах осуществления данного изобретения искусственный субстрат, например, синтетический пептид S-2288, можно применять в качестве субстрата в ферментативном анализе триптазы in vitro. В некоторых вариантах осуществления данного изобретения антитело против триптазы по данному изобретению способно ингибировать активность триптазы человека с половинной максимальной ингибирующей концентрацией (IC50), составляющей около 100 нМ или ниже (например, 100 нМ или ниже, 10 нМ или ниже). 5 нМ или ниже, 2,5 нМ или ниже, 1 нМ или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже или 0,1 пМ или ниже), что определяется с помощью ферментативного анализа триптазы in vitro, например, с применением S-2288 в качестве субстрата. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющем около 10 нМ или ниже (например, 10 нМ или ниже, 5 нМ или ниже, 2,5 нМ или ниже, 1 нМ или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже), что определяется с помощью ферментативного анализа триптазы in vitro, например, с применением S-2288 в качестве субстрата. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющем около 2,5 нМ или ниже (например, 2,5 нМ или ниже, 1 нМ или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже), что определяется с помощью ферментативного анализа триптазы in vitro, например, с применением S-2288 в качестве субстрата. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющем от около 0,1 нМ до около 2 нМ (например, около 0,1 нМ, около 0,2 нМ, около 0,3 нМ, около 0,4 нМ, около 0,5 нМ, около 0,6 нМ, около 0,7 нМ, около 0,8 нМ, около 0,9 нМ, около 1,0 нМ, около 1,1 нМ, около 1,2 нМ, около 1,3 нМ, около 1,4 нМ, около 1,5 нМ, около 1,6 нМ, около 1,7 нМ, около 1,8 нМ около 1,9 нМ или около 2,0 нМ). В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющем от 0,5 до 2,5 нМ (например, около 0,5 нМ, около 0,6 нМ, около 0,7 нМ, около 0,8 нМ, около 0,9 нМ, около 1,0 нМ, около 1,1 нМ, около 1,2 нМ, около 1,3 нМ, около 1,4 нМ, около 1,5 нМ, около 1,6 нМ, около 1,7 нМ, около 1,8 нМ, около 1,9 нМ, около 2,0 нМ, около 2,1 нМ, около 2,2 нМ, около 2,3 нМ, около 2,4 нМ или около 2,5 нМ). В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющем от около 1 пМ до около 2,5 нМ, от около 25 пМ до около 2,5 нМ, от около 50 пМ до около 2,5 нМ, от около 75 пМ до около 2,5 нМ, от около 100 пМ до около 2,5 нМ, от около 125 пМ до около 2,5 нМ, от около 150 пМ до около 2,5 нМ, от около 175 пМ до около 2,5 нМ, от около 200 пМ до около 2,5 нМ, от около 225 пМ до около 2,5 нМ, от около 250 пМ до около 2,5 нМ, от около 300 пМ до около 2,5 нМ, от около 325 пМ до около 2,5 нМ, от около 325 пМ до около 2,5 нМ, от около 350 пМ до около 2,5 нМ, от около 375 пМ до около 2,5 нМ, от около 400 пМ до около 2,5 нМ, от около 425 пМ до около 2,5 нМ, от около 450 пМ до около 2,5 нМ, от около 500 пМ до около 2,5 нМ, от около 450 пМ до около 2,5 нМ, от около 500 пМ до около 2,5 нМ, от около 550 пМ до около 2,5 нМ, от около 600 пМ до около 2,5 нМ, от около 650 пМ до около 2,5 нМ, от около 700 пМ до около 2,5 нМ, от около 750 пМ до около 2,5 нМ, от около 800 пМ до около 2,5 нМ, от около 850 пМ до около 2,5 нМ, от около 900 пМ до около 2,5 нМ, от около 950 пМ до около 2,5 нМ, от около 1 нМ до 2,5 нМ, от около 1,1 нМ до около 2,5 нМ, от около 1,2 нМ до около 2,5 нМ, от около 1,3 нМ до около 2,5 нМ, от около 1,4 нМ до около 2,5 нМ, от около 1,5 нМ до около 2,5 нМ, от около 1,6 нМ до около 2,5 нМ, от около нМ до около 2,5 нМ, от около 1,8 нМ до около 2,5 нМ, от около 1,9 нМ до около 2,5 нМ, от около 2,0 нМ до около 2,5 нМ, от около 2,1 нМ до около 2,5 нМ, от около 2,2 нМ до около 2,5 нМ, от около 2,3 нМ до около 2,5 нМ, от около 500 пМ до около 1,9 пМ от около 750 пМ до около 1,9 пМ, от около 1 нМ до около 1,9 пМ, от около 1,25 нМ до около 1,9 пМ, от около 1,5 нМ до около 1,9 пМ, от около 1 нМ до около 1,85 нМ, от около 1,25 нМ до около 1,85 нМ, от около 1,25 нМ до около 1,85 нМ, от около 1,5 нМ до около 1,85 нМ, от около 1 нМ до 1,8 нМ, от около 1,25 нМ до около нМ, от около 1,5 нМ до около 1,8 нМ или от около 1,6 нМ до около 1,8 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющим около 1,8 нМ. В других вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющим от около 0,5 нМ до около 1 нМ (например, около 0,5 нМ, около 0,6 нМ, около 0,7 нМ, около 0,8 нМ, около 0,9 нМ или около 1,0 нМ). В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющим от около 1 пМ до около 1 нМ, от около 25 пМ до около 1 нМ, от около 50 пМ до около 1 нМ, от около 75 пМ до около 1 нМ, от около 100 пМ до около 1 нМ, от около 125 пМ до около 1 нМ, от около 150 пМ до около 1 нМ, от около 175 пМ до около 1 нМ, от около 200 пМ до около 1 нМ, от около 225 пМ до около 1 нМ, от около 250 пМ до около 1 нМ, от около 300 пМ до около 1 нМ, от около 325 пМ до около 1 нМ, от около 350 пМ до около 1 нМ, от около 375 пМ до около 1 нМ, от около 400 пМ до около 1 нМ, от около 425 пМ до около 1 нМ, от около 450 пМ до около 1 нМ, от около 500 пМ до около 1 нМ, от около 450 пМ до около 1 нМ, от около 500 пМ до около 1 нМ, от около 550 пМ до около 1 нМ, от около 600 пМ до около 1 нМ, от около 650 пМ до около 1 нМ, от около 700 пМ до около 1 нМ, около 750 пМ, от около 250 пМ до около 800 пМ, от около 300 пМ до около 800 пМ, от около 325 пМ до около 800 пМ, от около 325 пМ до около 800 пМ, от около 350 пМ до около 800 пМ, от около 375 пМ до около 800 пМ, от около 400 пМ до около 800 пМ, от около 425 пМ до около 800 пМ, от около 450 пМ до около 800 пМ, от около 500 пМ до около 800 пМ, от около 450 пМ до около 800 пМ, от около 500 пМ до около 800 пМ, от около 550 пМ до около 800 пМ, от около 600 пМ до около 800 пМ, от около 650 пМ до около 800 пМ, от около 700 пМ до около 800 пМ от около 750 пМ до около 800 пМ, от около 1 пМ до около 600 пМ, от около 25 пМ до около 600 пМ, от около 50 пМ до около 600 пМ, от около 75 пМ до около 600 пМ, от около 100 пМ до около 600 пМ, от около 125 пМ до около 600 пМ, от около 150 пМ до около 600 пМ, от около 175 пМ до около 600 пМ, от около 200 пМ до около 600 пМ, от около 225 пМ до около 600 пМ, от около 250 пМ до около 600 пМ, от около 300 пМ до около 600 пМ, от около 325 пМ до около 600 пМ, от около 325 пМ до около 600 пМ, от около 350 пМ до около 600 пМ, от около 375 пМ до около 600 пМ, от около 400 пМ до около 600 пМ, от около 425 пМ до около 600 пМ, от около 450 пМ до около 600 пМ, от около 500 пМ до около 600 пМ, от около 450 пМ до около 600 пМ, от около 500 пМ до около 600 пМ, или от около 550 пМ до около 600 пМ. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека со значением IC50, составляющим около 0,6 нМ. В некоторых вариантах осуществления данного изобретения триптаза представляет собой триптазу человека, например, триптазу бета человека (например, триптазу бета 1 человека, триптазу бета 2 человека и/или триптазу бета 3 человека). В некоторых вариантах осуществления данного изобретения ингибирующую активность антитела определяют, как описано данном документе, например, в Примерах (например, Пример 1, в частности, Раздел (А) (viii) (а)), с помощью или других подходов, известных в данной области техники. В определенных вариантах осуществления данного изобретения указанное антитело представляет собой человеческое или гуманизированное антитело. В некоторых вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека в качестве моновалентного антитела или антигенсвязывающего фрагмента антитела (например, Fab). В других вариантах осуществления данного изобретения указанное антитело способно ингибировать активность триптазы человека в качестве двухвалентного антитела (например, антитела IgG (например, антитела IgG1 или IgG4) или F(ab')2).

В некоторых случаях любое из антител против триптазы, описанных в данном документе, может ингибировать стимулированное триптазой сокращение первичных гладко мышечных клеток дыхательных путей человека. В других случаях любое из антител против триптазы, описанных в данном документе, может ингибировать стимулированное триптазой сокращение первичных гладкомышечных клеток дыхательных путей человека. В еще других случаях любое из антител против триптазы, описанных в данном документе, может ингибировать триптазу или IgE-стимулированную дегрануляцию тучных клеток и/или высвобождение гистамина. В других случаях любое из антител против триптазы, описанных в данном документе, может уменьшать количество активной триптазы (например, в образце, таком как жидкость бронхоальвеолярного лаважа или в назосорбционном образце), например, после введения субъекту. Например, любое из антител против триптазы, описанных в данном документе, может снизить количество активной триптазы на около 1%, около 5%, около 10%, около 15%, около 20%, около 25%, около 30%, около 35%, около 40%, около 45%, около 50%, около 55%, около 60%, около 75%, около 80%, около 90%, около 95%, около 96%, около 97%, около 98%, около 99% или больше. Указанное уменьшение может представлять собой уменьшение относительно эталонного количества активной триптазы, например, количества активной триптазы в образце до введения антитела против триптазы.

В некоторых случаях указанное антитело (например, антитело против триптазы) может включать по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных областей (HVR), выбранных из: (a) HVR-H1, содержащей аминокислотную последовательность X1X2GMX3 (SEQ ID NO: 1), где X1 представляет собой Asp или Ser, Х2 представляет собой Tyr или Phe, и Х3 представляет собой Val или His; (b) HVR-H2, содержащей аминокислотную последовательность (SEQ ID NO: 2); (с) HVR-H3, содержащей аминокислотную последовательность RX1X2X3DWYFDV (SEQ ID NO: 3), где X1 представляет собой Asn или Asp, Х2 представляет собой Tyr или Asn, и Х3 представляет собой Asp или Tyr; (d) HVR-L1, содержащей аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащей аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащей аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6) или комбинацию одной или большего количества из указанных выше HVR и одного или большего количества их вариантов, имеющих по меньшей мере около 80% идентичности последовательности (например, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности) к любой из SEQ ID NO: 1-6.

Например, в некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) может включать по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных областей (HVR), выбранных из: (a) HVR-H1, содержащей аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащей аминокислотную последовательность (SEQ ID NO: 2); (с) HVR-H3, содержащей аминокислотную последовательность (SEQ ID NO: 8); (d) HVR-L1, содержащей аминокислотную последовательность (SEQ ID NO: 4); (e) HVR-L2, содержащей аминокислотную последовательность (SEQ ID NO: 5); и (f) HVR-L3, содержащей аминокислотную последовательность (SEQ ID NO: 6) или комбинацию одной или большего количества из указанных выше HVR и одного или большего количества их вариантов, имеющих по меньшей мере около 80% идентичности последовательности (например, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности) к любой из SEQ ID NO: 2 или 4-8.

В одном конкретном примере, в некоторых вариантах осуществления данного изобретения, указанное антитело (например, антитело против триптазы) может включать (a) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 8); (d) HVR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 4); (e) HVR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 6). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью SEQ ID NO: 9; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью SEQ ID NO: 10; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает одну, две, три или четыре из следующих каркасных областей тяжелой цепи (FR): (a) FR-H1, содержащую аминокислотную последовательность (SEQ ID NO: 11); (b) FR-H2, содержащую аминокислотную последовательность (SEQ ID NO: (с) FR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 13); и (d) FR-H4, содержащую аминокислотную последовательность (SEQ ID NO: 14). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает одну, две, три или четыре из следующих FR легкой цепи: (a) FR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 15); (b) FR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 16); (с) FR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 17); и (d) FR-L4, содержащую аминокислотную последовательность (SEQ ID NO: 18). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает домен VH, содержащий аминокислотную последовательность SEQ ID NO: 9, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10, например, антитело hu31A.v11.

В другом конкретном примере, в некоторых вариантах осуществления данного изобретения, указанное антитело (например, антитело против триптазы) может включать (a) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 2); (с) HVR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 29); (d) HVR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 4); (е) HVR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 6). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью SEQ ID NO: 19; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью SEQ ID NO: 20; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает одну, две, три или четыре из следующих каркасных областей тяжелой цепи (FR): (a) FR-H1, содержащую аминокислотную последовательность (SEQ ID NO: 21); (b) FR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 22); (с) FR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 23); и (d) FR-H4, содержащую аминокислотную последовательность (SEQ ID NO: 24). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает одну, две, три или четыре из следующих FR легкой цепи: (a) FR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 25); (b) FR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 26); (с) FR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 27); и (d) FR-L4, содержащую аминокислотную последовательность (SEQ ID NO: 28). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает домен VH, содержащий аминокислотную последовательность SEQ ID NO: 19, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 20, например, антитело 31а.

В некоторых случаях указанное антитело (например, антитело против триптазы) включает (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью любой из SEQ ID NO: 9, 101, 102, 103 и 104; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью любой из SEQ ID NO: 10, 105 и 106; или (с) домен VH, как в (а), и домен VL, как в (b). Например, в некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 98, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 102. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 98, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 98, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 103. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 99, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 102. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 99, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 99, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 103. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 100, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 102. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 100, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 100, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 103. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 9, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 102. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 9, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 9, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 103. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 101, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 102. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 101, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 10. В других случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 101, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 103.

В некоторых случаях любое из вышеописанных антител связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два, по меньшей мере три или все четыре остатка, выбранных из группы, состоящей из His51, Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два, по меньшей мере три или все четыре остатка, выбранных из группы, состоящей из His51, Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе бета 1 человека, содержащим His51 и по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Val80, Lys81 и Asp82 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать или все двенадцать аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит His51, Gln67, Val80, Lys81, Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать как малую поверхность контакта тетрамерной триптазы бета 1 человека, так и большую поверхность контакта тетрамерной триптазы бета 1 человека.

В некоторых случаях любое из вышеописанных антител против триптазы включает паратоп, который связывает триптазу (например, триптазу бета 1 человека), которая включает один или большее количество аминокислотных остатков (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 или 19 аминокислотных остатков), выбранных из группы, состоящей из аминокислотных остатков вариабельной области легкой цепи Val30; Thr31; Tyr32; Tyr34; Arg50; Tyr90; His92; Ser93; и Tyr94 и аминокислотных остатков вариабельной области тяжелой цепи Phe50; Ser52; Gly53; Ser54; Ser55; Thr56; Tyr58; Arg95; Tyr97; и Asp98.

Например, в некоторых случаях антитело против триптазы включает паратоп, который связывает триптазу (например, триптазу бета 1 человека), которая включает аминокислотные остатки вариабельной области легкой цепи Val30, Thr31, Tyr32, Tyr34, Arg50, Tyr90, His92, Ser93 и Tyr94 или аминокислотные остатки вариабельной области тяжелой цепи Phe50, Ser52, Gly53, Ser54, Ser55, Thr56, Tyr58, Arg95, Tyr97 и Asp98. В некоторых случаях антитело против триптазы включает паратоп, который связывает триптазу (например, триптазу бета 1 человека), которая включает аминокислотные остатки вариабельной области легкой цепи Val30, Thr31, Tyr32, Tyr34, Arg50, Tyr90, His92, Ser93 и Tyr94 и аминокислотные остатки вариабельной области тяжелой цепи Phe50, Ser52, Gly53, Ser54, Ser55, Thr56, Tyr58, Arg95, Tyr97 и Asp98.

В некоторых случаях указанное антитело (например, антитело против триптазы) может включать по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных областей (HVR), выбранных из: (a) HVR-H1, содержащей аминокислотную последовательность GYAIT (SEQ ID NO: 30); (b) HVR-H2, содержащей аминокислотную последовательность (SEQ ID NO: 31); (с) HVR-H3, содержащей аминокислотную последовательность (SEQ ID NO: 32); (d) HVR-L1, содержащей аминокислотную последовательность (SEQ ID NO: 33); (е) HVR-L2, содержащей аминокислотную последовательность (SEQ ID NO: 34); и (f) HVR-L3, содержащей аминокислотную последовательность (SEQ ID NO: 35), или комбинации одной или большего количества из указанных выше HVR и одного или большего количества их вариантов, имеющих по меньшей мере около 80% идентичности последовательности (например, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности) к любой из SEQ ID NO: 30-35

В некоторых случаях указанное антитело (например, антитело против триптазы) включает (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью любой из SEQ ID NO: 36, 47, 48, 49, 50, 51 и 52; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности) или последовательность, с аминокислотной последовательностью любой из SEQ ID NO: 37, 53, 58 или 59; или (с) домен VH, как в (а), и домен VL, как в (b).

В некоторых случаях любое из вышеописанных антител (например, антитела против триптазы) может включать одну, две, три или четыре из следующих каркасных областей тяжелой цепи (FR): (a) FR-H1, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 38); (b) FR-H2, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 39), где X1 представляет собой Ile или Val; (с) an FR-H3, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 40), где X1 представляет собой Val или Ser, Х2 представляет собой Arg или Val, Х3 представляет собой Val или Phe, и Х4 представляет собой Tyr or Phe; и (d) FR-H4, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 41).

Например, в некоторых случаях любое из вышеописанных антител (например, антитела против триптазы) может включать одну, две, три или четыре из следующих FR тяжелой цепи: (a) FR-H1, содержащую аминокислотную последовательность (SEQ ID NO: 38); (b) FR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 42); (c) FR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 43); и (d) FR-H4, содержащую аминокислотную последовательность (SEQ ID NO: 41).

В другом примере, в некоторых случаях любое из вышеописанных антител (например, антитела против триптазы) может включать одну, две, три или четыре из следующих FR тяжелой цепи: (a) FR-H1, содержащую аминокислотную последовательность (SEQ ID NO: 44); (b) FR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 45); (с) FR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 46); и (d) FR-H4, содержащую аминокислотную последовательность (SEQ ID NO: 41).

В другом примере, в некоторых случаях любое из вышеописанных антител (например, антитела против триптазы) может включать одну, две, три или четыре из следующих FR тяжелой цепи: (a) FR-H1, содержащую аминокислотную последовательность (SEQ ID NO: 44); (b) FR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 45); (c) FR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 46); и (d) FR-H4, содержащую аминокислотную последовательность (SEQ ID NO: 41).

В некоторых случаях любое из вышеописанных антител (например, антитела против триптазы) может включать одну, две, три или четыре из следующих FR легкой цепи: (a) FR-L1, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 60), где X1 представляет собой Ile или Ala, и Х2 представляет собой Met или Leu; (b) FR-L2, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 61), где X1 представляет собой Ala или Pro; (с) FR-L3, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 62), где X1 представляет собой Gly или Glu, и Х2 представляет собой Tyr или Phe; и (d) FR-L4, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью (SEQ ID NO: 63).

Например, в особых случаях любое из вышеописанных антител (например, антитела против триптазы) может включать одну, две, три или четыре из следующих FR легкой цепи: (a) FR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 64); (b) FR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 65); (с) FR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 66); и (d) FR-L4, содержащую аминокислотную последовательность (SEQ ID NO: 63).

В некоторых вариантах осуществления данного изобретения любое из вышеописанных антител (например, антитела против триптазы) может включать одну, две, три или четыре из следующих FR легкой цепи: (a) FR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 67); (b) FR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 68); (с) FR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 69), где X1 представляет собой Cys или Ala; и (d) FR-L4, содержащую аминокислотную последовательность (SEQ ID NO: 70).

В некоторых случаях указанное антитело (например, антитело против триптазы) включает (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью любой из SEQ ID NO: 36, 47, 48, 49, 50, 51 и 52; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности) или последовательность, с аминокислотной последовательностью любой из SEQ ID NO: 37, 53, 58 и 59; или (с) домен VH, как в (а), и домен VL, как в (b). Например, в некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 36, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 47, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 48, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 49, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 50, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 50, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 52, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 36, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 47, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 48, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 49, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 50, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 52, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 36, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 58. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 47, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 58. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 48, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 58. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 49, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 58. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 50, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 58. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 58. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 36, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 59. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 47, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 59. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 48, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 59. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 49, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 59. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 50, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 59. В некоторых случаях указанное антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 59.

В другом конкретном примере, в некоторых вариантах осуществления данного изобретения, указанное антитело против триптазы может включать (а) HVR-H1, содержащую аминокислотную последовательность GYAIT (SEQ ID NO: 30); (b) HVR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 31); (с) HVR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 32); (d) HVR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 33); (е) HVR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 34); и (f) HVR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 35). В некоторых вариантах осуществления данного изобретения указанное антитело против триптазы включает (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью SEQ ID NO: 36; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности) или последовательность, с аминокислотной последовательностью SEQ ID NO: 37; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело против триптазы включает одну, две, три или четыре из следующих каркасных областей тяжелой цепи (FR): (a) FR-H1, содержащую аминокислотную последовательность (SEQ ID NO: 38); (b) FR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 42); (с) FR-Н3, содержащую аминокислотную последовательность (SEQ ID NO: 43); и (d) FR-H4, содержащую аминокислотную последовательность (SEQ ID NO: 41). В некоторых вариантах осуществления данного изобретения указанное антитело против триптазы включает одну, две, три или четыре из следующих FR легкой цепи: (a) FR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 64); (b) FR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 65); (с) FR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 66); и (d) FR-L4, содержащую аминокислотную последовательность (SEQ ID NO: 63). В некоторых вариантах осуществления данного изобретения указанное антитело против триптазы включает домен VH, содержащий аминокислотную последовательность SEQ ID NO: 36, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37, например, антитело против триптазы huE104.v2.

В другом конкретном примере в некоторых вариантах осуществления данного изобретения, указанное антитело (например, антитело против триптазы) может включать (a) HVR-H1, содержащую аминокислотную последовательность GYAIT (SEQ ID NO: 30); (b) HVR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 31); (с) HVR-H3, содержащую аминокислотную последовательность (SEQ ID NO: 32); (d) HVR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 33); (е) HVR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 34); и (f) HVR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 35). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью SEQ ID NO: 52; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности) или последовательность, с аминокислотной последовательностью SEQ ID NO: 53; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает одну, две, три или четыре из следующих каркасных областей тяжелой цепи (FR): (a) FR-H1, содержащую аминокислотную последовательность (SEQ ID NO: 54); (b) FR-H2, содержащую аминокислотную последовательность (SEQ ID NO: 55); (с) FR-Н3, содержащую аминокислотную последовательность (SEQ ID NO: 56); и (d) FR-H4, содержащую аминокислотную последовательность (SEQ ID NO: 57). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает одну, две, три или четыре из следующих FR легкой цепи: (a) FR-L1, содержащую аминокислотную последовательность (SEQ ID NO: 67); (b) FR-L2, содержащую аминокислотную последовательность (SEQ ID NO: 68); (c) FR-L3, содержащую аминокислотную последовательность (SEQ ID NO: 69), где X1 представляет собой Cys или Ala; и (d) FR-L4, содержащую аминокислотную последовательность (SEQ ID NO: 70). В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает домен VH, содержащий аминокислотную последовательность SEQ ID NO: 52, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 53, например, антитело Е104. В некоторых вариантах осуществления данного изобретения указанное антитело (например, антитело против триптазы) включает домен VH, содержащий аминокислотную последовательность SEQ ID NO: 52, и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 59.

В некоторых случаях, в данном изобретении предлагается антитело, содержащее (а) тяжелую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 76, и/или (b) легкую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 77. В некоторых случаях указанное антитело содержит тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 76, и легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 77. В некоторых вариантах осуществления данного изобретения тяжелая цепь дополнительно содержит остаток лизина (K) на С-конце.

В некоторых случаях, в данном изобретении предлагается антитело, содержащее (а) тяжелую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 78, и/или (b) легкую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 79. В некоторых случаях указанное антитело содержит тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 78, и легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 79. В некоторых вариантах осуществления данного изобретения тяжелая цепь дополнительно содержит остаток лизина (K) на С-конце.

В некоторых случаях, в данном изобретении предлагается антитело, содержащее (а) тяжелую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 80, и/или (b) легкую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 81. В некоторых случаях указанное антитело содержит тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 80, и легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 81. В некоторых вариантах осуществления данного изобретения тяжелая цепь дополнительно содержит остаток лизина (K) на С-конце.

В некоторых случаях, в данном изобретении предлагается антитело, содержащее (а) тяжелую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 82, и/или (b) легкую цепь, содержащую аминокислотную последовательность, имеющую по меньшей мере 90% идентичности последовательности (например, по меньшей мере 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности последовательности), или последовательность, с аминокислотной последовательностью аминокислотной последовательности SEQ ID NO: 83. В некоторых случаях указанное антитело содержит тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 82, и легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 83. В некоторых вариантах осуществления данного изобретения тяжелая цепь дополнительно содержит остаток лизина (K) на С-конце.

В некоторых случаях любое из вышеописанных антител связывается с эпитопом на триптазе бета 1 человека, содержащим по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Gln100, Leu101 и Leu102 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе бета 1 человека содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать, по меньшей мере двенадцать, по меньшей мере тринадцать или все четырнадцать аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп содержит Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101, Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы бета 1 человека. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к тетрамеру триптазы бета 1 человека и указанный эпитоп на триптазе бета 1 человека дополнительно содержит один или оба из Gln35 и Arg216 SEQ ID NO: 71. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать малую поверхность контакта и/или большую поверхность контакта триптазы бета 1 человека.

В некоторых случаях любое из вышеописанных антител против триптазы включает паратоп, который связывает триптазу (например, триптазу бета 1 человека), которая включает один или большее количество аминокислотных остатков (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 или 16, или 19 аминокислотных остатков), выбранных из группы, состоящей из аминокислотных остатков вариабельной области легкой цепи Tyr29; Asn30; Arg32; и Arg94, и аминокислотных остатков вариабельной области тяжелой цепи Gly31; Tyr32; Ser52; Ser53; Ala54; Thr56; Phe58; Pro96; Arg97; Gly98; Tyr99; и Arg100e.

Например, в некоторых случаях антитело против триптазы включает паратоп, который связывает триптазу (например, триптазу бета 1 человека), которая включает аминокислотные остатки вариабельной области легкой цепи Tyr29; Asn30; Arg32; и Arg94, или аминокислотные остатки вариабельной области тяжелой цепи Gly31; Tyr32; Ser52; Ser53; Ala54; Thr56; Phe58; Pro96; Arg97; Gly98; Tyr99; и Arg100e. В некоторых случаях указанное антитело против триптазы включает паратоп, который связывает триптазу (например, триптазу бета 1 человека), которая включает аминокислотные остатки вариабельной области легкой цепи Tyr29; Asn30; Arg32; и Arg94, и аминокислотные остатки вариабельной области тяжелой цепи Gly31; Tyr32; Ser52; Ser53; Ala54; Thr56; Phe58; Pro96; Arg97; Gly98; Tyr99; и Arg100e.

В некоторых случаях любое из вышеописанных антител против триптазы связывает триптазу человека. В некоторых случаях любое из вышеописанных антител против триптазы связывает триптазу яванского макака (cyno). В некоторых случаях указанное антитело связывает триптазу альфа человека или триптазу бета человека. В некоторых случаях указанное антитело дополнительно связывает триптазу бета 1 человека, триптазу бета 2 человека или триптазу бета 3 человека.

В некоторых аспектах данного изобретения предлагаются антитела против триптазы, которые связываются с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает один или большее количество аминокислотных остатков (например, 1, 2, 3, 4, 5, 6 или 7 аминокислотных остатков), выбранных из группы, состоящей из His51, Val80, Lys81, Asp82, Leu83, Ala84 и Ala85, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. Например, в некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), содержащим по меньшей мере один, по меньшей мере два, по меньшей мере три или все четыре остатка, выбранные из группы, состоящей из His51, Val80, Lys81 и Asp82 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), содержащим His51 и по меньшей мере один, по меньшей мере два или все три остатка, выбранных из группы, состоящей из Val80, Lys81 и Asp82 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе (например, на триптазе бета 1 человека), дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71 или соответствующей аминокислоты любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе (например, на триптазе бета 1 человека) содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать или все двенадцать аминокислотных остатков, выбранных из группы, состоящей из Gln67, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71 или соответствующей аминокислоты любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе (например, на триптазе бета 1 человека) содержит His51, Gln67, Val80, Lys81, Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71 или соответствующую аминокислоту любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы (например, триптазы бета 1 человека). В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать как малую поверхность контакта тетрамерной триптазы, так и большую поверхность контакта тетрамерной триптазы (например, триптазы бета 1 человека).

В еще одном аспекте данного изобретения предлагаются антитела против триптазы, которые связываются с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает один или большее количество аминокислотных остатков, (например, 1, 2, 3, 4, 5, 6 или 7 аминокислотных остатков), выбранных из группы, состоящей из Gln100, Leu101, Leu102, Pro103, Val104, Ser105 и Arg106, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе (например, на триптазе бета 1 человека) дополнительно содержит один или большее количество аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71 или соответствующей аминокислоты любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп на триптазе (например, на триптазе бета 1 человека) содержит по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять, по меньшей мере одиннадцать, по меньшей мере двенадцать, по меньшей мере тринадцать или все четырнадцать аминокислотных остатков, выбранных из группы, состоящей из Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128 и Glu129 SEQ ID NO: 71 или соответствующей аминокислоты любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп содержит Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101, Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129 и Arg216 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к мономеру или тетрамеру триптазы (например, триптазы бета 1 человека). В некоторых вариантах осуществления данного изобретения указанный эпитоп относится к тетрамеру и указанный эпитоп на триптазе (например, на триптазе бета 1 человека) дополнительно содержит один или оба из Gln35 и Arg216 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанный эпитоп определяют с помощью модели по рентгеновской кристаллографии. В некоторых вариантах осуществления данного изобретения указанное антитело способно диссоциировать малую поверхность контакта и/или большую поверхность контакта триптазы (например, триптазы бета 1 человека).

В некоторых вариантах осуществления данного изобретения любое из вышеописанных антител связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает один или большее количество аминокислотных остатков, (например, 1, 2, 3, 4, 5, 6, 7, 8, 10 или 11 аминокислотных остатков), выбранных из группы, состоящей из Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu128 и Glu129, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы.

Например, в некоторых случаях любое из вышеописанных антител связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Gln67 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазы (например, на триптазе бета 1 человека), который включает Asp82 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Leu83 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Ala84 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазы (например, на триптазе бета 1 человека), который включает Arg87 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Pro103 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Val104 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Ser105 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Arg106 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях любое из вышеописанных антител связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Glu128 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Glu129 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы.

В некоторых вариантах осуществления данного изобретения любое из вышеописанных антител связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает два или большее количество, три или большее количество, четыре или большее количество, пять или большее количество, шесть или большее количество, семь или большее количество, восемь или большее количество, девять или большее количество, десять или большее количество или все одиннадцать аминокислотных остатков, выбранных из группы, состоящей из Gln67, Asp82, Leu83, Ala84, Arg87, Pro103, Val104, Ser105, Arg106, Glu128 и Glu129, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы.

В некоторых случаях любое из вышеописанных антител связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает один или большее количество аминокислотных остатков (например, 1, 2, 3, 4 или 5 дополнительных аминокислотных остатков), выбранных из группы, состоящей из His51, Val80, Lys81, Ala85 и Pro130, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. Например, в некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает His51 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Val80 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых вариантах осуществления данного изобретения указанное антитело против триптазы связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Lys81 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Ala85 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Pro130 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы.

В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает два или большее количество, три или большее количество, четыре или большее количество, или пять или большее количество дополнительных аминокислотных остатков, выбранных из группы, состоящей из His51, Val80, Lys81, Ala85 и Pro130, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы.

В некоторых случаях указанное анитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека) который включает His51, Gln67, Val80, Lys81, Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело против триптазы связывается с эпитопом на триптазе (например, на триптазе человека бета 1), который состоит из His51, Gln67, Val80, Lys81, Asp82, Leu83, Ala84, Ala85, Arg87, Pro103, Val104, Ser105, Arg106, Glu128, Glu129 и Pro130 SEQ ID NO: 71.

В некоторых случаях любое из вышеописанных антител против триптазы связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает один или большее количество (например, 1, 2, 3, 4, 5, 6, 7 или 8) дополнительных аминокислотных остатков, выбранных из группы, состоящей из Gln35, Trp55, Gln 100, Leu101, Leu102, Glu126, Leu127 и Arg216, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. Например, в некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Gln35 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Trp55 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Gln100 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Leu101 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Leu102 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Glu126 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Leu127 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает Arg216 SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который дополнительно включает два или большее количество, три или большее количество, четыре или большее количество, пять или большее количество, шесть или большее количество, семь или большее количество, или восемь или большее количество дополнительных аминокислотных остатков, выбранных из группы, состоящей из Gln35, Trp55, Gln100, Leu101, Leu102, Glu126, Leu127 и Arg216, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы.

В некоторых случаях указанное антитело против триптазы связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101, Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129 и Arg216, которые могут относиться к аминокислотной последовательности SEQ ID NO: 71, или соответствующую аминокислоту любого белка триптазы. В некоторых случаях указанное антитело против триптазы связывается с эпитопом на триптазе (например, на триптазе бета 1 человека), который включает Gln35, Trp55, Gln67, Asp82, Leu83, Ala84, Arg87, Gln100, Leu101, Leu102, Pro103, Val104, Ser105, Arg106, Glu126, Leu127, Glu128, Glu129 и Arg216 SEQ ID NO: 71.

В другом аспекте данного изобретения предлагается антитело, которое конкурирует за связывание с триптазой (например, триптазой бета 1 человека) с любым из вышеописанных антител.

В другом аспекте данного изобретения предлагается антитело, которое связывается с тем же эпитопом или перекрывающимся эпитопом, что и любое из вышеописанных антител.

В некоторых вариантах осуществления данного изобретения любое из вышеописанных антител может обладать способностью разрушать триптазу, имеющую тетрамерную структуру (такую как зрелая триптаза, присутствующая в секреторных гранулах тучных клеток или высвобождаемая из них) с образованием частиц с меньшей молекулярной массой, например, мономеров, димеров и/или тримеров.

В дополнительном аспекте антитело согласно любому из вышеупомянутых вариантов осуществления данного изобретения, может обладать любой из характеристик по отдельности или в комбинации, как описано в Разделах 1-7 ниже:

1. Аффинность антитела

В некоторых вариантах осуществления данного изобретения предлагается антитело, имеющее константу диссоциации (KD), составляющую of ≤ 1 мкМ, ≤ 100 нМ, ≤ 10 нМ, ≤ 1 нМ, ≤ 0. 1 нМ, ≤ 0. 01 нМ, ≤ 1 пМ, или ≤ 0. 1 пМ (например, 10-6 М или менее, например, от 10-6 М до 10-9 М или менее, например, от 10-9 М до 10-13 М или менее). В некоторых вариантах осуществления данного изобретения антитело против триптазы по данному изобретению связывается с триптазой (например, триптазой человека, например, триптазой бета человека) со значением KD, составляющим около 100 нМ или ниже (например, 100 нМ или ниже, 10 нМ или ниже, 1 нМ или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу (например, триптазу человека, например, триптазу бета человека) со значением KD, составляющим 10 нМ или ниже (например, 10 нМ или ниже, 1 нМ или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу (например, триптазу человека, например, триптазу бета человека) со значением KD, составляющим 1 нМ или ниже (например, 1 нм или ниже, 100 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже, или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения любое антитело против триптазы, описанное выше или в данном документе, связывается со триптазой (например, триптазой человека, например, триптазой бета человека), со значением KD, составляющим 0,5 нМ или ниже (например, 0,5 нМ или ниже, 400 пМ или ниже, 300 пМ или ниже, 200 пМ или ниже, 100 пМ или ниже, 50 пМ или ниже, 25 пМ или ниже, 10 пМ или ниже, 1 пМ или ниже или 0,1 пМ или ниже). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу (например, триптазу человека, например, триптазу бета человека) со значением KD, составляющим от около 0,1 нМ до около 0,5 нМ (например, около 0,1 нМ, около 0,2 нМ, около 0,3 нМ, около 0,4 нМ или около 0,5 нМ). В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу (например, триптазу человека, например, триптазу бета человека) со значением KD, составляющим около 0,4 нМ. В некоторых вариантах осуществления данного изобретения указанное антитело связывает триптазу (например, триптазу человека, например, триптазу бета человека) со значением KD, составляющим около 0,18 нМ.

В одном варианте осуществления данного изобретения KD измеряют с помощью анализа связывания антигена, меченого радиоактивной меткой (РИА). В одном варианте осуществления данного изобретения РИА выполняют с применением Fab-версии представляющего интерес антитела и его антигена. Например, аффинность связывания Fab с антигеном в растворе измеряют путем уравновешивания Fab с минимальной концентрацией (125I)-меченого антигена в присутствии серии разведений немеченого антигена немеченого антигена с последующим захватом связанного антигена на планшете, покрытом антителом анти-Fab (см., например, Chen et al., J. Mol. Biol. 293: 865-881(1999)). Чтобы определить условия анализа, многолуночные планшеты MICROTITER® (Thermo Scientific) покрывают в течение ночи улавливающим антителом к Fab (Cappel Labs) в концентрации 5 мкг/мл в 50 мМ растворе карбоната натрия (рН 9,6), а затем блокируют 2% (мае. /об.) раствором бычьего сывороточного альбумина в PBS в течение двух-пяти часов при комнатной температуре (около 23°С). В планшете, не содержащем адсорбента (Nunc №269620), смешивают 100 пМ или 26 пМ [1251]-антигена с серийными разведениями Fab, представляющего интерес (например, в соответствии с оценкой антитела против VEGF, Fab-12, описанного в публикации Presta et al., Cancer Res. 57: 4593-4599, 1997). Затем представляющий интерес Fab инкубируют в течение ночи; однако, инкубирование может продолжаться в течение более длительного периода (например, около 65 часов) для гарантии достижения равновесия. После этого смеси переносят в планшет для захвата и инкубируют при комнатной температуре (например, в течение одного часа). После инкубации раствор удаляют, а планшет промывают восемь раз 0,1% раствором полисорбата 20 (TWEEN®-20) в PBS. После высушивания планшетов добавляют 150 мк л/лунку сцинтиллятора (MICROSCINT-20™; Packard) и подсчитывают планшеты на гамма-счетчике TOPCOUNT™ (Packard) в течение десяти минут. Концентрации каждого Fab, обеспечивавшие связывание, меньшее или равное 20% от максимального, отбирают для применения в конкурентном анализе связывания.

В соответствии с другим вариантом осуществления данного изобретения Kd измеряют при помощи метода поверхностного плазмонного резонанса с применением BIACORE®. Например, анализ с применением BIACORE®-2000 или BIACORE®-3000 (BIAcore, Inc., Piscataway, NJ) выполняют при 25°С с чипами с иммобилизованным антигеном СМ5 при около 10 единицах ответа (RU). В одном варианте осуществления данного изобретения биосенсорные чипы на основе карбоксиметилированного декстрана (СМ5, BIACORE, Inc.) активируют гидрохлоридом N-этил-N'-(3-диметиламинопропил)-карбодиимида (EDC) и N-гидроксисукцинимидом (NHS) в соответствии с инструкциями поставщика. Антиген разбавляют 10 мМ раствором ацетата натрия, рН 4. 8, до 5 мк г/мл (~0,2 мкМ) и вводят при скорости потока 5 мкл/минуту, до достижения около 10 единиц ответа (RU) спаренного белка. После введения антигена вводят 1 М раствор этаноламина для блокирования непрореагировавших групп. Для измерения кинетики вводят двукратные серийные разведения Fab (от 0,78 нМ до 500 нМ) в фосфатно-солевом буфере (PBS), с 0,05% поверхностно-активным веществом полисорбатом-20 (TWEEN®-20) (PBST), при 25°С при скорости потока приблизительно 25 мк л/мин. Скорости ассоциации (kon) и диссоциации (koff) рассчитывают с помощью простой взаимно-однозначной модели связывания Ленгмюра (программное обеспечение BIACORE® Evaluation, версия 3. 2) путем одновременной аппроксимации сенсограмм ассоциации и диссоциации. Равновесную константу диссоциации (KD) рассчитывают как соотношение koff/kon. См., например, Chen et al., J. Mol. Biol. 293: 865-881 (1999). Если скорость ассоциации согласно вышеописанному анализу поверхностного плазмонного резонанса превышает 106 М-1 s-1, то ее можно определить с помощью методики гашения флуоресценции, измеряющей увеличение или снижение интенсивности испускания флуоресценции (возбуждение = 295 нм; испускание = 340 нм, полоса пропускания 16 нм) при 25°С для 20 нМ раствора антител против антигена (в форме Fab) в PBS, рН 7,2, в присутствии возрастающих концентраций антигена, измеренных на спектрометре, например, на спектрофотометре с устройством остановки потока (Aviv Instruments) или спектрофотометре SLM-AMINCO™ 8000 серии (ThermoSpectronic) с перемешиваемой кюветой.

В некоторых вариантах осуществления данного изобретения значение KD измеряют с помощью анализа BIACORE® SPR, например, как описано в Примере

1, Раздел (A) (vii). В некоторых вариантах осуществления данного изобретения для анализа SPR можно применять BIAcore® Т200 или эквивалентное устройство. В некоторых вариантах осуществления данного изобретения сенсорные чипы BIAcore® серии S СМ5 (или эквивалентные сенсорные чипы) иммобилизируют моноклональным мышиным антителом против IgG (Fc) человека, и антитела против триптазы впоследствии захватываются в проточной ячейке. Последовательные 3-кратные разведения His-меченого мономера триптазы бета 1 человека (SEQ ID NO: 128) вводят при скорости потока 30 мкл/мин. Каждый образец анализируют с 3-минутной ассоциацией и 10-минутной диссоциацией. Анализ проводят при 25°С. После каждого введения чип регенерируют с применением 3 М MgCl2. Ответ связывания корректируют путем вычитания единиц ответа (RU) из проточной ячейки, захватывающей нерелевантный IgG с аналогичной плотностью. Для анализа кинетики применяют модель Ленгмюра 1:1 одновременной подгонки kon и koff.

2. Фрагменты антитела

В некоторых вариантах осуществления данного изобретения антитело, предлагаемое в данном документе, представляет собой фрагмент антитела. Фрагменты антител включают, но не ограничиваются перечисленным, фрагменты Fab, Fab', Fab'-SH, F(ab')2 Fv и scFv, а также другие фрагменты, описанные ниже. Обзор некоторых фрагментов антител см. в публикации Hudson et al. Nat. Med. 9: 129-134 (2003). Для обзора фрагментов scFv см., например, Pluckthun, в The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), стр. 269-315, 1994; см. также WO 93/16185; патенты США №№5571894 и 5587458. Описание Fab- и F(ab')2-фрагментов, содержащих остатки эпитопа связывания рецептора реутилизации, и характеризующихся увеличенным периодом полувыведения in vivo, см. в патенте США №5869046.

Диатела представляют собой фрагменты антител, содержащие два антигенсвязывающих сайта, и могут быть двухвалентными или биспецифическими. См., например, ЕР 404,097; WO 1993/01161; Hudson et al. Nat. Med. 9: 129-134, 2003; и Hollinger et al. Proc. Natl. Acad. Sci. USA 90: 6444-6448,1993. Триатела и тетратела также описаны в публикации Hudson et al. Nat. Med. 9: 129-134, 2003.

Однодоменные антитела представляют собой фрагменты антител, содержащие весь вариабельный домен тяжелой цепи антитела или его часть, или весь вариабельный домен легкой цепи антитела или его часть. В некоторых вариантах осуществления данного изобретения однодоменное антитело представляет собой однодоменное антитело человека (см., например, патент США №6248516 В1).

Фрагменты антител могут быть получены различными методами, включая, но не ограничиваясь этим, в результате протеолитического расщепления интактного антитела, а также продукции рекомбинантных клеток-хозяев (например, Е. coli или фага), как описано в данном документе.

3. Химерные и гуманизированные антитела

В определенных вариантах осуществления данного изобретения антитело, предлагаемое в данном документе, представляет собой химерное антитело. Некоторые химерные антитела описаны, например, в патенте США №4816567 и в публикации Morrison et al. Proc. Natl. Acad. Sci. USA, 81: 6851-6855, 1984). В одном примере химерное антитело содержит вариабельную область нечеловеческого происхождения (например, вариабельную область, происходящую от антитела мыши, крысы, хомяка, кролика или примата, не являющегося человеком, например, обезьяны) и константную область человека. В еще одном примере химерное антитело представляет собой антитело с "переключенным классом", в котором изменен класс или подкласс по сравнению с родительским антителом. Термин "химерные антитела" включает антигенсвязывающие фрагменты таких антител.

В некоторых вариантах осуществления данного изобретения химерное антитело представляет собой гуманизированное антитело. Как правило, антитело нечеловеческого происхождения гуманизируют с целью снижения иммуногенности для людей, сохраняя при этом специфичность и аффинность исходного антитела нечеловеческого происхождения. Как правило, гуманизированное антитело содержит один или большее количество вариабельных доменов, в которых HVR (или их фрагменты) происходят от антитела нечеловеческого происхождения, a FR (или их фрагменты) происходят от последовательностей антитела человека. В некоторых случаях гуманизированное антитело также содержит по меньшей мере фрагмент константной области антитела человека. В некоторых вариантах осуществления данного изобретения некоторые FR остатки гуманизированного антитела заменены соответствующими остатками из антитела нечеловеческого происхождения (например, антитела, из которого получены остатки HVR), например, для восстановления или улучшения специфичности антитела или аффинности.

Гуманизированные антитела и способы их изготовления рассмотрены, например, в публикации Almagro et al. Front. Biosci. 13: 1619-1633 (2008), и дополнительно описаны, например, в публикации Riechmann et al. Nature 332: 323-329, 1988; Queen et al. Proc. Natl. Acad. Sci. USA 86: 10029-10033, 1989; в патентах США №№5821337, 7527791, 6982321 и 7087409; Kashmiri et al. Methods 36: 25-34, 2005 (описание прививания области, определяющей специфичность (SDR)); Padlan, Mol. Immunol. 28: 489-498, 1991 (описание "изменения поверхности"); et al. Methods 36: 43-60, 2005 (описание "перетасовки FR"); и Osbourn et al. Methods 36: 61-68, 2005, а также Klimka et al. Br. J. Cancer, 83: 252-260, 2000 (описание подхода "направленной селекции" к перетасовке FR).

Каркасные области человека, которые можно применять для гуманизации, включают в себя, но не ограничиваются ими: каркасные области, выбранные с помощью методики «наилучшего соответствия» (см., например,, Sims et al. J. Immunol. 151: 2296, 1993); каркасные области, происходящие от консенсусной последовательности антител человека конкретной подгруппы вариабельных областей легкой или тяжелой цепи (см., например,, Carteret al. Proc. Natl. Acad. Sci. USA, 89: 4285 (1992); и Presta et al. J. Immunol., 151: 2623 (1993)); зрелые (содержащие соматические мутации) каркасные области человека или эмбриональные каркасные области человека (см., например, Almagro et al. Front. Biosci. 13: 1619-1633, 2008); и каркасные области, полученные в результате скрининга библиотек FR (см., например, Baca et al. J. Biol. Chem. 272: 10678-10684, 1997 и Rosoket al., J. Biol. Chem. 271: 22611-22618, 1996).

4. Антитела человека

В определенных вариантах осуществления данного изобретения антитело, предлагаемое в данном документе, представляет собой антитело человека. Антитела человека можно получить, используя различные методики, известные в данной области техники. Антитела человека описаны в общих чертах в публикации van Dijk et al. Curr. Opin. Pharmacol. 5: 368-74 (2001) и Lonberg, Curr. Opin. Immunol. 20: 450-459, 2008.

Антитела человека можно получить путем введения иммуногена трансгенному животному, модифицированному с целью придания ему способности продуцировать интактные антитела или интактные антитела, содержащие вариабельные области человека, в ответ на введение антигена. Такие животные обычно содержат все или часть локусов иммуноглобулинов человека, которые заменяют эндогенные локусы иммуноглобулинов, или которые присутствует вне хромосом, или интегрируются случайным образом в хромосомы животного. В таких трансгенных мышей эндогенные иммуноглобулиновые локусы, как правило, были инактивированы. Обзор способов получения антител человека из трансгенных животных см. в публикации Lonberg, Nat. Biotech. 23: 1117-1125, 2005. См., например, патенты США №№6075181 и 6150584. в которых описана методика XENOMOUSE™; патент США №5770429, в котором описана методика HUMAB®; патент США №7041870, в котором описана методика K-М MOUSE®, ии публикацию заявки на патент США №2007/0061900, в которой описана методика VELOCIMOUSE® Вариабельные области человека из интактных антител, генерируемых такими животными, можно дополнительно модифицировать, например, путем объединения с другой константной областью человека.

Антитела человека также можно получить с помощью гибридомных способов. Описаны человеческие миеломные и мышино-человеческие гетеромиеломные клеточные линии, применяемые для получения человеческих моноклональных антител. (См., например, Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); и Boerner et al., J. Immunol. 147: 86, 1991). Антитела человека, полученные посредством технологии на основе В-клеточной гибридомы человека, также описаны в публикации Li et al., Proc. Natl. Acad. Sci. USA, 103: 3557-3562, 2006. Дополнительные способы включают в себя описанные, например, в патенте США 7189826 (в котором описано получение моноклональных антител IgM человека из гибридомных клеточных линий) и в публикации Ni, Xiandai Mianyixue, 26(4): 265-268, 2006 (в которой описаны полностью человеческие гибридомы). Методика на основе гибридомы человека (методика Trioma) также описана в публикациях Vollmers and Brandlein, Histology and Histopathology, 20(3): 927-937 (2005) и Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3): 185-91 (2005).

Антитела человека также можно получить путем выделения Fv-клона последовательностей вариабельного домена, выбранных из библиотек фагового дисплея человеческого происхождения. Такие последовательности вариабельного домена можно затем объединить с желательным константным доменом человека. Методики отбора антител человека из библиотек антител описаны ниже.

5. Антитела, полученные из библиотек

Антитела по данному изобретению можно выделить путем скрининга комбинаторных библиотек на предмет антител, обладающих желательной активностью или желательными активностями. Например, в данной области техники известны различные способы для создания библиотек фагового дисплея и скрининга таких библиотек на предмет антител, обладающих желательными характеристиками связывания. Такие способы рассмотрены, например, в публикации Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 ( et al., ed., Human Press, Totowa, NJ, 2001), и дополнительно описаны, например, в статьях McCafferty et al., Nature 348: 552-554, 1990; Clackson et al., Nature 352: 624-628, 1991; Marks et al. J. Mol. Biol. 222: 581-597, 1992; Marks et al. в Methods in Molecular Biology 248: 161-175 (Lo, ed., Human Press, Totowa, NJ, 2003); Sidhu et al. J. Mol. Biol. 338(2): 299-310, 2004; Lee et al. J. Mol. Biol. 340(5): 1073-1093, 2004; Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472, 2004; и Lee et al. J. Immunol. Methods 284(1-2): 119-132, 2004.

В некоторых способах на основе фагового дисплея репертуары VH- и VL-генов по отдельности клонировали с помощью полимеразной цепной реакции (ПЦР) и случайным образом рекомбинировали в фаговых библиотеках, которые затем можно подвергать скринингу на предмет антигенсвязывающего фага, как описано в публикации Winter et al., Ann. Rev. Immunol., 12: 433-455, 1994. Как правило, фаг отображает фрагменты антител либо в виде одноцепочечных фрагментов Fv (scFv), либо в виде фрагментов Fab. Библиотеки, полученные из иммунизированных источников, содержат антитела, обладающие высокой аффинностью к иммуногену, следовательно, необходимость конструирования гибридом отпадает. В качестве альтернативы, можно клонировать наивный репертуар (например, человека) для получения единого источника антител к широкому спектру чужеродных антигенов и аутоантигенов без иммунизации, как описано в публикации Griffiths et al., EMBO J, 12: 725-734, 1993. Наконец, наивные библиотеки можно также получить путем синтеза, клонируя сегменты V-генов стволовых клеток, не подвергавшиеся реаранжировке, и применяя ПЦР-праймеры, содержащие случайные последовательности, для кодирования гипервариабельной области HVR3 и осуществления реаранжировки in vitro, как описано в публикации Hoogenboom et al. J. Mol. Biol., 227: 381-388, 1992. Патентные публикации, в которых описаны фаговые библиотеки антител человека включают, например: патент США №5750373 и патентные публикации США №№2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936 и 2009/0002360.

Антитела или фрагменты антител, выделенные из библиотек антител человека, в данном документе считаются антителами человека или фрагментами антител человека.

6. Мультиспецифические антитела В некоторых вариантах осуществления данного изобретения антитело, предлагаемое в данном документе, представляет собой мультиспецифическое антитело, например, биспецифическое антитело. Мультиспецифические антитела представляют собой моноклональные антитела, которые содержат по меньшей мере два разных сайта специфического связывания. В некоторых вариантах осуществления данного изобретения биспецифические антитела могут связываться с двумя различными эпитопами триптазы. В некоторых вариантах осуществления данного изобретения одна из специфичностей связывания относится к триптазе, а другая - к любому другому антигену (например, второй биологической молекуле). В некоторых вариантах осуществления данного изобретения биспецифические антитела могут связываться с двумя различными эпитопами триптазы. В других вариантах осуществления данного изобретения одна из специфичностей связывания относится к триптазе (например, триптазе человека, например, триптазе бета человека), а другая относится к любому другому антигену (например, второй биологической молекуле, например, IL-13, IL-4, IL-5, IL-17, IL-33, IgE, основной М1, CRTH2 или TRPA). Соответственно, биспецифическое антитело может иметь специфичность связывания для триптазы и IL-13; триптазы и IL-4; триптазы и IL-5; триптазы и IL-17 или триптазы и IL-33. В частности, биспецифическое антитело может иметь специфичность связывания для триптазы и IL-13 или триптазы и IL-33. Биспецифические антитела можно получить в виде полноразмерных антител или в виде фрагментов антител.

Например, в некоторых случаях биспецифическое антитело включает первый связывающий домен, который связывает триптазу, и второй связывающий домен, который связывает IL-13. В некоторых вариантах осуществления данного изобретения первый связывающий домен, который связывает триптазу, может включать, например, по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных областей (HVR), выбранных из: (a) HVR-H1, содержащей аминокислотную последовательность X1X2GMX3 (SEQ ID NO: 1), где X1 представляет собой Asp или Ser, Х2 представляет собой Tyr или Phe, и Х3 представляет собой Val или His; (b) HVR-H2, содержащей аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащей аминокислотную последовательность RX1X2X3DWYFDV (SEQ ID NO: 3), где X1 представляет собой Asn или Asp, Х2 представляет собой Tyr или Asn, и Х3 представляет собой Asp или Tyr; (d) HVR-L1, содержащей аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащей аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащей аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6) или комбинацию одной или большего количества из указанных выше HVR и одного или большего количества их вариантов, имеющих по меньшей мере около 80% идентичности последовательности (например, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности) к любой из SEQ ID NO: 1-6. В некоторых случаях второй связывающий домен, который связывается с IL-13, может, например, включать по меньшей мере одну, две, три, четыре, пять или шесть HVR, выбранных из (a) HVR-Н1, содержащей аминокислотную последовательность AYSVN (SEQ ID NO: 84), (b) HVR-H2, содержащей аминокислотную последовательность MIWGDGKIVYNSALKS (SEQ ID NO: 85); (c) HVR-H3, содержащей аминокислотную последовательность DGYYPYAMDN (SEQ ID NO: 86); (d) HVR-L1, содержащей аминокислотную последовательность RASKSVDSYGNSFMH (SEQ ID NO: 87); (e) HVR-L2, содержащей аминокислотную последовательность LASNLES (SEQ ID NO: 88); и (f) HVR-L3, содержащей аминокислотную последовательность QQNNEDPRT (SEQ ID NO: 89), или комбинацию одной или большего количества из указанных выше HVR и одного или большего количества их вариантов, имеющих по меньшей мере около 80% идентичности последовательности (например, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности) к любой из SEQ ID NO: 84-89. В некоторых вариантах осуществления данного изобретения второй связывающий домен содержит одну, две, три, четыре, пять или шесть HVR антитела против IL-13 лебрикизумаба.

Например, в некоторых случаях первый связывающий домен, который связывает триптазу, содержит, например, по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных областей (HVR), выбранных из: (a) HVR-H1, содержащей аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащей аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащей аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащей аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащей аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащей аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6), например, антитело hu31A.v11. В некоторых случаях второй связывающий домен, который связывается с IL-13, может, например, содержать по меньшей мере одну, две, три, четыре, пять или шесть HVR, выбранных из (a) HVR-H1, содержащей аминокислотную последовательность AYSVN (SEQ ID NO: 84), (b) HVR-H2, содержащей аминокислотную последовательность MIWGDGKIVYNSALKS (SEQ ID NO: 85); (с) HVR-H3, содержащей аминокислотную последовательность DGYYPYAMDN (SEQ ID NO: 86); (d) HVR-L1, содержащей аминокислотную последовательность RASKSVDSYGNSFMH (SEQ ID NO: 87); (e) HVR-L2, содержащей аминокислотную последовательность LASNLES (SEQ ID NO: 88); и (f) HVR-L3, содержащей аминокислотную последовательность QQNNEDPRT (SEQ ID NO: 89). В некоторых вариантах осуществления данного изобретения второй связывающий домен содержит одну, две, три, четыре, пять или шесть HVR антитела против IL-13 лебрикизумаба. В некоторых вариантах осуществления данного изобретения первый связывающий домен содержит аминокислотную последовательность VH и/или VL антитела hu31A.v11, а второй связывающий домен содержит аминокислотную последовательность VH и/или VL антитела против IL-13 лебрикизумаба.

Любое из вышеописанных биспецифичных антител против триптазы/против IL-13 может включать первый связывающий домен, который связывает триптазу, включающий (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с, или последовательность SEQ ID NO: 9, и/или (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с, или последовательность SEQ ID NO: 10; или (с) домен VH, как в (а), и домен VL, как в (b). Любое из вышеописанных биспецифичных антител против триптазы/против IL-13 может включать второй связывающий домен, который связывается с IL-13, включающий (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с или последовательность SEQ ID NO: 90 или SEQ ID NO: 114, и/или (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с, или последовательность SEQ ID NO: 91 или SEQ ID NO: 115; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых случаях второй связывающий домен содержит домен VH и/или VL лебрикизумаба.

В другом примере, в некоторых случаях биспецифическое антитело включает первый связывающий домен, который связывает триптазу, и второй связывающий домен, который связывает IL-33. Второй связывающий домен, который связывает IL-33, может включать любое из антител против IL-33, описанных, например, в патентной публикации США №2016/0168242, содержание которой включено в данный документ посредством ссылки в полном объеме. В некоторых вариантах осуществления данного изобретения первый связывающий домен, который связывает триптазу, может включать, например, по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных областей (HVR), выбранных из: (a) HVR-H1, содержащей аминокислотную последовательность X1X2GMX3 (SEQ ID NO: 1), где X1 представляет собой Asp или Ser, Х2 представляет собой Tyr или Phe, и Х3 представляет собой Val или His; (b) HVR-H2, содержащей аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащей аминокислотную последовательность RX1X2X3DWYFDV (SEQ ID NO: 3), где X1 представляет собой Asn или Asp, Х2 представляет собой Tyr или Asn, и Х3 представляет собой Asp или Tyr; (d) HVR-L1, содержащей аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащей аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащей аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6) или комбинацию одной или большего количества из указанных выше HVR и одного или большего количества их вариантов, имеющих по меньшей мере около 80% идентичности последовательности (например, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности) к любой из SEQ ID NO: 1-6. В некоторых случаях второй связывающий домен, который связывается с IL-33, может, например, включать по меньшей мере одну, две, три, четыре, пять или шесть HVR, выбранных из (a) HVR-Н1, содержащей аминокислотную последовательность SFSMS (SEQ ID NO: 120); (b) HVR-H2, содержащей аминокислотную последовательность TISGGKTFTDYVDSVKG (SEQ ID NO: 121); (с) HVR-H3, содержащей аминокислотную последовательность ANYGNWFFEV (SEQ ID NO: 122); (d) HVR-L1, содержащей аминокислотную последовательность RASESVAKYGLSLLN (SEQ ID NO: 123); (е) HVR-L2, содержащей аминокислотную последовательность AASNRGS (SEQ ID NO: 124); и (f) HVR-L3, содержащей аминокислотную последовательность QQSKEVPFT (SEQ ID NO: 125) или комбинацию одной или большего количества из указанных выше HVR и одного или большего количества их вариантов, имеющих по меньшей мере около 80% идентичности последовательности (например, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичности) к любой из SEQ ID NO: 120-125. В некоторых вариантах осуществления данного изобретения второй связывающий домен содержит одну, две, три, четыре, пять или шесть HVR антитела 10С12. 38. Н6. 87Y. 58I против IL-33.

Например, в некоторых случаях первый связывающий домен, который связывает триптазу, содержит, например, по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных областей (HVR), выбранных из: (a) HVR-H1, содержащей аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащей аминокислотную последовательность

FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-H3, содержащей аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащей аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (е) HVR-L2, содержащей аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащей аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6), например, антитело hu31A.v11. В некоторых случаях второй связывающий домен, который связывается с IL-33, может, например, содержать по меньшей мере одну, две, три, четыре, пять или шесть HVR, выбранных из (a) HVR-H1, содержащей аминокислотную последовательность SFSMS (SEQ ID NO: 120); (b) HVR-H2, содержащей аминокислотную последовательность TISGGKTFTDYVDSVKG (SEQ ID NO: 121); (с) HVR-H3, содержащей аминокислотную последовательность ANYGNWFFEV (SEQ ID NO: 122); (d) HVR-L1, содержащей аминокислотную последовательность RASESVAKYGLSLLN (SEQ ID NO: 123); (е) HVR-L2, содержащей аминокислотную последовательность AASNRGS (SEQ ID NO: 124); и (f) HVR-L3, содержащей аминокислотную последовательность QQSKEVPFT (SEQ ID NO: 125). В некоторых вариантах осуществления данного изобретения второй связывающий домен содержит одну, две, три, четыре, пять или шесть HVR антитела 10С12. 38. Н6. 87Y. 58I против IL-33. В некоторых вариантах осуществления данного изобретения первый связывающий домен содержит аминокислотную последовательность VH и/или VL антитела hu31A.v11, а второй связывающий домен содержит аминокислотную последовательность VH и/или VL антитела 10С12. 38. Н6. 87Y. 58I против IL-33.

Любое из вышеописанных биспецифичных антител против триптазы/против IL-33 может включать первый связывающий домен, который связывает триптазу, включающий (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с, или последовательность SEQ ID NO: 9, и/или (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с, или последовательность SEQ ID NO: 10; или (с) домен VH, как в (а), и домен VL, как в (b). Любое из вышеописанных биспецифичных антител против триптазы/против IL-33 может включать второй связывающий домен, который связывается с IL-33, включающий (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с или последовательность SEQ ID NO: 126, и/или (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 80% (например, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99%) идентичность последовательности с, или последовательность SEQ ID NO: 127; или (с) домен VH, как в (а), и домен VL, как в (b). В некоторых случаях второй связывающий домен содержит домен VH и/или VL антитела 10С12. 38. Н6. 87Y. 58I.

Методики получения мультиспецифических антител включают, но не ограничиваются ими, рекомбинантную совместную экспрессию двух пар "тяжелая цепь - легкая цепь иммуноглобулина" с различной специфичностью (см. Milstein et al. Nature 305: 537, 1983; WO 93/08829; и Trauneckeret al. EMBO J. 10: 3655, 1991), и инженерию согласно принципу "выступ-во-впадину" (см., например, патент США №5731168). Мультиспецифические антитела также можно получить за счет конструирования электростатических направляющих эффектов для создания гетеродимерных молекул на основе Fc антител (WO 2009/089004 А1); перекрестного сшивания двух или большего количества антител или фрагментов (см., например, патент США №4676980, и Brennan et al., Science, 229: 81, 1985 применения лейциновых "молний" для получения биспецифических антител (см., например, публикацию Kostelny et al., J. Immunol., 148(5): 1547-1553 (1992)); применения технологии "диател" для изготовления биспецифических фрагментов антител (см., например, публикацию Hollinger et al., Proc. Natl. Acad. Sci. USA, 90: 6444-6448 (1993)); и применения одноцепочечных Fv- (sFv-) димеров (см., например, публикацию Gruber et al., J. Immunol., 152: 5368 (1994)); и получения триспецифических антител, как описано, например, в публикации Tutt et al. J. Immunol. 147: 60, 1991.

В данный документ также включено конструирование антител с тремя или большем количеством функциональных антигенсвязывающих сайтов, включая "антитела-осьминоги" (см., например, US 2006/0025576 А1).

В данном документе антитело или его фрагмент также включает "Fab двойного действия" или "DAF", содержащее антигенсвязывающий сайт, который связывается с триптазой, а также еще одним, отличающимся от него, антигеном (см., например, US 2008/0069820).

Выступы-во-впадины

Применение принципа "выступы-во-впадины" в качестве способа получения мультиспецифических антител описано, например, в патенте США №5731168, WO 2009/089004, US 2009/0182127, US 2011/0287009, Marvin and Zhu, Acta Pharmacol. Sin. (2005) 26(6): 649-658 и Kontermann (2005) Acta Pharmacol. Sin. 26:1-9. Ниже приводится краткое не ограничивающее обсуждение.

"Выступ" относится к по меньшей мере одной аминокислотной боковой цепи, которая выступает из поверхности взаимодействия первого полипептида и, следовательно, позиционируемая с компенсационной полостью на прилегающей поверхности взаимодействия (например, поверхности взаимодействия второго полипептида), с тем чтобы стабилизировать гетеромультимер, и тем самым сдвинуть равновесие в пользу образования гетеромультимеров вместо образования гомомультимеров, например. Выступ может существовать в природной поверхности взаимодействия или может быть введен искусственно (например, путем изменения нуклеиновых кислот, кодирующих поверхность взаимодействия). В некоторых вариантах осуществления данного изобретения, нуклеиновую кислоту, кодирующую поверхность взаимодействия первого полипептида изменяют для кодирования выступа. Для достижения этой цели нуклеиновую кислоту, кодирующую по меньшей мере один "оригинальный" аминокислотный остаток на поверхности взаимодействия первого полипептида, заменяют нуклеиновой кислотой, кодирующей по меньшей мере один "импортированный" аминокислотный остаток, который имеет больший объем боковой цепи, чем "оригинальный" аминокислотный остаток. Следует понимать, что может быть более одного оригинального и соответствующего импортированного остатка. Размеры боковой цепи различных аминокислотных остатков приведены в Таблице 1 US 2011/0287009 или в Таблице 1 патента США №7642228.

В некоторых вариантах осуществления данного изобретения импортированные остатки для образования выступа представляют собой встречающиеся в природе аминокислотные остатки, выбранные из аргинина (R), фенилаланина (F), тирозина (Y) и триптофана (W). В некоторых вариантах осуществления данного изобретения импортированный остаток представляет собой триптофан или тирозин. В некоторых вариантах осуществления данного изобретения оригинальный остаток для формирования выступа имеет небольшой объем боковой цепи, например, аланин, аспарагин, аспарагиновая кислота, глицин, серии, треонин или валин. См., например, патент США №7642228.

"Полость" относится к по меньшей мере одной аминокислотной боковой цепи, которая утоплена в поверхность взаимодействия второго полипептида и, следовательно, вмещает соответствующий выступ на прилегающей поверхности взаимодействия первого полипептида. Полость может существовать в природной поверхности взаимодействия или может быть введена искусственно (например, путем изменения нуклеиновых кислот, кодирующих поверхность взаимодействия). В некоторых вариантах осуществления данного изобретения, нуклеиновую кислоту, кодирующую поверхность взаимодействия второго полипептида изменяют для кодирования полости. Для достижения этой цели нуклеиновую кислоту, кодирующую по меньшей мере один "оригинальный" аминокислотный остаток на поверхности взаимодействия второго полипептида, заменяют ДНК, кодирующей по меньшей мере один "импортированный" аминокислотный остаток, который имеет меньший объем боковой цепи, чем "оригинальный" аминокислотный остаток. Следует понимать, что может быть более одного оригинального и соответствующего импортированного остатка. В некоторых вариантах осуществления данного изобретения введенные остатки для формирования полости представляют собой природные аминокислотные остатки, выбранные из аланина (А), серина (S), треонина (Т) и валина (V). В некоторых вариантах осуществления данного изобретения импортированный остаток представляет собой серии, аланин или треонин. В некоторых вариантах осуществления данного изобретения оригинальный остаток для формирования полости имеет большой объем боковой цепи, например, тирозин, аргинин, фенилаланин или триптофан.

Выступ является "позиционируемым" в полости, что означает, что пространственное расположение выступа и полости на поверхности взаимодействия первого полипептида и второго полипептида, соответственно, и размеры выступа и полости таковы, что выступ может быть расположен в полости без значительного нарушения нормальной ассоциации первого и второго полипептидов на поверхности взаимодействия. Поскольку выступы, такие как Tyr, Phe и Trp, как правило, не проходят перпендикулярно от оси поверхности взаимодействия и имеют предпочтительные конформации, выравнивание выступа с соответствующей полостью может в некоторых случаях основываться на моделировании пары "выступ/полость" на основе трехмерной структуры, такой как структура, полученная с помощью рентгеновской кристаллографии или ядерного магнитного резонанса (ЯМР). Этого можно достичь с помощью широко распространенных в данной области техники методов.

В некоторых вариантах осуществления данного изобретения мутация выступа в константной области IgG1 представляет собой T366W. В некоторых вариантах осуществления данного изобретения мутация впадины в константной области IgG1 содержит одну или большее количество мутаций, выбранных из T366S, L368A и Y407V. В некоторых вариантах осуществления данного изобретения мутация впадины в константной области IgG1 содержит T366S, L368A и Y407V.

В некоторых вариантах осуществления данного изобретения мутация выступа в константной области IgG4 представляет собой T366W. В некоторых вариантах осуществления данного изобретения мутация впадины в константной области IgG4 содержит одну или большее количество мутаций, выбранных из T366S, L368A и Y407V. В некоторых вариантах осуществления данного изобретения мутация впадины в константной области IgG4 содержит T366S, L368A и Y407V.

7. Варианты антител В некоторых вариантах осуществления данного изобретения рассматриваются варианты аминокислотных последовательностей антител, предложенных в данном документе. Например, может быть желательным улучшение аффинности и/или других биологических свойств антитела, такой как ингибирующая активность. Варианты аминокислотных последовательностей антител можно получить путем введения соответствующих модификаций в нуклеотидную последовательность, кодирующую антитело, или путем пептидного синтеза. Такие модификации содержат, например, делеции и/или вставки и/или замены остатков в аминокислотных последовательностях антитела. Для получения конечной конструкции можно проводить любые комбинации делеций, вставок и замен, при условии, что конечная конструкция обладает необходимыми характеристиками, например, антигенсвязывающими.

а) Варианты, полученные в результате замен, вставок и делеций

В некоторых вариантах осуществления данного изобретения предлагаются варианты антител, содержащие одну или большее количество аминокислотных замен. Участки, представляющие интерес с точки зрения заместительного мутагенеза, включают HVR и FR. Консервативные замены приведены в Таблице 1 под заголовком "предпочтительные замены". Более существенные изменения приведены в Таблице 1 под заголовком "типовые замены" и подробнее описаны ниже по отношению к классам боковой цепи аминокислот. Аминокислотные замены могут быть введены в антитело, представляющее интерес, а полученные продукты подвергнуты скринингу на предмет выявления желаемой активности, например, сохраненного/улучшенного связывания антигена, снижения иммуногенности или оптимизированной АЗКЦ или КЗЦ.

Аминокислоты можно сгруппировать по общим свойствам боковой цепи:

(1) гидрофобные: норлейцин, Met, Ala, Val, Leu, Ile;

(2) нейтральные гидрофильные: Cys, Ser, Thr, Asn, Gln;

(3) кислые: Asp, Glu;

(4) основные: His, Lys, Arg;

(5) остатки, влияющие на ориентацию цепи: Gly, Pro;

(6) ароматические: Trp, Tyr, Phe.

Неконсервативные замены приводят к замене представителя одного из этих классов на представителя другого класса.

Один из вариантов замены включает замену одного или большего количества аминокислотных остатков гипервариабельной области родительского антитела (например, гуманизированного или человеческого антитела). Как правило, полученный вариант(ы), выбранный для дальнейшего изучения, будет иметь модификации (например, улучшения) определенных биологических свойств (например, повышенную аффинность, пониженную иммуногенность) по сравнению с родительским антителом, и/или будет иметь по существу сохраненные определенные биологические свойства родительского антитела. Типовой вариант, получаемый путем замены, представляет собой антитело со зрелой аффинностью, который может быть беспрепятственно получен, например, с применением методик созревания аффинности на основе фагового дисплея, таких как описанные в данном документе. Вкратце, один или большее количество остатков HVR подвергают мутации, а вариантные антитела подвергают фаговому дисплею и скринингу на предмет конкретной биологической активности (например, аффинности связывания).

Модификации (например, замены) в HVR можно осуществить, например, с целью улучшения аффинности антитела. Такие модификации можно внести в "горячие точки" HVR, то есть остатки, кодируемые кодонами, с высокой частотой подвергающимися мутациям во время соматического созревания (см., например, Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), и/или в остатки, которые связываются с антигеном, с тестированием аффинности связывания полученного варианта VH или VL. Созревание аффинности путем конструирования и повторного отбора из вторичных библиотек было описано, например, в публикации Methods in Molecular Biology 178: 1-37 ( et al., ed., Human Press, Totowa, NJ, 2001). В некоторых вариантах осуществления созревания аффинности вносят разнообразие в вариабельные гены, выбранные для созревания с помощью одного из ряда способов (например, ПЦР пониженной точности, перетасовки цепей или олигонуклеотид-направленного мутагенеза). Затем создают вторичную библиотеку. После этого библиотеку подвергают скринингу для выявления вариантов антитела с желательной аффиностью. Другой способ для внесения разнообразия включает подходы, направленные на HVR, в которых несколько аминокислотных остатков HVR (например, 4-6 аминокислотных остатков подряд) являются рандомизированными. Остатки HVR, участвующие в связывании антигена, можно специфически определить, например, с помощью мутагенеза с аланиновым сканированием или моделированием. При этом мишенями часто являются HVR-H3 и HVR-L3.

В определенных вариантах осуществления данного изобретения замены, вставки или делеции могут находиться в одной или большем количестве HVR до той меры, пока такие изменения существенно не снижают способность антитела связывать антиген. Например, в HVR можно проводить консервативные замены (например, консервативные замены, предложенные в данном документе), которые по существу не снижают аффинность связывания. Такие изменения могут быть, например, за пределами остатков, контактирующих с антигеном, в HVR. В определенных вариантах осуществления вариантов последовательностей VH и VL, приведенных выше, каждая HVR является либо не измененной, либо содержит не более одной, двух или трех аминокислотных замен.

Пригодным способом выявления остатков или областей антитела, которые могут быть мишенями для мутагенеза, является "аланин-сканирующий мутагенез", описанный Cunningham et al. Science 244: 1081-1085, 1989. В данном способе выявляют остаток или группу остатков-мишеней (например, заряженных остатков, таких как Arg, Asp, His, Lys и Glu) и замещают их нейтральными или отрицательно заряженными аминокислотами (например, аланином или полиаланином) с целью определить, влияет ли это на взаимодействие антитела с антигеном. В аминокислотные положения, демонстрирующие функциональную чувствительность к первоначальной замене, можно ввести дальнейшие замены. В альтернативном или дополнительном варианте для выявления точек контакта между антителом и антигеном используют кристаллическую структуру комплекса антиген-антитело. Такие контактные или соседние с ними остатки можно применять в качестве мишеней для замены, или они могут не рассматриваться как кандидаты для замены. Варианты можно подвергнуть скринингу, чтобы определить, обладают ли они желательными свойствами.

Вставки в аминокислотную последовательность включают амино и/или карбокси концевые слияния длиной от одного остатка до полипептидов, содержащих сто или более остатков, а также вставки одного или множества аминокислотных остатков внутри последовательности. Примеры концевых вставок включают антитело с N-концевым остатком метионина. Другие вставочные варианты молекулы антитела включают слияние с N- или С-концом антитела с ферментом (например, для ADEPT) или полипептидом, который увеличивает период полужизни антитела в сыворотке.

b) Варианты, полученные в результате гликозилирования

В некоторых вариантах осуществления данного изобретения предложенное в данном документе антитело модифицируют с целью увеличения или уменьшения степени гликозилирования антитела. Добавление или удаление участков гликозилирования в антитело может быть с легкостью осуществлено путем изменения аминокислотной последовательности, в результате чего создается или удаляется один или большее количество участков гликозилирования.

Если антитело содержит Fc-область, можно изменить присоединенный к ней углевод. Нативные антитела, продуцируемые клетками млекопитающих, как правило, содержат разветвленный двухантенарный олигосахарид, обычно присоединенный с помощью N-связи к Asn297 в СН2-домене Fc-области. См., например, Wright et al. TIBTECH 15: 26-32 (1997. Указанный олигосахарид может содержать различные углеводы, например, маннозу, N-ацетилглюкозамин (GlcNAc), галактозу и сиаловую кислоту, а также фукозу, присоединенную к GlcNAc в "стебле" двухантенарной олигосахаридной структуры. В некоторых вариантах осуществления данного изобретения можно выполнить модификации олигосахарида в антителе согласно данному изобретению с целью создания вариантов антител с определенными улучшенными свойствами.

В одном варианте осуществления данного изобретения предлагаются варианты антител, содержащие углеводную структуру с недостаточным количеством фукозы, присоединенной (непосредственно или косвенно) к Fc-области. Например, количество фукозы в таком антителе может составлять от 1% до 80%, от 1% до 65%, от 5% до 65% или от 20% до 40%. Количество фукозы определяют путем расчета среднего количества фукозы в углеводной цепи при Asn297 по отношению к сумме всех углеводных структур, присоединенных к Asn297 (например, сложных гибридных структур с высоким содержанием маннозы), измеренной с помощью MALDI-TOF-масс-спектрометрии, как описано, например, в WO 2008/077546. Asn297 относится к остатку аспарагина, расположенному приблизительно в положении 297 в Fc-области (Eu-нумерация остатков Fc-области); однако Asn297 также может располагаться на расстоянии приблизительно ±3 аминокислоты выше или ниже положения 297, то есть между положениями 294 и 300, учитывая незначительные вариации последовательности в антителах. Такие фукозилированные варианты могут обладать улучшенной функцией АЗКЦ. См., например, публикации патентов США №№. 2003/0157108 и 2004/0093621. Примеры публикаций, касающихся "дефукозилированных" или "фукозодефицитных" вариантов антитела, включают в себя: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO 2005/053742; WO 2002/031140; Okazaki et al. J. Mol. Biol. 336: 1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614, 2004. Примеры клеточных линий, способных продуцировать дефукозилированные антитела, включают в себя клетки Lec13 СНО, дефектные по фукозилированию белка (Ripka et al. Arch. Biochem. Biophys. 249: 533-545, 1986; US 2003/0157108; и WO 2004/056312 A1, особенно в Примере 11), и нокаутные линии клеток, такие как нокаутные клетки СНО по гену альфа-1,6-фукозилтрансферазы, FUT8, (см., например, Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614, 2004; Kanda et al. Biotechnol. Bioeng. 94(4): 680-688, 2006; и WO 2003/085107).

Кроме того, предлагаются варианты антител с олигосахаридами, разделенными пополам, например, в которых двухантенарный олигосахарид, присоединенный к Fc-области антитела, разделен пополам с помощью GlcNAc. Такие варианты антител могут обладать сниженным уровнем фукозилирования и/или улучшенной функцией АЗКЦ. Примеры таких вариантов антител описаны, например, в WO 2003/011878; патенте США №6602684; и патенте США №2005/0123546. Кроме того, предлагаются варианты антител, содержащие по меньшей мере один остаток галактозы в составе олигосахарида, присоединенного к Fc-области. Такие варианты антител могут обладать улучшенной функцией КЗЦ. Такие варианты антител описаны, например, в WO 1997/30087; WO 1998/58964; и WO 1999/22764.

с) Варианты Fc-области

В определенных вариантах осуществления данного изобретения одну или большее количество аминокислотных модификаций можно ввести в Fc-область антитела, представленного в данном документе, создавая тем самым вариант Fc-области. Вариант Fc-области может содержать последовательность Fc-области человека (например, Fc-область IgG1, IgG2, IgG3 или IgG4 человека), содержащую аминокислотную модификацию (например, замену) в одном или большем количестве аминокислотных положениях.

В некоторых вариантах осуществления данного изобретения предлагается вариант антитела, который обладает некоторыми, но не всеми эффекторными функциями, что делает его пригодным кандидатом для практических применений, в которых важное значение имеет период полужизни антитела in vivo, хотя отдельные эффекторные функции (такие как комплемент и АЗКЦ) являются ненужными или вредными. Для подтверждения снижения/ослабления КЗЦ- и/или АЗКЦ-активности можно выполнить анализы цитотоксичности in vitro и/или in vivo. Например, чтобы убедиться в отсутствии связывания антитела с FcγR (и, следовательно, отсутствии АЗКЦ-активности) при сохранении способности связывания с FcRn, можно выполнить анализ связывания Fc-рецептора (FcR). Основные клетки, опосредующие АЗКЦ, NK-клетки, экспрессируют только FcγRIII, в то время как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. Сводная информация об экспрессии FcR на кроветворных клетках приведена в Таблице 3 на странице 464 в публикациии Ravetch et al. Annu. Rev. Immunol. 9: 457-492, 1991. Неограничивающие примеры анализа in vitro для оценки АЗКЦ-активности молекулы, представляющий интерес, описаны в патенте США №5500362 (см., например, Hellstrom et al. Proc. Natl. Acad. Sci. USA 83: 7059-7063, 1986 и Hellstrom et al. Proc. Natl. Acad. Sci. USA 82: 1499-1502, 1985; в патенте США №5821337 (см. Bruggemann et al. J. Exp. Med. 166: 1351-1361, 1987). В альтернативном варианте можно использовать способы анализа, не связанные с применением радиоактивных веществ (см., например, анализ цитотоксичности ACTI™ для проточной цитометрии без применения радиоактивных веществ (CellTechnology, Inc., Mountain View, CA; и анализ цитотоксичности CytoTox 96® без применения радиоактивных веществ (Promega, Madison, WI). В качестве эффекторных клеток в таких анализах можно применять мононуклеарные клетки периферической крови (МКПК) и клетки-натуральные киллеры (NK). В альтернативном или дополнительном варианте активность АЗКЦ молекулы, представляющей интерес, можно оценить in vivo, например, на модели животного, например, как описано в публикации Clynes et al., PNAS USA 95: 652-656 (1998). Кроме того, можно выполнить анализ связывания C1q с целью подтверждения неспособности антитела связывать C1q и, следовательно, отсутствия КЗЦ-активности. См., например, анализ связывания C1q и С3с методом ИФА в WO 2006/029879 и WO 2005/100402. Чтобы оценить активацию комплемента, можно выполнить анализ КЗЦ (см., например, Gazzano-Santoro et al. J. Immunol. Methods 202:163,1996; Cragg et al. Blood 101: 1045-1052, 2003; и Cragg et al. Blood 103: 2738-2743, 2004). Определение связывания с FcRn и in vivo клиренса/времени полужизни также может быть выполнено с помощью способов, известных в данной области техники (см., например, Petkova, S.В. et al. Immunol. 18(12): 1759-1769, 2006).

Антитела с пониженной эффекторной функцией включают в себя антитела с заменой одного или большего количества из остатков 238, 265, 269, 270, 297, 327 и 329 Fc-области (патент США №6737056). Такие мутанты Fc включают в себя мутантов Fc с заменами в двух или большем количестве аминокислотных положений 265, 269, 270, 297 и 327, включая так называемые мутанты Fc "DANA" с заменой остатков 265 и 297 на аланин (патент США №7332581).

Описаны некоторые варианты антител с усиленным или ослабленным связыванием с FcR. См., например, патент США №6737056; WO 2004/056312; и Shields et al. J. Biol. Chem. 9(2): 6591-6604, 2001).

В определенных вариантах осуществления данного изобретения вариант антитела содержит Fc-область с одной или большим количеством аминокислотных замен, которые улучшают АЗКЦ, например, с заменами в положениях 298, 333 и/или 334 области Fc (нумерация остатков по системе EU).

В некоторых вариантах осуществления данного изобретения вносят изменения в Fc-область, что приводит к изменению (то есть улучшению или снижению) связывания C1q и/или комплемент-зависимой цитотоксичности (КЗЦ), например, как описано в патенте США №6194551, WO 99/51642 и Idusogie et al. J. Immunol. 164: 4178-4184, 2000.

Антитела с увеличенным периодом полужизни и усиленным связыванием с неонатальным Fc-рецептором (FcRn), который отвечает за перенос материнских IgG к плоду (Guyer et al. J. Immunol. 117: 587, 1976 and Kim et al. J. Immunol. 24: 249, 1994), описаны в US 2005/0014934. Указанные антитела содержат Fc-область с одной или большем количеством замен, которые улучшают связывание Fc-области с FcRn. Такие варианты Fc включают в себя те, которые имеют замены в одном или большем количестве остатков Fc-области: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 или 434, например, замену аминокислотного остатка 434 в Fc-области (патент США №7371826).

См. также публикацию Duncan et al. Nature 322: 738-40, 1988; патенты США №№5648260 и 5624821; и WO 94/29351 в отношении других примеров вариантов Fc-области.

d) Варианты антител, сконструированные с применением цистеина

В определенных вариантах осуществления данного изобретения может быть желательно создать антитела, сконструированные с применением цистеина, например, "thioMAb", в которых один или большее количество остатков замещены остатками цистеина. В конкретных вариантах осуществления данного изобретения замещенные остатки находятся в доступных участках антитела. В результате замещения указанных остатков цистеином в доступных участках антитела располагаются реакционноспособные тиольные группы, которые можно применять для конъюгирования антитела с другими фрагментами, такими как фрагменты лекарственных средств или фрагменты линкер-лекарственное средство, с получением иммуноконъюгата, как описано далее в данном документе. В некоторых вариантах осуществления данного изобретения цистеином можно заменить один или большее количество из следующих остатков: V205 (нумерация Кабат) легкой цепи; А118 (нумерация EU) тяжелой цепи и S400 (нумерация EU) Fc-области тяжелой цепи. Антитела, сконструированные путем введения цистеина, могут быть получены, как описано, например, в патенте США №7521541.

e) Производные антител

В определенных вариантах осуществления данного изобретения антитело, предлагаемое в данном документе, можно дополнительно модифицировать путем введения дополнительных небелковых фрагментов, известных в данной области техники и легко доступных. Фрагменты, которые можно применять для дериватизации антитела, включают в себя, но не ограничиваются ими, водорастворимые полимеры. Неограничивающие примеры водорастворимых полимеров включают, но не ограничиваются ими, полиэтиленгликоль (ПЭГ), сополимеры этиленгликоля/пропиленгликоля, карбоксиметилцеллюлозу, декстран, поливиниловый спирт, поливинилпирролидон, поли-1, 3-диоксолан, поли-1,3,6-триоксан, сополимер этилена/малеинового ангидрида, полиаминокислоты (либо гомополимеры, либо статистические сополимеры), декстран или поли(n-винилпирролидон) полиэтиленгликоль, гомополимеры пропропиленгликоля, сополимеры оксида/этиленоксида, полиоксиэтилированные полиолы (например, глицерин), поливиниловый спирт и их смеси. Преимуществом пропионового альдегида полиэтиленгликоля в производстве является его стабильность в воде.

Полимер может иметь любой молекулярный вес и может быть разветвленным или неразветвленным. Число полимеров, присоединенных к антителу, может изменяться, и, в случае присоединения более одного полимера, они могут представлять собой одинаковые или разные молекулы. Как правило, число и/или тип полимеров, применяемых для дериватизации, можно определить с учетом факторов, включающих, но не ограничиваясь перечисленным, конкретные свойства или функции антитела, подлежащие улучшению, независимо от того, будет ли производное антитела применяться в терапии при определенных условиях, и тому подобное.

В другом варианте осуществления данного изобретения предлагаются конъюгаты антитела и небелкового компонента, которые можно избирательно нагревать путем облучения. В одном варианте осуществления данного изобретения небелковый фрагмент представляет собой углеродную нанотрубку (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605, 2005). Облучение может быть любой длины волны, включая, но не ограничиваясь перечисленным, длины волн, которые не приносят вреда обычным клеткам, но нагревают небелковый фрагмент до температуры, при которой клетки, находящиеся по соседству с небелковым фрагментом, погибают.

В. Рекомбинантные способы и композиции

Антитела можно получить с помощью рекомбинантных методик и композиций, например, как описано в патенте США №4816567. В одном варианте осуществления данного изобретения предлагается выделенная нуклеиновая кислота, кодирующая антитело против триптазы, описанное в данном документе. Такая нуклеиновая кислота может кодировать аминокислотную последовательность, содержащую VL, и/или аминокислотную последовательность, содержащую VH антитела (например, легкую и/или тяжелую цепи антитела). В дополнительном варианте осуществления данного изобретения предлагаются один или большее количество векторов (например, экспрессионные векторы), содержащих такие нуклеиновые кислоты. В некоторых вариантах осуществления данного изобретения предлагается клетка-хозяин, содержащая такую нуклеиновую кислоту. В одном таком варианте осуществления данного изобретения клетка-хозяин содержит (например, в результате трансформации): (1) вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и аминокислотную последовательность, содержащую VH антитела, или (2) первый вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и второй вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VH антитела. В одном варианте осуществления данного изобретения указанная клетка-хозяин является эукариотической, например, клеткой яичника китайского хомяка (СНО), клеткой 293, или лимфоидной клеткой (например, клеткой Y0, NS0, Sp20). В одном варианте осуществления данного изобретения предлагается способ получения антитела против триптазы, при этом указанный способ включает культивирование клетки-хозяина, содержащей нуклеиновую кислоту, кодирующую антитело, как описано выше, в условиях, пригодных для экспрессии антитела, и, в некоторых случаях, извлечение антитела из клетки-хозяина (или среды, в которой культивируют клетку-хозяина).

Для рекомбинантной продукции антитела против триптазы, нуклеиновую кислоту, кодирующую антитело, например, как описано выше, выделяют и вставляют в один или большее количество векторов для дальнейшего клонирования и/или экспрессии в клетке-хозяине. Такую нуклеиновую кислоту легко выделить и секвенировать с помощью общепринятых методик (например, с применением олигонуклеотидных зондов, способных специфически связываться с генами, кодирующими тяжелые и легкие цепи антитела).

Клетки-хозяева, пригодные для клонирования или экспрессии векторов, кодирующих антитело, включают прокариотические или эукариотические клетки, описанные в данном документе. Например, антитела можно получать в бактериях, в особенности, если гликозилирование и эффекторная функция Fc не являются необходимыми. Способы экспрессии фрагментов антител и полипептидов в бактериях можно найти, например,в патентах США №№5648237, 5789199 и 5840523. См. также Charlton, Methods in Molecular Biology, Vol. 248 (В. K. C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, где описана экспрессия фрагментов антитела в Е. coli. После экспрессии антитело можно перевести из массы бактериальных клеток в растворимую фракцию, после чего дополнительно очистить.

В дополнение к прокариотам, пригодными хозяевами для клонирования или экспрессии векторов, кодирующих антитело, являются эукариотические микроорганизмы, например, мицелиальные грибы или дрожжи, в том числе штаммы грибов и дрожжей с "гуманизированными" путями гликозилирования, которые позволяют получать антитело с частично или полностью человеческой моделью гликозилирования. См. Gerngross Nat. Biotech. 22: 1409-1414, 2004 и Li et al. Nat. Biotech. 24: 210-215, 2006.

Пригодные для экспрессии гликозилированного антитела клетки-хозяева также можно получить из многоклеточных организмов (беспозвоночных и позвоночных). Примеры клеток беспозвоночных включают клетки растений и насекомых. Идентифицированы многочисленные бакуловирусные штаммы, которые можно применять в сочетании с клетками насекомых, в частности, для трансфекции клеток Spodoptera frugiperda.

Кроме того, в качестве хозяев можно использовать культуры клеток растений. См., например, патенты США №№5959177, 6040498, 6420548, 7125978 и 6417429 (описывающие технологию PLANTIBODIES™ для производства антител в трансгенных растениях).

Кроме того, в качестве хозяев можно применять клетки позвоночных. Например, можно применять клеточные линии млекопитающих, адаптированные для роста в суспензии. Другие примеры пригодных линий клеток-хозяев млекопитающих представляют собой линию клеток почки обезьяны CV1, трансформированных SV40 (COS-7); эмбриональную линию клеток почки человека (клетки 293 или 293, как описано, например, в публикации Graham et al., J. Gen Virol. 36: 59 (1977)); клетки почки детеныша хомяка (ВНК); мышиные клетки Сертоли (клетки ТМ4, как описано, например, в публикации Mather Biol. Reprod. 23: 243-251, 1980); клетки почки обезьяны (CV1); клетки почки африканской зеленой мартышки (VERO-76); клетки карциномы шейки матки человека (HELA); клетки почки собаки (MDCK, клетки печени серой крысы (BRL 3А), клетки легких человека (W138), клетки печени человека (Hep G2), клетки опухоли молочной железы мыши (ММТ 060562), клетки TRI, как описано, например, в Mather et al. Annals N. Y. Acad. Sci. 383: 44-68, 1982; клетки MRC-5; и клетки FS4. Другие пригодные линии клеток-хозяев млекопитающих включают клетки яичника китайского хомяка (СНО), в том числе DHFR- клетки СНО (Urlaub et al. Proc. Natl. Acad. Sci. USA 77: 4216, 1980); и линии клеток миеломы, такие как Y0, NS0 и Sp2/0. Обзор некоторых линий клеток-хозяев млекопитающих, пригодных для продукции антител, см., например, в публикациях Yazaki et al. Methods in Molecular Biology, Vol. 248 (В. K. C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268, 2003.

С. Анализы

Антитела против триптазы, предлагаемые в данном документе, могут быть идентифицированы, подвергнуты скринингу, или исследованы относительно их физических/химических свойств и/или биологической активности с помощью различных анализов, известных в данной области техники.

1. Анализы связывания и другие анализы

В одном аспекте антитело против триптазы согласно данному изобретению исследуют на его антигенсвязывающую активность, например, с помощью известных способов, таких как ИФА, вестерн-блоттинг, поверхностный плазмонный резонанс (SPR) и тому подобное.

В другом аспекте можно применять конкурентные анализы для идентификации антитела, способного конкурировать с антителом против триптазы по данному изобретению за связывание с триптазой. В определенных вариантах осуществления данного изобретения такое конкурирующее антитело связывается с тем же эпитопом (например, линейным или конформационным эпитопом), что и антитело против триптазы, описанное в данном документе. В определенных вариантах осуществления данного изобретения такое конкурирующее антитело связывается с перекрывающимся эпитопом (например, линейным или конформационным эпитопом), что и антитело против триптазы, описанное в данном документе. Подробное описание илюстративных методов картирования эпитопа, с которым связывается антитело, можно найти в публикации Morris "Epitope Mapping Protocols," in Methods in Molecular Biology Vol. 66 (Humana Press, Totowa, NJ), 1996.

В типовом конкурентном анализе иммобилизованную триптазу инкубируют в растворе, содержащем первое меченое антитело, которое связывается с триптазой, и второе немеченое антитело, которое исследуют на его способность конкурировать с первым антителом за связывание с триптазой. Второе антитело может присутствовать в супернатанте гибридом. В качестве контроля иммобилизованную триптазу инкубируют в растворе, который содержит первое меченое антитело, но не содержит второе немеченое антитело. После инкубирования в условиях, допускающих связывание первого антитела с триптазой, удаляют избыток несвязанного антитела и измеряют количество метки, связанной с иммобилизованной триптазой. Если количество метки, связанной с иммобилизованной триптазой, существенно снижается в анализируемом образце по сравнению с контрольным образцом, то это указывает на то, что второе антитело конкурирует с первым антителом за связывание с триптазой. См. публикацию Harlow et al., Antibodies: A Laboratory Manual Ch. 14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY), 1988.

В других вариантах осуществления данного изобретения конкуренцию двух антител за связывание с одним и тем же эпитопом определяют с помощью анализа связывания эпитопа. Например, меченый антиген иммобилизируют на твердой поверхности и вводят в реакцию с насыщающим количеством первого антитела. Затем добавляется второе конкурирующее антитело. Любое дополнительное связывание вторым антителом, обнаруженное, например, с помощью анализа OCTET® (ForteBio) или других методов биослойной интерферометрии (BLI), указывает на то, что два антитела связываются с различными неперекрывающимися эпитопами. Отсутствие дополнительного связывания указывает на то, что два антитела связываются с одним и тем же или перекрывающимся эпитопом. Для демонстрации того, что два антитела связываются с одинаковыми или перекрывающимися эпитопами также можно применять некоторые другие методики, включая ИФА, эксклюзионную хроматографию, кристаллографию, HDX-MS, мутагенез и другие методы SPR. Подобные методики могут применяться для определения того, осуществляет ли антитело перекрестное блокирование антитела по данному изобретению или является ли антитело перекрестно блокированным посредством антитела по данному изобретению.

2. Анализы активности

В одном аспекте предлагаются анализы для идентификации антител против триптазы, обладающих биологической активностью. Биологическая активность может включать, например, связывание с триптазой (например, триптазой в кровеносном русле или в дыхательных путях) или ее пептидным фрагментом, либо in vivo, in vitro, либо ex vivo. В других вариантах осуществления данного изобретения биологическая активность может включать блокирование или нейтрализацию триптазы. Например, в некоторых вариантах осуществления данного изобретения биологическая активность может включать блокирование или нейтрализацию протеолитической активности триптазы. В данном изобретении также предлагаются антитела, обладающие такой биологической активностью in vivo и/или in vitro.

В определенных вариантах осуществления данного изобретения антитело по данному изобретению исследуют на такую биологическую активность.

Например, в некоторых вариантах осуществления данного изобретения антитело по данному изобретению исследуют на ингибирование активности триптазы в ферментативном анализе триптазы, например, с применением пептидного субстрата (например, синтетического пептида S-2288), например, как описано в Примерах, (например, Пример 1, в частности Раздел (A) (viii) (а)), или с помощью методов, известных в данной области техники (см., например, публикацию Fukuoka et al. J. Immunol. 176: 3165-3172, 2006). В некоторых вариантах осуществления данного изобретения ингибирование активности триптазы в ферментативном анализе триптазы осуществляют при нейтральном рН или около того (например, около рН 7, например, около рН 7, около рН 7,4 или около рН 8). В других вариантах осуществления данного изобретения иингибирование активности триптазы в ферментативном анализе триптазы осуществляют при кислотном рН (например, около рН 6,0, например, около рН 4,0, около рН 5,0, около рН 6,0 или около рН 6,5).

В некоторых вариантах осуществления данного изобретения антитело по данному изобретению исследуют на способность разрушать триптазу, имеющую тетрамерную структуру (такую как зрелая триптаза, присутствующая в секреторных гранулах тучных клеток или высвобождаемая из них), с образованием мономеров, что можно определить с помощью любого пригодного способа, известного в данной области техники, включая гель-фильтрационную хроматографию (например, гель-фильтрационную хроматографию SUPEROSE® 12). См., например, в публикации Fukuoka et al. J. Immunol. 176: 3165-3172, 2006.

В других вариантах осуществления данного изобретения антитело по данному изобретению исследуют на способность ингибировать стимулированную триптазой пролиферацию и/или сокращение первичных гладко мышечных клеток (ГМК) дыхательных путей человека, как описано, например, в Примере 1.

В других вариантах осуществления данного изобретения антитело по данному изобретению исследуют на способность ингибировать дегрануляцию тучных клеток и/или высвобождение гистамина, например, стимулируемое триптазой и/или IgE. Такие анализы описаны, например, в Примере 1.

В некоторых вариантах осуществления данного изобретения антитело по данному изобретению исследуют на способность ингибировать активную триптазу, например, в анализе активной триптазы (см., например, Фиг. 15 и Пример 6), например, в образце (например, в жидкости бронхоальвеолярного лаважа), полученном от субъекта после введения антитела указанному субъекту (например, путем внутривенной или подкожной инъекции).

В еще дополнительных вариантах осуществления данного изобретения антитело по данному изобретению исследуют на способность модулировать (например, увеличивать или уменьшать) уровни общей триптазы, например, в анализе общей триптазы (см., например, Фиг. 15 и Пример 6), например, в образце (например, в жидкости бронхоальвеолярного лаважа), полученном от субъекта после введения антитела указанному субъекту (например, путем внутривенной или подкожной инъекции).

D. Иммуноконъюгаты

В данном изобретении также предлагаются иммуноконъюгаты, содержащие антитело против триптазы согласно данному изобретению, конъюгированное с одним или большим количеством цитотоксических агентов, например, химиотерапевтических агентов или лекарственных средств, ингибиторов роста, токсинов (например, белковые токсины, токсины бактериального, грибкового, растительного или животного происхождения, обладающие ферментативной активностью, или их фрагменты) или радиоактивных изотопов.

В одном варианте осуществления данного изобретения иммуноконъюгат представляет собой конъюгат антитело-лекарственное средство (ADC), в котором антитело конъюгировано с одним или большем количеством лекарственных средств, включая, но не ограничиваясь ими, майтансиноид (см. в патентах США №№5202020, 5416064 и в Европейском патенте ЕР 0425235 В1); ауристатин, например, фрагменты лекарственного средства монометилауристатина DE и DF (ММАЕ и MMAF) (см. в патентах США №№5635483 и 5780588, а также 7498298); доластатин; калихеамицин или его производное (см. в патентах США №№5712374, 5714586, 5739116, 5767285, 5770701, 5770710, 577001 и 5877296; Hinman et al., Cancer Res. 53: 3336-3342, 1993; и Lode et al. Cancer Res. 58: 2925-2928, 1998); антрациклин, такой как дауномицин или доксорубицин (см. Kratz et al., Current Med. 13: 477-523, 2006; Jeffrey et al. Bioorganic & Med. Chem. Letters 16: 358-362, 2006; Torgov et al. Bioconj. Chem. 16: 717-721, 2005; Nagy et al. Proc. Natl. Acad. Sci. USA 97: 829-834, 2000; Dubowchik et al. Bioorg. & Med. Chem. Letters 12: 1529-1532, 2002; King et al. J. Med. Chem. 45: 4336-4343 (2002); ив патенте США №6630579); метотрексат; виндезин; таксан, такой как доцетаксел, паклитаксел, ларотаксел, тезетаксел и ортатаксел; трихотецен; а также СС1065.

В другом варианте осуществления данного изобретения иммуноконъюгат содержит антитело, описанное в данном документе, конъюгированное с токсином, обладающим ферментативной активностью, или его фрагментом, включая, но не ограничиваясь этим, цепь А дифтерийного токсина, несвязывающие активные фрагменты дифтерийного токсина, цепь А экзотоксина (из Pseudomonas aeruginosa), цепь А рицина, цепь А абрина, цепь А модексина, альфа-сарцин, белки Aleurites fordii, белки диантина, белки Phytolacca americana (PAPI, PAPII и PAP-S), ингибитор Momordica charantia, курцин, кротин, ингибитор Saponaria officinalis, гелонин, митогеллин, рестриктоцин, феномицин, эномицин и трихотецены.

В некоторых вариантах осуществления данного изобретения иммуноконъюгат содержит антитело, описанное в данном документе и конъюгированное с радиоактивным атомом с образованием радиоконъюгата. Для получения радиоконъюгатов доступны разнообразные радиоактивные изотопы. Примеры включают в себя At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu. В случае, если радиоконъюгат применяют для обнаружения, он может содержать радиоактивный атом для сцинтиграфических исследований, например, технеций-99m (tc99m) или I123, или спиновую метку для визуализации с помощью ядерного магнитного резонанса (ЯМР) (также известной как магнитно-резонансная визуализация, МРВ), например, йод-123, йод-131, индий-111, фтор-19, углерод-13, азот-15, кислород-17, гадолиний, марганец или железо.

Конъюгаты антитела и цитотоксического агента могут быть получены с применением множества бифункциональных связывающих белок агентов, таких как N-сукцинимидил-3-(2-пиридилдитио) пропионат (SPDP), сукцинимидил-4-N-малеимидометил) циклогексан-1-карбоксилат (SMCC), иминотиолан (IT), бифункциональные производные имидоэфиров (такие как диметиладипимидат HCl), активные сложные эфиры (такие как дисукцинимидил суберат), альдегиды (такие как глутаровый альдегид), бис-азидосоединения (такие как бис(п-азидобензоил) гександиамин), производные бис-диазония (такие как бис-(п-диазонийбензоил)-этилендиамин), диизоцианаты (такие как толуол-2,6-диизоцианат) и бис-активные соединения фтора (такие как 1,5-дифтор-2, 4-динитробензол). Например, иммунотоксин на основе рицина может быть получен, как описано в публикации Vitetta et al., Science 238: 1098, 1987. 1-Изотиоцианатбензил-3-метилдиэтилентриаминпентауксусная кислота (MX-DTPA), меченая углеродом-14, представляет собой типичный хелатирующий агент для конъюгирования радионуклеотида с антителом. См. WO 94/11026. Линкер может представлять собой "расщепляемый линкер", облегчающий высвобождение цитотоксического лекарственного средства в клетке. Например, можно применять кислотолабильный линкер, чувствительный к пептидазам линкер, фотолабильный линкер, диметильный линкер или дисульфидсодержащий линкер (Chari et al., Cancer Res. 52: 127-131 (1992); патент США №5208020).

Иммуноконъюгаты или ADC в данном документе прямо подразумевают, но не ограничиваются конъюгатами, полученными при помощи перекрестно-сшивающих реагентов, включая, без ограничений, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, МРВН, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, сульфо-EMCS, сульфо-GMBS, сульфо-KMUS, сульфо-MBS, сульфо-SIAB, сульфо-SMCC и сульфо-SMPB, а также SVSB (сукцинимидил-(4-винилсульфон)бензоат), которые являются коммерчески доступными (например, от Pierce Biotechnology, Inc., Rockford, IL, U.S.A).

E. Способы и композиции для диагностики и обнаружения

В определенных вариантах осуществления данного изобретения любое из предлагаемых в данном описании антител против триптазы, можно применять для обнаружения наличия триптази в биологическом образце. В данном контексте термин "обнаружение" охватывает количественное или качественное обнаружение. В определенных вариантах осуществления данного изобретения биологический образец содержит клетку или ткань, включая, но не ограничиваясь этим, тучные клетки, базофилы, эпителиальные клетки или легочную ткань (например, гладкие мышцы бронхов). В определенных вариантах осуществления данного изобретения биологический образец содержит кровь (например, цельную кровь, сыворотку или плазму), мокроту, жидкость бронхоальвеолярного лаважа, или образец назосорбции.

В одном варианте осуществления настоящего изобретения предлагается антитело против триптазы для применения в способе диагностики или обнаружения. В дополнительном аспекте предлагается способ обнаружения наличия триптазы в биологическом образце. В некоторых вариантах осуществления данного изобретения указанный способ включает приведение в контакт биологического образца с антителом против триптазы, как описано в данном документе, в условиях, обеспечивающих связывание антитела против триптазы с триптазой, и определение образования комплекса антитела против триптазы с триптазой. Такой способ может выполнять в условиях in vitro или in vivo. В одном варианте осуществления данного изобретения антитело против триптазы применяют для выбора субъектов, подходящих для лечения с помощью антитела против триптазы, например, когда триптаза является биомаркером для отбора пациентов.

Типовые нарушения, которые могут быть диагностированы с применением антитела по данному изобретению, включают легочные нарушения (например, астма (например, астма с высоким уровнем Th2 или астма с низким уровнем Th2), гиперреактивность дыхательных путей или ХОЗЛ), аутоиммунные нарушения (например, ревматоидный артрит, псориаз, эозинофильный эзофагит, ВЗК и болезнь Крона), воспалительные нарушения (например, хроническая идиопатическая крапивница (ХИК или ХСК), атопический дерматит или аллергический ринит), фиброзные нарушения (например, ИЛФ), гранулоцитарные (нейтрофильные или эозинофильные) нарушения, моноцитарные нарушения, лимфоцитарные нарушения, нарушения, ассоциированные с увеличенным количеством или распределением резидентных клеток нормальной или патологической ткани (таких как тучные клетки, макрофаги или лимфоциты) или стромальных клеток (таких как фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелия), а также нарушения, ассоциированные с триптазой, или нарушения, опосредованные триптазой.

Например, в некоторых случаях антитела по данному изобретению можно применять для диагностики или выявления анафилаксии (например, острой системной анафилаксии) или мастоцитоза (например, неострого системного мастоцитоза), например, как описано в публикации Schwartz et al. Immunol. Allergy Clin. N. Am. 26: 451-463, 2006). Антитела по данному изобретению можно применять, например, в ИФА для определения уровней общей триптазы, протриптазы и/или зрелой триптазы.

В некоторых вариантах осуществления данного изобретения антитело по данному изобретению можно применять в качестве иммобилизованного антитела в ИФА. В других вариантах осуществления данного изобретения антитело по данному изобретению можно применять в качестве детекторного антитела в ИФА. В конкретных вариантах осуществления данного изобретения нормальный эталонный уровень общей триптазы в сыворотке или плазме может составлять около 1-15 нг/мл (например, около 1 нг/мл, около 2 нг/мл, около 3 нг/мл, около 4 нг/мл. около 5 нг/мл, около 6 нг/мл, около 7 нг/мл, около 8 нг/мл, около 9 нг/мл, около 10 нг/мл, около 11 нг/мл, около 12 нг/мл, около 13 нг/мл, около 14 нг/мл или около 15 нг/мл). В некоторых случаях увеличение относительно нормального эталонного уровня общей триптазы применяется в качестве диагностического индикатора нарушения, ассоциированного с триптазой. В некоторых вариантах осуществления данного изобретения нормальный эталонный уровень зрелой триптазы в сыворотке или плазме может составлять < 1 нг/мл. В некоторых вариантах осуществления данного изобретения увеличение относительно нормального эталонного уровня зрелой триптазы можно применять в качестве диагностического индикатора нарушения, ассоциированного с триптазой.

В некоторых вариантах осуществления данного изобретения предлагаются меченые антитела против триптазы. Метки включают, но не ограничиваясь этим, метки или фрагменты, обнаруживаемые прямым способом (например, флуоресцентные, хромофорные, электронно-плотные, хемилюминесцентные и радиоактивные метки), а также фрагменты, такие как ферменты или лиганды, обнаруживаемые непрямым способом, например, через ферментативную реакцию или молекулярные взаимодействия. Типовые метки включают, но не ограничиваются перечисленным, радиоизотопы 32Р, 14С, 125I, 3Н и 131I, флуорофоры, такие как редкоземельные хелаты или флуоресцеин и его производные, родамин и его производные, дансил, умбеллиферон, люциферазы, например, люцифераза светлячка и бактериальная люцифераза (описана в патенте США №4737456), люциферин, 2,3-дигидрофталазиндионы, пероксидазу хрена (HRP), щелочную фосфатазу, β-галактозидазу, глюкоамилазу, лизоцим, оксидазы углеводов, например, глюкозооксидазу, галактозооксидазу и глюкозо-6-фосфатдегидрогеназу, оксидазы гетероциклических соединений, такие как уриказа и ксантиноксидаза, в сочетании с ферментом, который использует пероксид водорода для окисления предшественника красителя, такого как HRP, лактопероксидазу или микропероксидазу, биотин/авидин, спиновые метки, метки-бактериофаги, стабильные свободные радикалы и тому подобное.

F. Фармацевтические составы

Фармацевтические составы антитела против триптазы по данному изобретению получают путем смешивания такого антитела, имеющего необходимую степень чистоты, с одним или большим количеством необязательных фармацевтически приемлемых носителей (см., например, Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed., 1980), в виде лиофилизированных составов или водных растворов. Фармацевтически приемлемые носители являются в общем случае нетоксичными для реципиентов в применяемых дозировках и концентрациях, и включают, но не ограничиваются этим, буферные вещества, например, фосфат, цитрат и другие органические соли; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (например, хлорид октадецилдиметилбензиламмония; хлорид гексаметония; хлорид бензалкония; хлорид бензэтония; фенол; бутиловый или бензиловый спирт; алкилпарабены, например, метил- или пропилпарабен; катехол; резорцин; циклогексанол; 3-пентанол; и m-крезол); низкомолекулярные (содержащие менее 10 остатков) полипептиды; белки, например, сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, например, поливинилпирролидон; аминокислоты, например, глицин, глутамин, аспарагин, гистидин, аргинин или лизин; моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатирующие агенты, например, ЭДТК; сахара, например, сахарозу, маннит, трегалозу или сорбит; солеобразующие противоионы, например, натрия; металлсодержащие комплексы (например, комплексы Zn-белок) и/или неионные поверхностно-активные вещества, такие как полиэтиленгликоль (ПЭГ). Примеры фармацевтически приемлемых носителей в данном документе дополнительно включают средства, обеспечивающие внутритканевое распределение лекарственных средств, такие как растворимые нейтрально-активные гликобелки, содержащие гиалуронидазу (sHASEGP), например, растворимые гликобелки РН-20 человека, содержащие гиалуронидазу, такие как rHuPH20 (HYLENEX®, Baxter International, Inc.). Некоторые примеры sHASEGP и способы их применения, включая rHuPH20, описаны в патентных публикациях США №№2005/0260186 и 2006/0104968. В одном аспекте sHASEGP объединяют с одной или большим количеством дополнительных глюкозаминогликаназ, таких как хондроитиназы.

Типовые лиофилизированные составы антител описаны в патенте США №6267958. Водные составы антител включают те, которые описаны в патенте США №6171586 и WO 2006/044908, последние составы содержат гистидин-ацетатный буфер.

Состав, описанный в данном документе, также может содержать более одного активного соединения, если это необходимо для лечения по конкретным показаниям, предпочтительно, соединения с взаимодополняющими активностями, не оказывающие нежелательного действия друг на друга. Например, может быть желательно дополнительно обеспечить антагонист связывания оси интерлейкина-13 (IL-13), антагонист связывания оси интерлейкина-17 (IL-17), антагонист связывания оси интерлейкина-5 (IL-5), антагонист связывания оси IL-33, антагонист основного М1, антагонист IgE, антагонист TRPA1, антагонист CRTH2, бронходилатирующее лекарственное средство или лекарственное средство, контролирующее симптомы астмы, иммуномодулятор, кортикостероид, ингибитор пути Th2, ингибитор тирозинкиназы или ингибитор фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13 представляет собой антитело против IL-13, например, лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33. В некоторых случаях антагонист основного М1 представляет собой квилизумаб. В некоторых случаях антагонист IgE представляет собой омализумаб (КСОЛАР®). Такие активные ингредиенты присутствуют в комбинации в количествах, эффективных для предполагаемой цели.

Активные ингредиенты можно заключать в микрокапсулы, полученные, например, с помощью методики коацервации или межфазной полимеризации, например, такие как гидроксиметилцеллюлозные или желатиновые микрокапсулы и поли-(метилметакрилатные) микрокапсулы, соответственно, в коллоидные системы доставки лекарственных средств (такие как липосомы, альбуминовые микросферы, микроэмульсии, наночастицы и нанокапсулы) или в макроэмульсии. Такие методики описаны в Remington's Pharmaceutical Science 16th edition, Osol, A. Ed., 1980.

Можно изготовить препараты с замедленным высвобождением. Пригодные примеры препаратов с замедленным высвобождением включают полупроницаемые матрицы из твердых гидрофобных полимеров, содержащие указанное антитело, при этом указанные матрицы находятся в форме формованных изделий, таких как, например, пленки или микрокапсулы.

Составы, предназначенные для применения in vivo, обычно являются стерильными. Стерильности легко достичь, например, путем фильтрации через мембраны для стерильной фильтрации.

В данном изобретении предлагаются фармацевтические композиции, которые включают антиоксиданты. Такие композиции можно применять для уменьшения окисления антитела, описанного в данном документе (например, антитела против триптазы, такого как hu31A.v11). В некоторых случаях антиоксидант включают для уменьшения окисления остатка триптофана, например остатка триптофана в области HVR или области FR вариабельной области. В конкретных случаях антиоксидант включают для уменьшения окисления остатка HVR-H3 антитела против триптазы, например, W100 в hu31A.v11. В некоторых случаях антиоксидант включают в композицию для уменьшения окисления остатка метионина, например, остатка метионина в Fc-области антитела (например, антитела против триптазы), такого как Fc-остатки М251, М357 и/или М427 (например, hu31A.v11).

В некоторых случаях фармацевтическая композиция включает любое из антител, описанных в данном документе, и антиоксидант. В некоторых случаях антитело подвержено окислению (например, на одном или большем количестве (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10) остатков триптофана или метионина). С этой целью можно применять любой пригодный антиоксидант. Например, в некоторых случаях указанная композиция включает один или большее количество антиоксидантов (например, 1, 2, 3, 4, 5, 6, 7, 8 или 9 антиоксидантов), выбранных из группы, состоящей из N-ацетилтриптофана (например, N-ацетил DL-триптофан или N-ацетил D-триптофан), триптофана, метионина (например, L-метионин), цистеина, глутатиона, тиосорбитола, аскорбиновой кислоты, монотиоглицерина, циклодекстринов, тролокса, пиридоксина, полиолов (например, маннит), сахарозы, хелатора металла (например, ЭДТК) и их комбинации (например, комбинация N-ацетилтриптофана и метионина). В некоторых случаях антиоксидант представляет собой N-ацетилтриптофан (например, N-ацетил DL-триптофан или N-ацетил D-триптофан). В других случаях антиоксидант представляет собой метионин (например, L-метионин или D-метионин). В конкретных случаях композиция включает N-ацетилтриптофан (например, N-ацетил-DL-триптофан или N-ацетил-D-триптофан) и метионин (например, L-метионин или D-метионин). В некоторых случаях N-ацетилтриптофан уменьшает или предотвращает окисление триптофана в антителе. В некоторых случаях метионин уменьшает или предотвращает окисление метионина в антителе.

Фармацевтическая композиция может включать любую пригодную концентрацию антиоксиданта для уменьшения или устранения окисления. Например, концентрация полиолов (например, маннита) или сахарозы может составлять от около 1% (вес/объем) до около 25% (вес/объем), например, около 1%, около 2%, около 3%, около 4%, около 5%, около 6%, около 7%, около 8%, около 9%, около 10%, около 11%, около 12%, около 13%, около 15%, около 16%, около 17%, около 18%, около 19%, около 20% или около 25% (вес/объем). В конкретных случаях концентрация полиолов (например, маннита) или сахарозы может составлять около 15% (вес/объем). В другом примере концентрация хелаторов металлов (например, ЭДТК) может составлять от около 0,01% (вес/объем) до около 1% (вес/объем), например, около 0,01%, около 0,02%, около 0,03%, около 0,04%, около 0,05%, около 0,06%, около 0,07%, около 0,08%, около 0,09%, около 0,1%, около 0,15%, около 0,2%, около 0,25%, около 0,3%, около 0,4%, около 0,45%, около 0,5%, около 0,6%, около 0,7%, около 0,8%, около 0,9% или около 1% (вес/объем). В конкретных случаях концентрация хелатора металла (например, ЭДТК) может составлять около 0,4% (вес/объем). В еще одном примере концентрация метионина и/или триптофана может составлять от около 0,1 мг/мл до около 10 мг/мл, например, около 0,1 мг/мл, около 0,5 мг/мл, около 1 мг/мл, около 2 мг/мл, около 3 мг/мл, около 4 мг/мл, около 5 мг/мл, около 6 мг/мл, около 7 мг/мл, около 8 мг/мл, около 9 мг/мл или около 10 мг/мл. В некоторых случаях концентрация метионина и/или триптофана составляет около 2 мг/мл.

Например, в некоторых случаях, в данном изобретении предлагается фармацевтическая композиция, которая включает:

(i) выделенное антитело, которое связывается с триптазой человека, или его антигенсвязывающий фрагмент, при этом указанное антитело содержит следующие шесть гипервариабельных областей (HVR): (a) HVR-H1, содержащую аминокислотную последовательность DYGMV (SEQ ID NO: 7); (b) HVR-H2, содержащую аминокислотную последовательность FISSGSSTVYYADTMKG (SEQ ID NO: 2); (с) HVR-Н3, содержащую аминокислотную последовательность RNYDDWYFDV (SEQ ID NO: 8); (d) HVR-L1, содержащую аминокислотную последовательность SASSSVTYMY (SEQ ID NO: 4); (e) HVR-L2, содержащую аминокислотную последовательность RTSDLAS (SEQ ID NO: 5); и (f) HVR-L3, содержащую аминокислотную последовательность QHYHSYPLT (SEQ ID NO: 6); (ii) N-ацетилтриптофан (например, N-ацетил-DL-триптофан или N-ацетин-D-триптофан) и (iii) метионин (например, L-метионин или D-метионин).

Любую пригодную концентрацию N-ацетилтриптофана (например, N-ацетил-DL-триптофана или N-ацетил-D-триптофана) можно применять в любой из композиций, описанных в данном документе. В некоторых случаях концентрация N-ацетилтриптофана (например, N-ацетил-DL-триптофана или N-ацетил-D-триптофана) составляет от около 0,05 мМ до около 20 мМ (например, от около 0,05 мМ до около 20 мМ, от около 0,05 мМ до около 19 мМ, от около 0,05 мМ до около 18 мМ, от около 0,05 мМ до около 17 мМ, от около 0,05 мМ до около 16 мМ, от около 0,05 мМ до около 15 мМ, от около 0,05 мМ до около 14 мМ, от около 0,05 мМ до около 13 мМ от около 0,05 мМ до около 13 мМ, от около 0,05 мМ до около 12 мМ, от около 0,05 мМ до около 11 мМ, от около 0,05 мМ до около 10 мМ, от около 0,05 мМ до около 9 мМ, от около 0,05 мМ до около 8 мМ, от около 0,05 мМ до около 7 мМ, от около 0,05 мМ до около 6 мМ, от около 0,05 мМ до около 5 мМ, от около 0,05 мМ до около 4 мМ, от около 0,05 мМ до около 3 мМ, от около 0,05 мМ до около 2 мМ, от около 0,05 мМ до около 1 мМ, от около 0,1 мМ до около 20 мМ, от около 0,1 мМ до около 19 мМ, от около 0,1 мМ до около 18 мМ, от около 0,1 мМ до около 17 мМ, от около 0,1 мМ до около 16 мМ, от около 0,1 мМ мМ до около 15 мМ, от около 0,1 мМ до около 14 мМ, от около 0,1 мМ до около 13 мМ, от около 0,1 мМ до около 13 мМ, от около 0,1 мМ до около 12 мМ, от около 0,1 мМ до около 11 мМ, от около 0,1 мМ до около 10 мМ, от около 0,1 мМ до около 9 мМ, от около 0,1 мМ до около 8 мМ, от около 0,1 мМ до около 7 мМ, от около 0,1 мМ до около 6 мМ, от около 0,1 мМ до около 5 мМ, от около 0,1 мМ до около 4 мМ, от около 0,1 мМ до около 3 мМ, от около 0,1 мМ до около 2 мМ, от около 0,1 мМ до около 1 мМ, от около 0,1 мМ до около 0,9 мМ, от около 0,1 мМ до около 0,8 мМ, от около 0,1 мМ до около 0,7 мМ, от около 0,1 мМ до около 0,6 мМ, от около 0,1 мМ до около 0,5 мМ, от около 0,1 мМ до около 0,4 мМ, от около 0,1 мМ до около 0,3 мМ, от около 0,2 мМ до около 20 мМ, от около 0,2 мМ до около 19 мМ, от около 0,2 мМ до около 18 мМ, от около 0,2 мМ до около 17 мМ, от около 0,2 мМ до около 16 мМ. мМ, от около 0,2 мМ до около 15 мМ, от около 0,2 мМ до около 14 мМ, от около 0,2 мМ до около 13 мМ, от около 0,2 мМ до около 13 мМ, от около 0,2 мМ до около 12 мМ, от около 0,2 мМ до около 11 мМ, от около 0,2 мМ до около 10 мМ, от около 0,2 мМ до около 9 мМ, от около 0,2 мМ до около 8 мМ, от около 0,2 мМ до около 7 мМ, от около 0,2 мМ до около 6 мМ, от около 0,2 мМ до около 5 мМ, от около 0,2 мМ до около 4 мМ, от около 0,2 мМ до около 3 мМ, от около 0,2 мМ до около 2 мМ, от около 0,2 мМ до около 1 мМ, от около 0,2 мМ до около 0,9 мМ, от около 0,2 мМ до около 0,8 мМ, от около 0,2 мМ до около 0,7 мМ, от около 0,2 мМ до около 0,6 мМ, от около 0,2 мМ до около 0,5 мМ, от около 0,2 мМ до около 0,4 мМ, от около 0,2 мМ до около 0,3 мМ, от около 0,3 мМ до около 20 мМ, от около 0,3 мМ до около 19 мМ, от около 0,3 мМ до около 18 мМ, от около 0,3 мМ до около 17 мМ, от около 0,3 мМ до около 16 мМ, от около 0,3 до около 15 мМ, от около 0,3 мМ до около 14 мМ, от около 0,3 мМ до около 13 мМ, от около 0,3 мМ до около 13 мМ, от около 0,3 мМ до около 12 мМ, от около 0,3 мМ до около 11 мМ, от около 0,3 мМ до около 10 мМ, от около 0,3 мМ до около 9 мМ, от около 0,3 мМ до около 8 мМ, от около 0,3 мМ до около 7 мМ, от около 0,3 мМ до около 6 мМ, от около 0,3 мМ до около 5 мМ, от около 0,3 мМ до около 4 мМ мМ, от около 0,3 мМ до около 3 мМ, от около 0,3 мМ до около 2 мМ, от около 0,3 мМ до около 1 мМ, от около 0,3 мМ до около 0,9 мМ, от около 0,3 мМ до около 0,8 мМ, от около 0,3 мМ до около 0,7 мМ, от около 0,3 мМ до около 0,6 мМ, от около 0,3 мМ до около 0,5 мМ или от около 0,3 мМ до около 0,4 мМ). В некоторых случаях М-ацетилтриптофан присутствует в концентрации от около 0,1 мМ до около 1 мМ (например, около 0,1 мМ, около 0,2 мМ, около 0,3 мМ, около 0,4 мМ, около 0,5 мМ, около 0,6 мМ, около 0,7 мМ. (около 0,8 мМ, около 0,9 мМ или около 1 мМ). В конкретных случаях концентрация N-ацетилтриптофана (например, N-ацетил-DL-триптофана или N-ацетил-D-триптофана) составляет около 0,3 мМ. В конкретных случаях N-ацетилтриптофан представляет собой N-ацетил DL-триптофан.

Любую пригодную концентрацию метионина (например, L-метионина или D-метионина) можно применять в любой из композиций, описанных в данном документе. Например, в некоторых случаях концентрация метионина (например, L-метионина или D-метионина) составляет от около 0,1 мМ до около 30 мМ (например, от около 0,1 мМ до около 30 мМ, от около 0,1 мМ до около 25 мМ, от около 0,1 мМ мМ до около 20 мМ, от около 0,1 мМ мМ до около 19 мМ, от около 0,1 мМ до около 18 мМ, от около 0,1 мМ мМ до около 17 мМ, от около 0,1 мМ до около 16 мМ, от около 0,1 мМ до около 15 мМ, около 0,1 мМ до около 14 мМ, от около 0,1 мМ до около 13 мМ, от около 0,1 мМ до около 13 мМ, от около 0,1 мМ до около 12 мМ, от около 0,1 мМ до около 11 мМ, от около 0,1 мМ до около 10 мМ, от около 0,1 мМ до около 9 мМ, от около 0,1 мМ до около 8 мМ, от около 0,1 мМ до около 7 мМ, от около 0,1 мМ до около 6 мМ, от около 0,1 мМ до около 5 мМ, от около 0,1 мМ до около 4 мМ, от около 0,1 мМ до около 3 мМ. от около 0,1 мМ до около 2 мМ, от около 0,1 мМ до около 1 мМ, от около 1 мМ до около 20 мМ, от около 1 мМ до около 19 мМ, от около 1 мМ до около 18 мМ, от около 1 мМ до около 17 мМ, от около 1 мМ до около 16 мМ, от около 1 мМ до около 15 мМ, от около 1 мМ до около 14 мМ, от около 1 мМ до около 13 мМ, от около 1 мМ до около 13 мМ, от около 1 мМ до около 12 мМ, от около 1 мМ до около 11 мМ, от около 1 мМ до около 10 мМ, от около 1 мМ до около 9 мМ, от около 1 мМ до около 8 мМ, от около 1 мМ до около 7 мМ, от около 1 мМ до около 6 мМ, от около 1 мМ до около 5 мМ, от около 1 мМ до около 4 мМ, от около 1 мМ до около 3 мМ, от около 1 мМ до около 2 мМ, от около 2 мМ до около 20 мМ, от около 2 мМ до около 19 мМ, от около 2 мМ до около 18 мМ, от около 2 мМ до около 17 мМ, от около 2 мМ до около 16 мМ, от около 2 мМ до около 15 мМ, от около 2 мМ до около 14 мМ, от около 2 мМ до около 13 мМ, от около 2 мМ до около 13 мМ, от около 2 мМ до около 12 мМ, от около 2 мМ до около 11 мМ, от около 2 мМ до около 10 мМ, от около 2 мМ до около 9 мМ, от около 2 мМ до около 8 мМ, от около 2 мМ до около 7 мМ, от около 2 мМ до около 6 мМ, от около 2 мМ до около 5 мМ, от около 2 мМ до около 4 мМ, от около 2 мМ до около 3 мМ, от около 5 мМ до около 20 мМ, от около 5 мМ до около 19 мМ, от около 5 мМ до около 18 мМ, от около 5 мМ до около 17 мМ, от около 5 мМ до около 16 мМ, от около 5 мМ до около 15 мМ, от около 5 мМ до около 14 мМ, от около 5 мМ до около 13 мМ, от около 5 мМ до около 13 мМ, от около 5 мМ до около 12 мМ, от около 5 мМ до около 11 мМ, от около 5 мМ до около 10 мМ, от около 5 мМ до около 9 мМ, от около 5 мМ до около 8 мМ, от около 5 мМ до около 7 мМ или от около 5 мМ до около 6 мМ). В некоторых случаях метионин (например, L-метионин или D-метионин) находится в концентрации от около 1 мМ до около 10 мМ (например, около 1 мМ, около 2 мМ, около 3 мМ, около 4 мМ, около 5 мМ). около 6 мМ, около 7 мМ, около 8 мМ, около 9 мМ или около 10 мМ). В конкретных случаях концентрация метионина (например, L-метионина или D-метионина) составляет около 5 мМ. В других случаях концентрация метионина составляет около 10 мМ. В конкретных случаях метионин представляет собой L-метионин.

В некоторых случаях присутствие антиоксиданта (например, N-ацетилтриптофана (например, N-ацетил-DL-триптофана) и/или метионина (например, L-метионина или D-метионина)) снижает процент окисления антитела против триптазы на конкретном остатке (например, остатке триптофана или остатке метионина, например, на остатке HVR-H3 (например, W100 домена VH антитела hu31A.v11) или на Fc-остатке (например, Fc-остатке М251, М357 и/или М427 (например, hu31A.v11)) на около 1%, на около 2%, на около 5%, на около 6%, на около 10%, на около 15%, на около 20%, на около 25%, на около 28%, на около 30%, на около 35%, на около 40%, на около 45%, на около 50%, на около 55%, на около 60%, на около 65%, на около 70%, на около 75%, на около 80%, на около 85%, на около 90%, на около 95%, на около 96%, на около 97%, на около 98%, на около 99% или более, например, относительно процента окисления на остатке в отсутствие антиоксиданта.

В тех случаях, когда указанное антитело содержит остаток W100 домена VH в HVR-H3 (например, hu31A.v11), который подвержен окислению, в некоторых случаях остаток W100 домена VH в HVR-H3 имеет процент окисления менее чем около 35% (например, менее 35%, менее 34%, менее 33%, менее 32%, менее 31%, менее 30%, менее 29%, менее 28%, менее 27%, менее 26%, менее 25%, менее 24%, менее 23%, менее 22%, менее 21%, менее 20%, менее 19%, менее 18%, менее 17%, менее 16%, менее 15%, менее 14%, менее 13%, менее 12%, менее 11%, менее 10%, менее 9%, менее 8%, менее 7%, менее 6%, менее 5%, менее 4%, менее 3%, менее 2%, менее 1% или менее). Например, в некоторых случаях остаток W100 в HVR-H3 имеет процент окисления менее чем около 35%. В других случаях остаток W100 в HVR-H3 имеет процент окисления менее чем около 25%. В других случаях остаток W100 в HVR-H3 имеет процент окисления менее чем около 15%. В других случаях остаток W100 в HVR-H3 имеет процент окисления менее чем около 10%. В других случаях остаток W100 в HVR-H3 имеет процент окисления менее чем около 5%. В других случаях остаток W100 в HVR-H3 имеет процент окисления менее чем около 4%, около 3%, около 2% или около 1%.

Например, в некоторых случаях, когда указанное антитело содержит остаток W100 домена VH в HVR-H3, который подвержен окислению, в некоторых случаях остаток W100 в домене VH в HVR-H3 имеет процент окисления от около 1% до около 50%, от около 1% до около 45%, от около 1% до около 40%, от около 1% до около 35%, от около 1% до около 30%, от около 1% до около 25%, от около 1% до около 20%, от около 1% до около 15%, от около 1% до около 10%, от около 1% до около 5%, от около 1% до около 4%, от около 1% до около 3%, от около 1% до около 2%, от около 5% до около 50%, от около 5% до около 45%, от около 5% до около 50%, от около 5% до около 35%, от около 5% до около 30%, от около 5% до около 25%, от около 5% до около 20%, от около 5% до около 15%, от около 5% до около 10%, от около 10% до около 50%, от около 10% до около 45%, от около 10% до около 40%, от около 10% до около 35%, от около 10% до около 30%, от около 10% до около 25%, от около 10% до около 20%, от около 10% до около 15%, от около 15% до около 50%, от около 15% до около 45%, от около 15% до около 40%, от около 15% до около 35%, от около 15% до около 30%, от около 15% до около 25%, от около 15% до около 20%, от около 25% до около 50% или от около 30% до около 50%.

Процент окисления может быть определен, например, в пределах около 1 месяца, 2 месяцев, 3 месяцев, 4 месяцев, 5 месяцев, 6 месяцев, 7 месяцев, 8 месяцев 9 месяцев, 10 месяцев, 11 месяцев, 12 месяцев, 18 месяцев, двух лет или более от первоначального изготовления антитела или его фармацевтической композиции. В некоторых случаях процент окисления определяется в пределах около 9 месяцев, около 12 месяцев, около 18 месяцев или двух лет от первоначального изготовления антитела или его фармацевтической композиции.

Концентрация антитела в композиции по данному изобретению может варьироваться, например, от около 1 мг/мл до около 350 мг/мл (например, от около 1 мг/мл до около 350 мг/мл, от около 1 мг/мл до около 325 мг/мл, от около 1 мг/мл до около 300 мг/мл, от около 1 мг/мл до около 275 мг/мл, от около 1 мг/мл до около 250 мг/мл, от около 1 мг/мл до около 225 мг/мл, от около 1 мг/мл до около 200 мг/мл, от около 1 мг/мл до около 175 мг/мл, от около 1 мг/мл до около 150 мг/мл, от около 1 мг/мл до около 125 мг/мл, от около 1 мг/мл до около 100 мг/мл, от около 1 мг/мл до около 75 мг/мл, от около 1 мг/мл до около 50 мг/мл, от около 1 мг/мл до около 25 мг/мл, от около 25 до около 350 мг/мл, от около 25 до около 325 мг/мл, от около 25 до около 300 мг/мл, от около 25 до около 275 мг/мл, около 25 мг/мл до около 250 мг/мл, от около 25 мг/мл до около 225 мг/мл, от около 25 мг/мл до около 200 мг/мл, от около 25 мг/мл до около 175 мг/мл, от около 25 мг/мл до около 150 мг/мл, от около 25 мг/мл до около 125 мг/мл, от около 25 мг/мл до около 100 мг/мл, от около 25 мг/мл до около 75 мг/мл, от около 25 мг/мл до около 50 мг/мл, от около 50 мг/мл до около 350 мг/мл, от около 50 мг/мл до около 325 мг/мл, от около 50 мг/мл до около 300 мг/мл, от около 50 мг/мл до около 275 мг/мл, от около 50 мг/мл до около 250 мг/мл, от около 50 мг/мл до около 225 мг/мл, от около 50 мг/мл до около 200 мг/мл, от около 50 мг/мл до около 175 мг/мл, от около 50 мг/мл до около 150 мг/мл, от около 50 мг/мл до около 125 мг/мл, от около 50 мг/мл до около 100 мг/мл, от около 50 мг/мл до около 75 мг/мл, от около 75 мг/мл до около 350 мг/мл, от около 75 мг/мл до около 325 мг/мл, от около 75 мг/мл до около 300 мг/мл, от около 75 мг/мл до около 275 мг/мл, от около 75 мг/мл до около 250 мг/мл, от около 75 мг/мл до около 225 мг/мл, от около 75 мг/мл до около 200 мг/мл, от около 75 мг/мл до около 175 мг/мл, от около 75 мг/мл до около 150 мг/мл, от около 75 мг/мл до около 125 мг/мл, от около 75 мг/мл до около 100 мг/мл, от около 100 мг/мл до около 350 мг/мл, от около 100 мг/мл до около 325 мг/мл, от около 100 мг/мл до около 300 мг/мл, от около 100 мг/мл до около 2 75 мг/мл, от около 100 мг/мл до около 250 мг/мл, от около 100 мг/мл до около 225 мг/мл, от около 100 мг/мл до около 200 мг/мл, от около 100 мг/мл до около 175 мг/мл, от около 100 мг/мл до около 150 мг/мл, от около 100 мг/мл до около 125 мг/мл или от около 150 мг/мл до около 175 мг/мл. В некоторых случаях указанное антитело присутствует в концентрации от около 50 мг/мл до около 200 мг/мл (например, около 50 мг/мл, около 60 мг/мл, около 70 мг/мл, около 80 мг/мл, около 90 мг/мл, около 100 мг/мл, около 110 мг/мл, около 120 мг/мл, около 130 мг/мл, около 140 мг/мл, около 150 мг/мл, около 160 мг/мл, около 170 мг/мл, около 180 мг/мл, около 190 мг/мл или около 200 мг/мл. В конкретных случаях концентрация антител составляет около 150 мг/мл.

Любая из описанных в данном документе композиций может включать одно или большее количество дополнительных вспомогательных веществ, выбранных из группы, состоящей из стабилизатора, буфера, поверхностно-активного вещества и регулятора тоничности. В некоторых случаях указанный буфер содержит сукцинат аргинина и/или сукцинат гистидина. В некоторых случаях указанный буфер содержит сукцинат аргинина и сукцинат гистидина.

Можно применять любую пригодную концентрацию сукцината аргинина. Например, в некоторых случаях концентрация сукцината аргинина составляет от около 10 мМ до около 500 мМ (например, около 10 мМ, около 20 мМ, около 30 мМ, около 40 мМ, около 50 мМ, около 75 мМ, около 100 мМ, около 125 мМ, около 150 мМ, около 175 мМ, около 200 мМ, около 225 мМ, около 250 мМ, около 275 мМ, около 300 мМ, около 325 мМ, около 350 мМ, около 375 мМ, около 400 мМ, около 425 мМ, около 450 мМ, около 475 мМ или около 500 мМ). Например, в некоторых случаях концентрация сукцината аргинина составляет от около 100 мМ до около 300 мМ, от около 125 мМ до около 300 мМ, от около 150 мМ до около 300 мМ, от около 175 мМ до около 300 мМ, от около 200 мМ до около 300 мМ, от около 225 мМ до около 300 мМ, от около 250 мМ до около 300 мМ, от около 275 мМ до около 300 мМ, от около 100 мМ до около 250 мМ, от около 125 мМ до около 250 мМ, от около 150 мМ до около 250 мМ, от около 175 мМ до около 250 мМ, от около 200 мМ до около 250 мМ, от около 100 мМ до около 225 мМ, от около 125 мМ до около 225 мМ, от около 150 мМ до около 225 мМ, от около 175 мМ до около 225 мМ, от около 200 мМ до около 225 мМ, от около 100 мМ до около 200 мМ, от около 125 мМ до около 200 мМ, от около 150 мМ до около 200 мМ или от около 175 мМ до около 200 мМ. В особых случаях концентрация сукцината аргинина составляет около 200 мМ.

Можно применять любую пригодную концентрацию сукцината гистидина. Например, в некоторых вариантах осуществления данного изобретения концентрация сукцината гистидина составляет от около 1 мМ до около 100 мМ (например, около 1 мМ, около 5 мМ, около 10 мМ, около 15 мМ, около 20 мМ, около 25 мМ, около 30 мМ около 35 мМ, около 40 мМ, около 45 мМ, около 50 мМ, около 55 мМ, около 60 мМ, около 65 мМ, около 70 мМ, около 75 мМ, около 80 мМ, около 85 мМ, около 90 мМ, около 95 мМ или около 100 мМ). В особых случаях концентрация сукцината гистидина составляет около 20 мМ.

Любая из композиций, описанных в данном документе, может иметь рН от около 4,0 до около 7,0 (например, около 4,0, около 4,5, около 5,0, около 5,5, около 6,0, около 6,5 или около 7,0). В некоторых случаях рН составляет от около 4,5 до около 7,0 (например, около 4,5, около 5,0, около 5,5, около 6,0, около 6,5 или около 7,0). В некоторых случаях рН составляет от около 4,5 до около 6,5 (например, около 4,5, около 4,6, около 4,7, около 4,8, около 4,9, около 5, около 5,1, около 5,2, около 5,3, около 5,4, около 5,5, около 5,6, около 5,7, около 5,8, около 5,9, около 6, около 6,1, около 6,2, около 6,3, около 6,4 или около 6,5). В некоторых случаях рН составляет от около 5,0 до около 6,0 (например, около 5,0, около 5,1, около 5,2, около 5,3, около 5,4, около 5,5, около 5,6, около 5,7, около 5,8, около 5,9 или около 6,0). В некоторых случаях рН составляет от около 5,5.

В композициях, описанных в данном документе, может применяться любое пригодное поверхностно-активное вещество. В некоторых случаях поверхностно-активное вещество представляет собой полоксамер 188 или полисорбат 20. Можно применять любую пригодную концентрацию полоксамера 188. Например, концентрация полоксамера 188 может составлять от около 0,005% до около 0,5%, от около 0,005% до около 0,05% или около 0,02%. В некоторых случаях концентрация полоксамера 188 составляет около 0,01%, около 0,02%, около 0,03%, около 0,04%, около 0,05%, около 0,06%, около 0,07%, около 0,08%, около 0,09% или около 0,1%. В конкретных вариантах осуществления данного изобретения концентрация полоксамера 188 составляет около 0,02%. Можно применять любую пригодную концентрацию полисорбата 20. Например, концентрация полисорбата 20 может составлять от около 0,005% до около 0,5%, от около 0,005% до около 0,05% или около 0,02%. В некоторых случаях концентрация полисорбата 20 составляет около 0,01%, около 0,02%, около 0,03%, около 0,04%, около 0,05%, около 0,06%, около 0,07%, около 0,08%, около 0,09% или около 0,1%.

В конкретных случаях композиция включает в себя около 150 мг/мл антитела против триптазы, описанного в данном документе (например, hu31A.v11), около 200 мМ сукцината аргинина, около 20 мМ сукцината гистидина, около 0,3 мМ N-ацетил-DL-триптофана), около 5 мМ L-метионина, около 0,02% полоксамера 188 и имеет рН около 5,8.

Любая из композиций, описанных в данном документе, может быть составлена для введения любым пригодным путем. В конкретных случаях указанная композиция составлена для подкожного или внутривенного введения. В некоторых случаях указанная композиция составлена для подкожного введения.

G. Терапевтические способы и композиции

Любое из антител против триптазы или любую из фармацевтических композиций по данному изобретению можно применять в терапевтических способах.

В одном аспекте предлагается антитело против триптазы или его фармацевтическая композиция для применения в качестве лекарственного средства. В дополнительных аспектах предлагается антитело против триптазы или его фармацевтическая композиция для применения при лечении нарушения. В определенных вариантах осуществления данного изобретения предлагается антитело против триптазы или его фармацевтическая композиция для применения в способе лечения. В определенных вариантах осуществления данного изобретения предлагается антитело против триптазы или его фармацевтическая композиция для применения в способе лечения субъекта, имеющего нарушение, который включает введение субъекту эффективного количества антитела против триптазы. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение субъекту эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже. "Субъектом" в соответствии с любым из вышеуказанных вариантов осуществления данного изобретения предпочтительно является человек.

В дополнительном аспекте данного изобретения предлагается применение антитела против триптазы или его фармацевтической композиции при изготовлении или приготовлении лекарственного средства. В одном варианте осуществления настоящего изобретения лекарственное средство предназначено для лечения нарушения. В дополнительном варианте осуществления данного изобретения лекарственное средство предназначено для применения в способе лечения нарушения, включающем введение субъекту, имеющему указанное нарушение, эффективного количества лекарственного средства. В одном из таких вариантов осуществления данного изобретения указанный способ дополнительно включает введение субъекту эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже. "Субъектом" в соответствии с любым из вышеуказанных вариантов осуществления данного изобретения может быть человек.

В дополнительном аспекте данного изобретения предлагается способ лечения нарушения, включающего, например, легочное нарушение (например, астма (например, астма с высоким уровнем Th2 или астма с низким уровнем Th2), гиперреактивность дыхательных путей или ХОЗЛ), аутоиммунное нарушение (например, ревматоидный артрит, псориаз, эозинофильный эзофагит, ВЗК, болезнь Крона), воспалительное нарушение (например, хроническая идиопатическая крапивница (ХИК или ХСК), анафилаксию, атопический дерматит или аллергический ринит), фиброзное нарушение (например, ИЛФ), гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение, лимфоцитарное нарушение или нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или патологической ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий), а также нарушение, ассоциированное с триптазой, или нарушение, опосредованное триптазой. В одном варианте осуществления данного изобретения указанный способ включает введение субъекту, страдающему нарушением, эффективного количества антитела против триптазы или его фармацевтической композиции. В одном из таких вариантов осуществления данного изобретения указанный способ дополнительно включает введение субъекту эффективного количества по меньшей мере одного дополнительного терапевтического агента, как описано ниже. "Субъектом" в соответствии с любым из вышеуказанных вариантов осуществления данного изобретения может быть человек.

В дополнительном аспекте данного изобретения предлагаются фармацевтические составы, содержащие любое из антител против триптазы, описанных в данном документе, например, для применения в любом из вышеуказанных терапевтических способов. В одном варианте осуществления данного изобретения фармацевтический состав содержит любое из антител против триптазы, описанных в данном документе, и фармацевтически приемлемый носитель. В еще одном варианте осуществления данного изобретения фармацевтический состав содержит любое из антител против триптазы, описанных в данном документе, и по меньшей мере один дополнительный терапевтический агент, например, как описано ниже. Любой из фармацевтических составов, описанных в разделе F (например, составов, которые включают антиоксидант, такой как N-ацетилтриптофан и/или метионин) выше, можно применять в любом из применений или способов, описанных в данном документе.

В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение, лимфоцитарное нарушение или нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или патологической ткани (например, тучные клетки, макрофаги или лимфоциты) или стромальных клеток (например, фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий). В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой легочное нарушение.

В некоторых вариантах данного изобретения указанное легочное нарушение является ассоцииорованным с гранулоцитарным (эозинофильным и/или нейтрофильным) легочным воспалением, патологическими состояниями легких, вызванными инфекцией (включая патологические состояния, которые ассоциированы с вирусными (например, грипп, парагрипп, риновирус, метапневмовирус человека и респираторно-синцитиальный вирус), бактериальными или грибковыми (например, Aspergillus) возбудителями. В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой патологическое состояние легких, индуцированное аллергеном, патологическое состояние легких, индуцированное токсическим загрязнением окружающей среды (например, асбестоз, силикоз или бериллиоз), патологическое состояние легких, индуцированное аспирацией содержимым желудка, или патологическое состояние легких, ассоциированное с иммунной дисрегуляцией, или воспалительное состояние с генетической предрасположенностью, такое как муковисцидоз, В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой патологическое состояние легких, индуцированное физической травмой (например, вентиляторное поражение), эмфизему, </g> эмфизему, индуцированную курением сигарет, бронхит, саркоидоз, гистиоцитоз, лимфангиомиоматоз, острое поражение легких, острый респираторный дистресс-синдром, хроническое заболевание легких, бронхолегочную дисплазию, пневмонию (например, внебольничная пневмония, внутрибольничная пневмония, вентиляторно-ассоциированная пневмония, вирусная пневмония, бактериальная пневмония и тяжелая пневмония), обострения заболеваний дыхательных путей и острый респираторный дистресс-синдром (ОРДС)). В некоторых вариантах осуществления данного изобретения легочное нарушение представляет собой ХОЗЛ.

В некоторых вариантах осуществления любого из указанных способов легочное нарушение представляет собой астму. В некоторых вариантах осуществления данного изобретения астма представляет собой персистирующую хроническую тяжелую астму с острыми проявлениями ухудшающихся симптомов (обострений или вспышек), которые могут быть опасными для жизни. В некоторых вариантах осуществления данного изобретения астма представляет собой атопическую (также известную как аллергическую) астму, неаллергическую астму (например, часто обусловленную инфицированием респираторным вирусом (например, вирусом гриппа, парагриппа, риновирусом, метапневмовирусом человека и респираторно-синцитиальным вирусом) или вдыхаемым раздражителем (загрязнители воздуха, дым, частицы дизельного топлива, летучие химические вещества и газы в помещении или на открытом воздухе, или даже на холодном сухом воздухе).

В некоторых вариантах осуществления любого из указанных способов астма представляет собой интермитирующую или вызванную физической нагрузкой астму, астму, обусловленную коротким или длительным первичным или вторичным воздействием "дыма" (обычно сигарет, сигар, трубок), вдыханием или "курением электронных сигарет" (табак, марихуана или другие подобные вещества), или астму, обусловленную недавним приемом аспирина или родственных НПВП. В некоторых вариантах осуществления данного изобретения астма представляет собой легкую астму, или нелеченую кортикостероидами астму, недавно диагностированную и нелеченую астму, или астму, не требующую до этого длительного применения ингаляционных топических или системных стероидов для контроля симптомов (кашель, хрипение, одышка/удушье или боль в грудной клетке). В некоторых вариантах осуществления данного изобретения астма представляет собой хроническую астму, резистентную к кортикостероидам астму, рефракторную к кортикостероидам астму, астмой, неконтролируемую приемом кортикостероидов или других препаратов, разработанных для контроля хронической астмы.

В некоторых вариантах осуществления любого из указанных способов астма представляет собой астму от средней до тяжелой степени тяжести. В определенных вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем Th2. В некоторых вариантах осуществления данного изобретения астма представляет собой тяжелую астму. В некоторых вариантах осуществления данного изобретения астма представляет собой атопическую астму, аллергическую астму, неаллергическую астму (например, обусловленную инфекцией и/или респираторно-синцитиальным вирусом (RSV)), астму, вызванную физическими нагрузками, астму, чувствительную/обостряющуюся при приеме аспирина, легкую астму, астму от средней до тяжелой степени тяжести, астму, не леченную кортикостероидами, хроническую астму, резистентную к кортикостероидам астму, рефракторную к кортикостероидам астму, недавно диагностированную и не леченную астму, астму, вызванную курением, и астму, не контролируемую приемом кортикостероидов. В некоторых вариантах осуществления данного изобретения астма представляет собой астму, обусловленную Т-хелперными лимфоцитами типа 2 (Th2), или астму с высоким уровнем Т-хелперных лимфоцитов типа 2 (Th2), или астму, индуцируемую Т-хелперными лимфоцитами типа 2 (Т2). В некоторых вариантах осуществления данного изобретения астма представляет собой эозинофильную астму. В некоторых вариантах осуществления данного изобретения астма представляет собой аллергическую астму. В некоторых вариантах осуществления данного изобретения индивидуум был определен как положительный относительно эозинофильного воспаления (EIP). См. WO 2015/061441. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким уровнем периостина (например, с уровнем периостина, составляющим по меньшей мере около 20 нг/мл, 25 нг/мл или 50 нг/мл сыворотки). Способы определения уровня периостина в сыворотке представлены, например, в публикации US 2012/0156194. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с высоким количеством эозинофилов (например, по меньшей мере около 150, 200, 250, 300, 350, 400 эозинофилов/мл крови). В определенных вариантах осуществления данного изобретения астма представляет собой астму с низким уровнем Th2, или астму, не индуцируемую Th2. В некоторых вариантах осуществления данного изобретения индивидуум был определен как отрицательный относительно эозинофильного воспаления (EIN). См. WO 2015/061441. В некоторых вариантах осуществления данного изобретения астма представляет собой астму с низким уровнем периостина (например, с уровнем периостина, составляющим менее чем около 20 нг/мл сыворотки). В некоторых вариантах осуществления данного изобретения астма представляет собой астму с низким количеством эозинофилов (например, менее чем около 150 эозинофов/мл крови или менее чем около 100 эозинофов/мл крови). В определенных вариантах осуществления данного изобретения у индивидуума наблюдается повышенный уровень FeNO (фракция оксида азота в выдыхаемом воздухе) и/или повышенный уровень IgE. Например, в некоторых случаях у индивидуума наблюдается уровень FeNO выше около 250 частей на миллиард (ppb), выше около 275 ppb, выше около 300 ppb, выше около 325 ppb, выше около 325 ppb или выше около 350 ppb. В некоторых случаях индивидуум имеет уровень IgE, который является выше 50 МЕ/мл. В некоторых вариантах осуществления данного изобретения индивидуум имеет объем форсированного выдоха за 1 секунду (ОФВ1) от 40% до 80% от прогнозируемого.

В других вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой легочной фиброз. В некоторых вариантах осуществления данного изобретения легочной фиброз представляет собой идиопатический легочной фиброз (ИЛФ).

В других дополнительных вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой эзофагит (например, эозинофильный эзофагит), аллергический ринит, неаллергический ринит, риносинусит с полипами, полипы носа, бронхит, хроническую пневмонию, аллергический бронхолегочный аспергиллез, воспаление дыхательных путей, аллергический ринит, бронхоэктазию и/или хронический бронхит.

В некоторых вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой артрит. В некоторых вариантах осуществления данного изобретения артрит представляет собой ревматоидный артрит. В некоторых вариантах осуществления данного изобретения артрит представляет собой остеоартрит, ревматоидный артрит, ювенильный артрит, ювенильный ревматоидный артрит, ранний артрит, полиартикулярный ревматоидный артрит, ревматоидный артрит с системным началом, энтеропатический артрит, реактивный артрит, псориатический артрит и/или артрит в результате травмы.

В других дополнительных вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой воспалительное состояние желудочно-кишечного тракта.. В некоторых вариантах осуществления данного изобретения воспалительное состояние желудочно-кишечного тракта представляет собой ВЗК (воспалительное заболевание кишечника), язвенный колит (ЯК), болезнь Крона (БК), колит (например, колит, вызванный воздействием окружающей среды (например, вызванный или ассоциированный со способом лечения, таким как как химиотерапия, лучевая терапия и т.д.)), инфекционный колит, ишемический колит, коллагеновый или лимфоцитарный колит, некротический энтероколит, колит при таких патологических состояниях, как хроническое гранулематозное заболевание или целиакия, пищевые аллергии, гастрит, гастроэнтерит, инфекционный гастрит или энтероколит (например, хронический активный гастрит с инфекцией Helicobacter pylori), эзофагит и другие формы воспаления желудочно-кишечного тракта, вызванные инфекционным агентом, или неуточненный колит.

В некоторых вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение или лимфоцитарное нарушение представляет собой воспалительное состояние желудочно-кишечного тракта. В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой ВЗК (воспалительное заболевание кишечника). В некоторых вариантах осуществления данного изобретения воспалительное заболевание кишечника представляет собой язвенный колит (ЯК) или болезнь Крона (БК). В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой колит (например, колит, вызванный воздействием окружающей среды (например, вызванный или ассоциированный со способом лечения, таким как как химиотерапия, лучевая терапия и т.д.)), инфекционный колит, ишемический колит, коллагеновый или лимфоцитарный колит, некротический энтероколит, колит при таких патологических состояниях, как хроническое гранулематозное заболевание или целиакия, пищевые аллергии, гастрит, гастроэнтерит, инфекционный гастрит или энтероколит (например, хронический активный гастрит с инфекцией Helicobacter pylori) и другие формы воспаления желудочно-кишечного тракта, вызванные инфекционным агентом, или неуточненный колит.

В некоторых вариантах осуществления любого из указанных способов воспалительное состояние желудочно-кишечного тракта представляет собой язвенный колит (ЯК) или болезнь Крона (БК). В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой язвенный колит (ЯК). В некоторых вариантах осуществления данного изобретения язвенный колит представляет собой дистальный колит от легкой до средней степени тяжести. В некоторых вариантах осуществления данного изобретения язвенный колит представляет собой обширный колит от легкой до средней степени тяжести. В некоторых вариантах осуществления данного изобретения язвенный колит представляет собой тяжелый колит. В некоторых вариантах осуществления данного изобретения указанное воспалительное состояние желудочно-кишечного тракта представляет собой болезнь Крона (БК). В некоторых вариантах осуществления данного изобретения болезнь Крона находится в стадии острого заболевания. В некоторых вариантах осуществления данного изобретения болезнь Крона находится в стадии индуцированной клинической ремиссии. В некоторых вариантах осуществления данного изобретения болезнь Крона находится в стадии поддержания ответа/ремиссии. В некоторых вариантах осуществления данного изобретения болезнь Крона характеризуется легкой или средней степенью тяжести. В некоторых вариантах осуществления данного изобретения болезнь Крона характеризуется средней или тяжелой степенью тяжести. В некоторых вариантах осуществления данного изобретения болезнь Крона является тяжелым/фулиминантным заболеванием. В некоторых вариантах осуществления данного изобретения болезнь Крона характеризуется поражением подвздошной кишки, подвздошной и ободочной кишки, или ободочной кишки.

В некоторых вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, гранулоцитарное (нейтрофильное или эозинофильное) нарушение, моноцитарное нарушение, или лимфоцитарное нарушение или нарушение, ассоциированное с увеличенным количеством или распределением резидентных клеток нормальной или патологической ткани (таких как тучные клетки, макрофаги или лимфоциты) или стромальных клеток (таких как фибробласты, миофибробласты, клетки гладких мышц, эпителий или эндотелий) представляют собой волчанку или системную красную волчанку (СКВ), или одно или большее количество органоспецифических проявлений волчанки (например, волчаночный нефрит (ВН), поражающий почку, или внепочечная волчанка (ВПВ), поражающая кровь и/или лимфоидные органы (лимфатические узлы, селезенку, тимус и связанные с ними лимфатические сосуды), и/или суставы, и/или другие органы, но не обязательно почки).

В некоторых вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение связано с сепсисом и/или травмой, ВИЧ-инфекцией, или является идиопатическим (неизвестной этиологии), например, ANCA-ассоциированные васкулиты (AAV), гранулематоз с полиангиитом (ранее известным как гранулематоз Вегенера), болезнь Бехчета, сердечно-сосудистые заболевания, эозинофильный бронхит, синдром Рейтера, синдром SEA (серонегативность, энтезопатия, синдром артропатии), анкилозирующий спондилит, дерматомиозит, склеродермия, например, системная склеродермия, также называемая системным склерозом, васкулит (например, гигантоклеточный артериит (ГКА), также называемый височным артериитом, краниальным артериитом или болезнью Гортона), миозит, полимиозит, дерматомиозит, узелковый полиартериит, артериит, ревматическая полимиалгия, саркоидоз, первичный билиарный склероз, склерозирующий холангит, синдром Шегрена, псориаз, бляшечный псориаз, каплевидный псориаз, псориаз сгибательных поверхностей и кожных складок, пустулезный псориаз, эритродермический псориаз, дерматит, атопический дерматит, пузырчатка, например, пузырчатка обыкновенная, атеросклероз, волчанка, болезнь Стилла, миастения, глютеновая болезнь, рассеянный склероз (PC) рецидивирующе-ремиттирующего (РРРС) или первично-прогрессирующего (ППРС) или вторично-прогрессирующего (ВПРС) подтипов, болезнь Гийена-Барре, сахарный диабет I типа (СД1т), или СД инсулинозависимого (ИЗСД) или юношеского типа, тиреоидит (например, болезнь Грейвса), целиакия, синдром Шурга-Штрауса, синдром миалгии, гиперэозинофильный синдром, отечные реакции в том числе эпизодический ангионевротический отек, гельминтозы, онхоциркозный дерматит, эозинофильный эзофагит, эозинофильный энтерит, эозинофильный колит, синдром обструктивного апноэ во сне, эндомиокардиальная фиброз, болезнь Аддисона, болезнь и феномен Рейно, аутоиммунный гепатит, болезнь "трансплантат против хозяина" (БТПХ), или отторжения трансплантата.

В некоторых вариантах осуществления любого из указанных способов нарушение представляет собой воспалительное заболевание кожи. В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой атопический дерматит или онхоцеркальный дерматит. В некоторых вариантах осуществления данного изобретения указанное нарушение представляет собой хроническую идиопатическую крапивницу (ХИК или ХСК). В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антагониста IL-13, антагониста IL-33, антагониста IgE, ингибитора кальция, ингибитора лейкотриена или антигистаминного агента. В некоторых вариантах осуществления данного изобретения антагонист IL-13 представляет собой лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист IgE представляет собой омализумаб или лигелизумаб.

В некоторых вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой фиброзное нарушение. В некоторых вариантах осуществления данного изобретения фиброзные нарушения включают фиброз легких, фиброз печени (например, фиброз, ассоциированный с циррозом печени (например, цирроз печени, вызванный алкоголем, цирроз печени, вызванный вирусом, цирроз печени после гепатита С и первичный билиарный цирроз), шистосомоз, холангит (например, склерозирующий холангит) и аутоиммунно-индуцированный гепатит), фиброз почки (например, тубулоинтерстициальный фиброз, склеродермия, диабетический нефрит и клубочковый нефрит), фиброз кожи (например, склеродермия, гипертрофические и келоидные рубцы, нефрогенная фиброзирующая дерматопатия и ожоги), миелофиброз, нейрофиброматоз, фиброма, фиброз кишечника и фиброзные спайки в результате хирургических процедур), фиброз сердца (например, фиброз, ассоциированный с инфарктом миокарда), фиброз сосудов (например, фиброз, ассоциированный с артериальным рестенозом после ангиопластики и атеросклерозом), фиброз глаза (например, фиброз, ассоциированный с операцией по поводу катаракты, пролиферативная витреоретинопатия и ретроорбитальный фиброз), а также фиброз костного мозга (например, идиопатический миелофиброз и миелофиброз, индуцированный лекарственными средствами). Фиброз может быть органоспецифичным или системным (например, системный склероз и фиброз, ассоциированный с БТПХ). В некоторых вариантах осуществления данного изобретения указанное фиброзное нарушение представляет собой легочной фиброз. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой фиброзирующую интерстициальную пневмонию. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой идиопатический легочной фиброз (ИЛФ), также известный как криптогенный фиброзирующий альвеолит. В некоторых вариантах осуществления данного изобретения ИЛФ характеризуется I стадией по шкале GAP (пол, возраст и физиология). В некоторых вариантах осуществления данного изобретения ИЛФ характеризуется II стадией по шкале GAP. В некоторых вариантах осуществления данного изобретения ИЛФ характеризуется III стадией по шкале GAP. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой спорадический ИЛФ. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой семейный легочный фиброз. В некоторых вариантах осуществления данного изобретения легочный фиброз представляет собой комбинированный легочный фиброз и эмфизему. В некоторых вариантах осуществления легочный фиброз ассоциирован с одним или большим количеством из следующих патологических состояний: обычная интерстициальная пневмония; идиопатическая интерстициальная пневмония; десквамативная интерстициальная пневмония; респираторный бронхиолит - интерстициальное легочное заболевание; острая интерстициальная пневмония; неспецифическая интерстициальная пневмония; саркоидоз; криптогенная организующая пневмония; эозинофильная пневмония; инфекция; воздействие профессиональных или экологических факторов; курение сигарет; интерстициальное легочное заболевание, индуцированное лекарственными средствами или радиацией; интерстициальное легочное заболевание, ассоциированное с ревматическим заболеванием; лимфоидная интерстициальная пневмония; плевропульмональный фиброэластоз; гистиоцитоз клеток Лангерганса; системный склероз - интерстициальное легочное заболевание; синдром Германского-Пудлака; а также теломеропатия.

В некоторых вариантах осуществления любого из указанных способов аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой хроническое обструктивное заболевание легких (ХОЗЛ). В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией А согласно Глобальной инициативе по хроническому обструктивному заболеванию легких (GOLD). В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией В согласно GOLD. В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией С согласно GOLD. В некоторых вариантах осуществления данного изобретения ХОЗЛ характеризуется категорией D согласно GOLD. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой хронический бронхит. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой эмфизему. В некоторых вариантах осуществления данного изобретения эмфизема представляет собой проксимальную ацинарную, панацинарную или дистальную ацинарную эмфизему. В некоторых вариантах осуществления данного изобретения эмфизема представляет собой эмфизему, индуцированную курением сигарет. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоциированным с воздействием пыли, химических паров и/или загрязнением воздуха. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоциированным с нарушением развития легких. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой хроническую обструктивную астму. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоциированным с дефицитом альфа-1 антитрипсина. В некоторых вариантах осуществления данного изобретения ХОЗЛ является ассоциированным с кладой Е ингибитора сериновой протеазы, представителя 2 (SERPINE2) разрушения. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с персистирующим системным воспалением. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с высоким уровнем эозинофилов или Т-хелперов типа 2 (TH2). В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с персистирующей бактериальной колонизацией. В некоторых вариантах осуществления данного изобретения ХОЗЛ представляет собой ХОЗЛ с частыми обострениями. В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой перекрестный синдром ХОЗЛ-астма (ПСХА). В некоторых вариантах осуществления данного изобретения ПСХА представляет собой ПСХА с преобладанием эозинофилов, ПСХА с преобладанием нейтрофилов, ПСХА смешанного типа или ПСХА без воспаления (пауцигранулоцитарный). В некоторых вариантах осуществления данного изобретения указанное аутоиммунное нарушение, воспалительное нарушение, фиброзное нарушение, нейтрофильное нарушение или эозинофильное нарушение представляет собой перекрестный синдром ХОЗЛ - обструктивное апноэ во сне (ОАС).

Антитела согласно данному изобретению или их фармацевтические композиции могут применяться как самостоятельно, так и в комбинации с другими агентами в терапии. Например, антитело данному изобретению или их фармацевтические композиции можно совместно вводить с по меньшей мере одним дополнительным терапевтическим агентом. В некоторых вариантах осуществления данного изобретения дополнительный терапевтический агент представляет собой антагонист связывания оси интерлейкина-13 (IL-13), антагонист связывания оси интерлейкина-17 (IL-17), антагонист связывания оси интерлейкина-5 (IL-5), или антагонист связывания оси IL-33. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13 представляет собой антитело против IL-13, например, лебрикизумаб. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-5 представляет собой антагонист связывания IL-5 или антагонист связывания рецептора IL-5. В некоторых вариантах осуществления данного изобретения антагонист связывания оси IL-13 представляет собой антагонист связывания IL-33 или антагонист связывания ST2. В некоторых вариантах осуществления данного изобретения антагонист связывания IL-33 представляет собой антитело против IL-33.

В некоторых вариантах реализации изобретения дополнительный терапевтический агент представляет собой лекарственный препарат против астмы, как описано ниже. В настоящее время умеренная астма лечится ежедневными ингаляциями противовоспалительных кортикостероидов или ингибитора активности тучных клеток, такого как кромолин натрия или недокромил, в сочетании, при необходимости, с ингаляциями бета 2-агониста (3-4 раза в сутки) для облегчения симптомов обострения или астмы, индуцированной аллергенами или физической нагрузкой. Типовые ингаляционные кортикостероиды включают КЬЮВАР (QVAR®), ПУЛЬМИКОРТ (PULMICORT®), СИМБИКОРТ (SYMBICORT®), АЭРОБИД (AEROBID®), ФЛОВЕНТ (FLOVENT®), ФЛОНАЗЕ (FLONASE®), АДВАИР (ADVAIR®) и АЗМАКОРТ (AZMACORT®). Дополнительные лекарственные препараты против астмы включают бронходилятаторы длительного действия (LABD). В определенных вариантах осуществления данного изобретения LABD представляет собой агонист бета-2 длительного действия (LABA), антагонист лейкотриеновых рецепторов (LTRA), мускариновый антагонист длительного действия (LAMA), теофиллин или пероральные кортикостероиды (OCS). Типовые LABD включают СИМБИКОРТ (SYMBICORT®), АДВАИР (ADVAIR®), БРОВАНА (BROVANA®), ФОРАДИЛ (FORADIL®), ПЕРФОРОМИСТ (PERFOROMIST™) и CEPBEHT (SEREVENT®).

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение бронходилятатора или лекарственного средства, контролирующего симптомы астмы. В некоторых вариантах осуществления данного изобретения бронходилятатор или лекарственное средство, контролирующее симптомы астмы, представляет собой β2-адренергический агонист, такой как β2-агонист короткого действия (SABA) (такой как альбутерол), или β2-адренергический агонист длительного действия (LABA). В некоторых вариантах осуществления данного изобретения LABA представляет собой сальметерол, абедитерол, индакатерол, вилантерол и/или формотерол (формотерола фумарата дигидрат). В некоторых вариантах осуществления данного изобретения лекарственное средство, контролирующее симптомы астмы, представляет собой антагонист лейкотриеновых рецепторов (LTRA). В некоторых вариантах осуществления данного изобретения LTRA представляет собой монтелукаст, зафирлукаст и/или зилеутон. В некоторых вариантах осуществления данного изобретения бронходилятатор или лекарственное средство, контролирующее симптомы астмы, представляет собой мускариновый антагонист, такой как (холинергический) антагонист мускаринового рецептора ацетилхолина длительного действия (LAMA). В некоторых вариантах осуществления данного изобретения LAMA представляет собой гликопирроний. В некоторых вариантах осуществления данного изобретения бронходилятатор или лекарственное средство, контролирующее симптомы астмы, представляет собой агонист ионного канала, например, рецептор горького вкуса (такой как TAS2R).

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение бронходилятатора. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой ингаляционный бронходилататор. В некоторых вариантах осуществления данного изобретения ингаляционный бронходилататор представляет собой β2-адренергический агонист. В некоторых вариантах осуществления данного изобретения β2-адренергический агонист представляет собой β2-адренергический агонист короткого действия (SABA). В некоторых вариантах осуществления данного изобретения SABA представляет собой битолтерол, фенотерол, изопротеренол, левальбутерол, метапротеренол, пирбутерол, прокатерол, ритодрин, альбутерол и/или тербуталин. В некоторых вариантах осуществления данного изобретения β2-адренергический агонист представляет собой β2-адренергический агонист длительного действия (LABA). В некоторых вариантах осуществления данного изобретения LABA представляет собой арформотерол, бамбутерол, кленбутерол, формотерол, сальметерол, абедитерол, кармотерол, индакатерол, олодатерол и/или вилантерол. В некоторых вариантах осуществления данного изобретения ингаляционный бронходилататор представляет собой антагонист мускариновых рецепторов. В некоторых вариантах осуществления данного изобретения антагонист мускариновых рецепторов представляет собой антагонист мускариновых рецепторов короткого действия (SAMA). В некоторых вариантах осуществления данного изобретения SAMA представляет собой ипратропия бромид. В некоторых вариантах осуществления данного изобретения антагонист мускариновых рецепторов представляет собой антагонист мускариновых рецепторов длительного действия (LAMA). В некоторых вариантах осуществления данного изобретения LAMA представляет собой тиотропия бромид, гликопиррония бромид, умеклидиния бромид, аклидиния бромид и/или ревефенацин. В некоторых вариантах осуществления данного изобретения ингаляционный бронходилататор представляет собой комбинацию SABA/SAMA. В некоторых вариантах осуществления данного изобретения комбинация SABA/SAMA представляет собой альбутерол/ипратропий. В некоторых вариантах осуществления данного изобретения ингаляционный бронходилататор представляет собой комбинацию LABA/LAMA. В некоторых вариантах осуществления данного изобретения комбинация LABA/LAMA представляет собой формотерол/аклидиний, формотерол/гликопирроний, формотерол/тиотропий, индакатерол/гликопирроний, индакатерол/тиотропий, олодатерол/тиотропий, сальметерол/тиотропин и/или вилантерол/умеклидиний. В некоторых вариантах осуществления данного изобретения ингаляционный бронходилататор представляет собой бифункциональный бронходилататор. В некоторых вариантах осуществления данного изобретения Бифункциональный бронходилататор представляет собой мускариновый антагонист/β2-агонист (МАВА). В некоторых вариантах осуществления данного изобретения МАВА представляет собой батефентерол, THRX 200495, AZD 2115, LAS 190792, TEI3252, PF-3429281 и/или PF-4348235. В некоторых вариантах осуществления данного изобретения ингаляционный бронходилататор представляет собой агонист TAS2R. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой небулизированный SABA. В некоторых вариантах осуществления данного изобретения небулизированный SABA представляет собой альбутерол и/или левальбутерол. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой небулизированный LABA. В некоторых вариантах осуществления данного изобретения небулизированный LABA представляет собой арформотерол и/или формотерол. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой небулизированный SAMA. В некоторых вариантах осуществления данного изобретения небулизированный SAMA представляет собой ипратропий. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой небулизированный LAMA. В некоторых вариантах осуществления данного изобретения небулизированный LAMA представляет собой гликопирроний и/или ревефенацин. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой небулизированную комбинацию SABA/SAMA. В некоторых вариантах осуществления данного изобретения небулизированная комбинация SABA/SAMA представляет собой альбутерол/ипратропий. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой антагонист лейкотриеновых рецепторов (LTRA). В некоторых вариантах осуществления данного изобретения LTRA представляет собой монтелукаст, зафирлукаст и/или зилеутон. В некоторых вариантах осуществления данного изобретения бронходилататор представляет собой метилксантин. В некоторых вариантах осуществления данного изобретения метилксантин представляет собой теофиллин.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение иммуномодулятора. В некоторых вариантах осуществления данного изобретения иммуномодулятор представляет собой антитело к иммуноглобулину типа Е (IgE) или анти-IgE (ингибитор IgE). В некоторых вариантах осуществления данного изобретения анти-IgE представляет собой омализумаб и/или лигелизумаб. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает кромолин. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает метилксантин. В некоторых вариантах осуществления данного изобретения метилксантин представляет собой теофиллин или кофеин.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение одного или большего количества кортикостероидов, таких как ингаляционный кортикостероид (ICS) или пероральный кортикостероид. Не ограничивающие примеры кортикостероидов включают ингаляционные кортикостероиды, такие какбеклометазон дипропионат, будесонид, циклесонид, флунизолид, флутиказона пропионат, флутиказона фуроат, мометазон и/или триамцинолона ацетонид, и пероральные кортикостероиды, такие как метилпреднизолон, преднизолон и преднизон. В некоторых вариантах осуществления данного изобретения кортикостероид представляет собой ICS. В некоторых вариантах осуществления данного изобретения ICS представляет собой беклометазон, будесонид, флунизолид, флутиказона пропионат, флутиказона фуроат, мометазон, циклесонид и/или триамцинолон. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение комбинации ICS/LABA и/или LAMA. В некоторых вариантах осуществления данного изобретения комбинация ICS/LABA и/или LAMA представляет собой флутиказона пропионат/сальметерол, будезонид/формотерол, мометазон/формотерол, флутиказона фуроат/вилантерол, флутиказона пропионат/формотерол, беклометазон/формотерол, флутиказона фуроат/умеклидиний, флутиказона фуроат/вилантерол/умеклидиний, флутиказон/сальметерол/тиотропий, беклометазон/формотерол/гликопирроний, будесонид/формотерол/гликопирроний, и/или будесонид/формотерол/тиотропий. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение небулизированного кортикостероида. В некоторых вариантах осуществления данного изобретения небулизированный кортикостероид представляет собой будесонид. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение перорального или внутривенного кортикостероида. В некоторых вариантах осуществления данного изобретения пероральный или внутривенный кортикостероид представляет собой преднизон, преднизолон, метилпреднизолон и/или гидрокортизон.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение ингибитора пути ТН2 или Т2, который ингибирует одну или большее количество мишеней, выбранных из ITK, BTK, JAK (JAK1, JAK2 и/или JAK3), IL-9, IL-6., IL-5, IL-13, IL-4, IL-17 (например, IL-17A и IL-17F), OX40L, TSLP, IL-25, IL-33, IgE, рецептора IL-9, рецептора IL-5, рецептора IL-4 α, рецептора IL-13 (например, рецептора IL-13 α1 и/или α2), OX40, TSLP-R, рецептора IL-7 (например, IL7Rα), рецептора IL-17 (например, IL -17Rβ), ST2 (рецептора IL-33), CCR3, CCR4, CRTH2, FcεRI, FcεRII/CD23, Flap, Syk-киназы; CCR4, TLR9, CCR3, антагониста хемокиновых рецепторов и GM-CSF. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение антагониста IL-5. В некоторых вариантах осуществления данного изобретения антагонист IL-5 представляет собой бенилизумаб, меполизумаб и/или реслизумаб. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение антагониста IL-13. В некоторых вариантах осуществления данного изобретения антагонист IL-13 представляет собой лебрикизумаб, детрекумаб или тралокинумаб. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение антагониста IL-4 (включая антагонист IL-4/IL-13). В некоторых вариантах осуществления данного изобретения антагонист IL-4 представляет собой дупилумаб или QBX-258 (Novartis). В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение антагониста TSLP. В некоторых вариантах осуществления данного изобретения антагонист TSLP представляет собой AMG-157 (MEDI-9929). В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение антагониста ST2. В некоторых вариантах осуществления данного изобретения указанный способ дополнительно включает введение антагониста IL-17. В некоторых вариантах осуществления данного изобретения антагонист IL-17 представляет собой секукинумаб, иксэкизумаб или бимекизумаб. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение февипипранта. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение маситиниба. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение ингибитора или антагониста фосфодиэстеразы (PDE), такого как антагонист PDE3 и/или PDE4. В некоторых вариантах осуществления данного изобретения антагонист PDE представляет собой Theo-24, далиресп или рофлумиласт.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение одного или большего количества активных ингредиентов, выбранных из аминосалицилата; стероида; биологического; а тиопурина; метотрексата; ингибитора кальциневрина, например, циклоспорина или такролимуса; и антибиотика. В некоторых вариантах осуществления любого из указанных способов, способ включает введение дополнительного активного ингредиента в составе для перорального или местного применения. Примеры аминосалицилатов включают 4-аминосалициловую кислоту, сульфасалазин, бальсалазид, олсалазин и мезалазин в таких формах, как покрытый Эудрагитом-S, рН-зависимый мезаламин, покрытый этилцеллюлозой мезаламин, и мезаламин с высвобождением множества матриц. Примеры стероидов включают кортикостероиды или глюкокортикостероиды. Примеры кортикостероидов включают преднизон и гидрокортизон или метилпреднизолон, или кортикостероид второго поколения, например, будесонид или азатиоприн; например, в таких формах, как клизма с гидрокортизоном или пена с гидрокортизоном. Примеры биологических препаратов включают этанерцепт; антитело к фактору некроза опухоли альфа, например, инфликсимаб, адалимумаб или цертолизумаб; антитело к IL-12 и IL-23, например, устекинумаб; ведолизумаб; этролизумаб и натализумаб. Примеры тиопуринов включают азатиоприн, 6-меркаптопурин и тиогуанин. Примеры антибиотиков включают ванкомицин, рифаксимин, метронидазол, триметоприм, сульфаметоксазол, диаминодифенилсульфон и ципрофлоксацин; и противовирусные средства, такие как ганцикловир.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антифибротического агента. В некоторых вариантах осуществления данного изобретения антифибротический агент ингибирует синтез коллагена, стимулированного трансформирующим фактором роста бета (TGF-β), уменьшает внеклеточный матрикс и/или блокирует пролиферацию фибробластов. В некоторых вариантах осуществления данного изобретения антифибротический агент представляет собой пирфенидон. В некоторых вариантах осуществления данного изобретения антифибротический агент представляет собой PBI-4050. В некоторых вариантах осуществления данного изобретения антифибротический агент представляет собой типелукаст.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение ингибитора тирозинкиназы. В некоторых вариантах осуществления данного изобретения ингибитор тирозинкиназы ингибирует тирозинкиназу, которая опосредует выработку одного или большего количества фиброгенных факторов роста. В некоторых вариантах осуществления данного изобретения фиброгенный фактор роста представляет собой тромбоцитарный фактор роста, фактор роста эндотелия сосудов и/или фактор роста фибробластов. В некоторых вариантах осуществления данного изобретения ингибитор тирозинкиназы представляет собой иматиниб и/или нинтеданиб. В некоторых вариантах осуществления данного изобретения ингибитор тирозинкиназы представляет собой нинтеданиб. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение противодиарейного агента. В некоторых вариантах осуществления данного изобретения противодиарейный агент представляет собой лоперамид.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антитела. В некоторых вариантах осуществления данного изобретения антитело представляет собой антитело против интерлейкина (IL)-13. В некоторых вариантах осуществления данного изобретения антитело против IL-13 представляет собой тралокинумаб. В некоторых вариантах осуществления данного изобретения антитело представляет собой антитело против IL-4/IL-13. В некоторых вариантах осуществления данного изобретения антитело против IL-4/IL-13 представляет собой SAR 156597. В некоторых вариантах реализации изобретения антитело представляет собой антитело против фактора роста соединительной ткани (CTGF). В некоторых вариантах осуществления данного изобретения антитело против CTGF представляет собой FG-3019. В некоторых вариантах осуществления данного изобретения антитело представляет собой антитело против белка 2, подобного лизилоксидазе (LOXL2). В некоторых вариантах осуществления данного изобретения антитело против LOXL2 представляет собой симтузумаб. В некоторых вариантах осуществления данного изобретения антитело представляет собой антитело против рецептора интегрина αvβ6. В некоторых вариантах осуществления данного изобретения антитело против рецептора интегрина αvβ6 представляет собой STX-100. В некоторых вариантах осуществления данного изобретения антитело представляет собой моноклональное антитело.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антагониста рецептора лизофосфатидной кислоты-1 (LPA1). В некоторых вариантах осуществления данного изобретения антагонист рецептора LPA1 представляет собой BMS-986020. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение ингибитора галектина 3. В некоторых вариантах осуществления данного изобретения ингибитор галектина 3 представляет собой TD-139.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение паллиативных терапевтических средств. В некоторых вариантах осуществления данного изобретения паллиативные терапевтические средства включают одно или большее количество из следующих средств: антибиотик, анксиолитик, кортикостероид и опиоид. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой антибиотик широкого спектра действия. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой пенициллин, ингибитор β-лактамазы и/или цефалоспорин. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой пиперациллин/тазобактам, цефиксим, цефтриаксон и/или цефдинир. В некоторых вариантах осуществления данного изобретения анксиолитик представляет собой алпразолам, буспирон, хлорпромазин, диазепам, мидазолам, лоразепам и/или прометазин. В некоторых вариантах осуществления данного изобретения кортикостероид представляет собой глюкокортикостероид. В некоторых вариантах осуществления данного изобретения глюкокортикостероид представляет собой преднизон, преднизолон, метилпреднизолон и/или гидрокортизон. В некоторых вариантах осуществления данного изобретения опиоид представляет собой морфин, кодеин, дигидрокодеин и/или диаморфин.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антибиотика. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой макролид. В некоторых вариантах осуществления данного изобретения макролид представляет собой азитромицин и/или кларитромицин. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой доксициклин. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой триметоприм/сульфаметоксазол. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой цефалоспорин. В некоторых вариантах осуществления данного изобретения цефалоспорин представляет собой цефепим, цефиксим, цефподоксим, цефпрозил, цефтазидим и/или цефуроксим. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой пенициллин. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой амоксициллин, ампициллин и/или пивампициллин. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой комбинацию пенициллина/ингибитора β-лактамазы. В некоторых вариантах осуществления данного изобретения комбинация пенициллина/ингибитора β-лактамазы представляет собой комбинацию амоксициллин/клавуланат и/или пиперациллин/тазобактам. В некоторых вариантах осуществления данного изобретения антибиотик представляет собой фторхинолон. В некоторых вариантах осуществления данного изобретения фторхинолон представляет собой ципрофлоксацин, гемифлоксацин, левофлоксацин, моксифлоксацин и/или офлоксацин.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение ингибитора фосфодиэстеразы. В некоторых вариантах осуществления данного изобретения ингибитор фосфодиэстеразы представляет собой ингибитор фосфодиэстеразы типа 5. В некоторых вариантах осуществления данного изобретения ингибитор фосфодиэстеразы представляет собой аванафил, бензамиденафил, дасантафил, икариин, лоденафил, мироденафил, силденафил, тадалафил, уденафил и/или варденафил. В некоторых вариантах осуществления данного изобретения ингибитор PDE представляет собой ингибитор PDE-4. В некоторых вариантах осуществления данного изобретения ингибитор PDE-4 представляет собой рофлумиласт, циломиласт, тетомиласт и/или CHF6001. В некоторых вариантах осуществления данного изобретения ингибитор PDE представляет собой ингибитор PDE-3/PDE-4. В некоторых вариантах осуществления данного изобретения ингибитор PDE-3/PDE-4 представляет собой RPL-554.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение цитотоксического и/или иммуносупрессивного агента. В некоторых вариантах осуществления данного изобретения цитотоксический и/или иммуносупрессивный агент представляет собой азатиоприн, колхицин, циклофосфамид, циклоспорин, метотрексат, пеницилламин и/или талидомид. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение агента, который восстанавливает деплетированные уровни глютатиона в легких. В некоторых вариантах осуществления данного изобретения агент, который восстанавливает деплетированные уровни глютатиона в легких, представляет собой N-ацетилцистеин. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антикоагулянта. В некоторых вариантах осуществления данного изобретения антикоагулянт представляет собой варфарин, гепарин, активированный белок С и/или ингибитор пути тканевого фактора.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антагониста рецептора эндотелина. В некоторых вариантах осуществления данного изобретения антагонист рецептора эндотелина представляет собой бозентан, макитентан и/или амбрисентан. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антагониста TNF-α. В некоторых вариантах осуществления данного изобретения антагонист TNF-α включает один или большее количество из следующих препаратов: этанерцепт, адалимумаб, инфликсимаб, цертолизумаб и голимумаб. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение интерферона гамма-1b.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение ингибитора интерлейкина (IL). В некоторых вариантах осуществления данного изобретения ингибитор IL представляет собой ингибитор IL-5. В некоторых вариантах осуществления данного изобретения ингибитор IL-5 представляет собой меполизумаб и/или бенрализумаб. В некоторых вариантах осуществления данного изобретения ингибитор IL представляет собой ингибитор IL-17A. В некоторых вариантах осуществления данного изобретения ингибитор IL-17A представляет собой CNTO-6785.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение ингибитора р38 митоген-активируемой протеинкиназы (MAPK). В некоторых вариантах осуществления данного изобретения ингибитор р38 MAPK представляет собой лосмапимод и/или AZD-7624. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение антагониста CXCR2. В некоторых вариантах осуществления данного изобретения антагонист CXCR2 представляет собой данириксин.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает вакцинацию. В некоторых вариантах осуществления данного изобретения вакцинация представляет собой вакцинацию против пневмококков и/или гриппа. В некоторых вариантах осуществления данного изобретения вакцинация представляет собой вакцинацию против Streptococcus pneumoniae и/или гриппа. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение противовирусной терапии. В некоторых вариантах осуществления данного изобретения противовирусная терапия представляет собой осельтамивир, перамивир и/или занамивир.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает профилактику гастроэзофагеального рефлюкса и/или рецидивирующей микроаспирации.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает вспомогательную вентиляцию легких. В некоторых вариантах осуществления данного изобретения вспомогательная вентиляция легких представляет собой механическую вентиляцию. В некоторых вариантах осуществления данного изобретения вспомогательная вентиляция легких представляет собой неинвазивную вентиляцию. В некоторых вариантах осуществления данного изобретения вспомогательная вентиляция легких представляет собой дополнительное введение кислорода. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает легочную реабилитацию.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает трансплантацию легких. В некоторых вариантах осуществления данного изобретения трансплантация легких представляет собой трансплантацию одного легкого. В некоторых вариантах осуществления данного изобретения трансплантация легких представляет собой двустороннюю трансплантацию легких.

В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает нефармакологическое вмешательство. В некоторых вариантах осуществления данного изобретения нефармакологическое вмешательство представляет собой прекращение курения, здоровое питание и/или регулярные физические упражнения. В некоторых вариантах осуществления любого из указанных способов, способ дополнительно включает введение фармакологических вспомогательных средств для прекращения курения. В некоторых вариантах осуществления данного изобретения фармакологические вспомогательные средства для прекращения курения представляют собой никотинзаместительные препараты, бупропион и/или варениклин. В некоторых вариантах осуществления данного изобретения нефармакологическое вмешательство представляет собой легочную терапию. В некоторых вариантах осуществления данного изобретения легочная терапию представляет собой легочную реабилитацию и/или дополнительное введение кислорода. В некоторых вариантах осуществления данного изобретения нефармакологическое вмешательство представляет собой хирургическое вмешательство на легких. В некоторых вариантах осуществления данного изобретения хирургическое вмешательство на легких представляет собой хирургическое вмешательство по уменьшению объема легких, трансплантация одного легкого, двустороннюю трансплантацию легкого или буллэктомию. В некоторых вариантах осуществления данного изобретения нефармакологическое вмешательство представляет собой применение устройства. В некоторых вариантах осуществления данного изобретения устройство представляет собой спираль для уменьшения объема легких, стент для дыхательных путей и/или систему для назальной вспомогательной вентиляции легких.

Такие комбинированные виды терапии, указанные выше, охватывают комбинированное введение (в котором два или большее количество терапевтических агентов включены в одну и ту же или отдельные композиции), а также раздельное введение, и в этом случае, введение антитела против триптазы или его фармацевтической композиции может происходить до, одновременно и/или после введения дополнительного терапевтического агента (агентов). В одном варианте осуществления данного изобретения введение антитела против триптазы или его фармацевтической композиции и введение дополнительного терапевтического агента происходит с интервалом около одного месяца; или с интервалом около одной, двух или трех недель; или с интервалом около одного, двух, трех, четырех, пяти или шести дней; или с интервалом около 1, 2, 3, 4, 5, 6, 7, 8 или 9 часов; или с интервалом около 1, 5, 10, 20, 30, 40 или 50 минут друг от друга. Для вариантов осуществления данного изобретения, включающих последовательное введение, антитело против триптазы можно вводить до или после введения дополнительного терапевтического агента (агентов).

Антитело против триптазы по данному изобретению или его фармацевтические композиции (и любой дополнительный терапевтический агент) можно вводить любым пригодным способом, включая парентеральное, внутрилегочное и интраназальное введение. Парентеральные инфузии включают внутримышечное, внутривенное, внутриартериальное, внутрибрюшинное или подкожное введение. В некоторых случаях антитело против триптазы по данному изобретению можно вводить интравитреально, внутримышечно, внутривенно, интрадермально, чрескожно, внутриартериально, внутрибрюшинно, внутриочагово, интракраниально, внутрисуставно, внутрь простаты, внутриплеврально, интратрахеально, интратрахеально, интраназально, интравитреально, интравагинально, ректально, местно, внутриопухолево, перитонеально, подкожно, субконъюнктивально, интравезикулярно, мукозально, интраперикардиально, внутрипуповинно, интраокулярно, интраорбитально, перорально, местно, трансдермально, периокулярно, конъюнктивально, субтенонально, внутрикамерно, субретинально, ретробульбарно, внутриканально, путем ингаляции, путем инъекции, путем имплантации, путем инфузии, путем длительной инфузии, путем локализованной перфузии непосредственно через клетки-мишени, при помощи катетера, при помощи лаважа, в кремах или в липидных композициях. В конкретных случаях антитело или его фармацевтическую композицию можно вводить путем подкожного введения. Композиции, используемые в описанных в данном документе способах, также можно вводить системно или местно. Введение дозы можно проводить любым удобным способом, например, путем инъекций, таких как внутривенные или подкожные инъекции, частично в зависимости оттого, является ли введение кратковременным или постоянным. В данном документе рассматриваются различные схемы введения доз, включая одно или множество введений в различные моменты времени, болюсное введение и пульс-терапию, но не ограничиваясь ими.

Антитела согласно данному изобретению или их фармацевтические композиции можно включать в состав препарата, дозировать и вводить с помощью способов в соответствии с принципами надлежащей медицинской практики. Факторы, которые следует учитывать в данном контексте, включают конкретное нарушение, подлежащее лечению, конкретное млекопитающее, подвергаемое лечению, клиническое состояние отдельно взятого пациента, причину нарушения, область доставки агента, способ введения, график введения и другие факторы, известные медицинским работникам. Антитело или его фармацевтическую композицию необязательно составляют вместе с одним или большим количеством агентов, которые на данный момент применяются для предотвращения или лечения соответствующего нарушения. Эффективное количество таких других агентов зависит от количества антитела, присутствующего в составе, вида нарушения или лечения, и других факторов, описанных выше. Как правило, другие агенты применяют в тех же дозах и посредством того же пути введения, как описано в данном документе, или в дозах, составляющих от около 1 до 99% количества доз, описанных в данном документе, или в любой дозе и посредством любого пути введения, эмпирически/клинически считающихся пригодными.

Для предотвращения или лечения заболевания соответствующая доза антитела согласно изобретению (при применении отдельно или в комбинации с одним или большим количеством других дополнительных терапевтических агентов) будет зависеть от вида заболевания, подлежащего лечению, типа антитела, тяжести и течения заболевания, от того, вводят ли антитело в профилактических или терапевтических целях, предшествующей терапии, анамнеза заболевания пациента, реакции на антитело, и усмотрения лечащего врача. Антитело пригодно для введения пациенту однократно или в несколько курсов лечения. В зависимости от типа и тяжести заболевания, первоначальная предполагаемая доза антитела для введения пациенту, например, посредством одного или более раздельных введений или непрерывной инфузии, составляет от около 1 мкг/кг до 15 мг/кг (например, от 0,1 мг/кг до 10 мг/кг). Типовая ежедневная доза может находиться в диапазоне от около 1 мкг/кг до 200 мг/кг или более в зависимости от вышеупомянутых факторов. При повторном введении в течение нескольких дней или дольше, в зависимости от патологического состояния, лечение обычно следует продолжать до желательного подавления симптомов заболевания. Одна типовая доза антитела должна находиться в диапазоне от около 0,05 мг/кг до около 10 мг/кг. Таким образом, пациенту может быть введена одна или большее количество доз, составляющих около 0,5 мг/кг, 2,0 мг/кг, 4,0 мг/кг или 10 мг/кг (или любая их комбинация). Такие дозы могут вводиться периодически, например, каждую неделю, каждые две недели, каждые три недели или каждые четыре недели (например, так, чтобы пациент получал от около двух до около двадцати или, например, около шести доз антитела). Например, дозу можно вводить один раз в месяц (например, путем подкожной инъекции). Можно вводить начальную повышенную нагрузочную дозу, за которой следует одна или большее количество пониженных доз. Однако можно применять и другие схемы введения доз. Эффективность лечения можно контролировать с помощью обычных методик и анализов. В некоторых случаях антитело можно вводить, например, путем подкожной инъекции в дозе, составляющей около 50 мг/мл до около 200 мг/мл (например, около 50 мг/мл, около 60 мг/мл, около 70 мг/мл, около 80 мг/мл, около 90 мг/мл, около 100 мг/мл, около 110 мг/мл, около 120 мг/мл, около 130 мг/мл, около 140 мг/мл, около 150 мг/мл, около 160 мг/мл, около 170 мг/мл, около 180 мг/мл, около 190 мг/мл или около 200 мг/мл. В некоторых случаях антитело можно вводить путем подкожной инъекции в дозе, составляющей около 150 мг/мл.

Следует понимать, что любой из вышеуказанных составов или терапевтических способов может быть осуществлен с применением иммуноконъюгата согласно данному изобретению вместо или в дополнение к антителу против триптазы.

Н. Готовые изделия

В другом аспекте данного изобретения предлагается изделие, содержащее материалы, пригодные для лечения, предотвращения и/или диагностики нарушений (например, нарушений, ассоциированных с триптазой), описанных выше. Готовое изделие включает контейнер и этикетку или листок-вкладыш в упаковке, размещенный на или связанный с контейнером. Пригодные контейнеры включают, например, бутыли, флаконы, шприцы, пакеты для в/в введения растворов и т.д. Контейнеры можно сформировать из различных материалов, например, из стекла или пластика. Контейнер содержит композицию, которая сама по себе или в сочетании с другой композицией эффективна для лечения, предотвращения и/или диагностики патологического состояния, и может иметь стерильное отверстие для доступа (например, контейнер может представлять собой пакет для в/в введения растворов или флакон с пробкой, прокалываемой иглой для подкожных инъекций). По меньшей мере один активный агент в композиции представляет собой антитело по данному изобретению или его фармацевтическую композицию. На этикетке или на вкладыше в упаковку указано, что композиция используется для выбранного патологического состояния. Кроме того, изделие может содержать (а) первый контейнер с содержащейся в нем композицией, при этом указанная композиция содержит антитело по данному изобретению; и (b) второй контейнер с содержащейся в нем композицией, при этом указанная композиция содержит дополнительный терапевтический агент. Готовое изделие в данном варианте осуществления изобретения может дополнительно содержать вкладыш в упаковку, в котором указано, что указанные композиции можно применять для лечения конкретного патологического состояния. В альтернативном или дополнительном варианте готовое изделие может дополнительно содержать второй (или третий) контейнер, содержащий фармацевтически приемлемый буфер, такой как бактериостатическая вода для инъекций (BWFI), фосфатно-буферный солевой раствор, раствор Рингера и раствор декстрозы. Готовое изделие может дополнительно включать другие материалы, желательные с коммерческой и потребительской точки зрения, в том числе другие буферы, разбавители, фильтры, иглы и шприцы.

Следует понимать, что любое из указанных выше готовых изделий вместо антитела против триптазы или в дополнение к нему может включать иммуноконъюгат по данному изобретению.

III. Примеры

Ниже приведены примеры способов и композиций согласно данному изобретению. Следует понимать, что, учитывая общее описание, представленное выше, можно осуществить различные другие варианты осуществления данного изобретения. Если не указано иное, в исследованиях применяли триптазу бета 1 человека.

Пример 1: Генерация и гуманизация антител против триптазы

А. Материалы и способы

Остатки пронумерованы по Kabat et al., Sequences of proteins of immunological interest 5th Ed., Public Health Service, National Institutes of Health, Bethesda, MD, 1991.

(i) Рекомбинантная экспрессия и очистка триптазы в клетках насекомых и клетках млекопитающих

Последовательность, кодирующую зрелую триптазу бета 1 дикого типа человека (нумерация химотрипсиногена Ile16 - Pro246, SEQ ID NO: 97), клонировали в модифицированный вектор pAcGP67A за промотором многогранника и сигнальной последовательностью секреции gp67. Если не указано иное, в этом разделе триптаза относится к триптазе бета 1 человека (также называемой триптазой b1 человека). Конструкция содержит N-концевую метку His6, сайт расщепления энтерокиназой и, для некоторых конструкций, С-концевую метку FLAG. Сайт-направленный мутагенез проводили с применением стандартных протоколов QuikChange™ (Stratagene) для получения мутантов триптазы. Все конструкции были подтверждены секвенированием ДНК. Рекомбинантные бакуловирусы генерировали с помощью системы BaculoGold™ (BD Biosciences) в клетках Sf9 в соответствии со стандартными протоколами. Клетки Trichoplusia ni инфицировали для крупномасштабной продукции белка и собирали через 48 ч после инфицирования. Собранную среду дополняли 1 мМ NiCl2, 5 мМ CaCl2 и 20 мМ Трис рН 8, встряхивали в течение 30 мин, а затем центрифугировали в течение 20 мин при 8500 × г для удаления клеток и выпадения осадка из среды. Супернатантную среду фильтровали через фильтр из полиэфирсульфона (PES) 0,22 мкм перед загрузкой в аффинную колонку с никель-нитрилотриуксусной кислотой (Ni-NTA). Триптазу бета 1 человека также экспрессировали путем временной трансфекции в клеточной линии млекопитающих СНО DP12. Среду для культивирования клеток подвергали такой же очистке, начиная с аффинной очистки Ni-NTA, как описано ниже.

Среду клеток насекомых или среду клеток СНО, содержащую секретированную His6-меченую рекомбинантную триптазу (дикого или мутантного типа), загружали в 10 мл колонку Ni-NTA Superflow (Qiagen) при объемной скорости потока 170 см/ч. Колонку промывали 10 ОК (объемы колонки) промывочного буфера (20 мМ Трис, рН 8, 10 мМ имидазол, 300 мМ NaCl) и элюировали 8 ОК элюирующего буфера (20 мМ Трис, рН 8, 300 мМ имидазол, 300 мМ NaCl). Фракции, проанализированные с помощью электрофореза в полиакриламидном геле с додецилсульфатом натрия (ДСН-ПААГ), содержащие триптазу, объединяли, концентрировали и загружали в колонку для эксклюзионной хроматографии S200 (GE Healthcare) для дальнейшей очистки с применением рабочего буфера (10 мМ 3-(N-морфолино)пропансульфоновая кислота (MOPS), рН 6,8, 2 М NaCl) при скорости потока, рекомендованной производителем. Фракции, содержащие His-меченую рекомбинантную триптазу (мономерную), объединяли и концентрировали. Затем рекомбинантную триптазу расщепляли в течение ночи при комнатной температуре в концентрации 2 мг/мл в буфере (10 мМ MOPS, рН 6,8, 0,2 М NaCl), содержащем 0,5 мг/мл гепарина (Sigma Aldrich) и 0,1 мг/мл энтерокиназы (New England Biolabs, Inc). Посредством этого этапа удаляли N-концевую His6-метку и получали тетрамеризацию и протеолитически активную триптазу, которая имеет IVGG в качестве вновь образованной N-концевой последовательности, начиная с остатка 16 (нумерация химотрипсиногена). Тетрамерную триптазу затем подвергали эксклюзионной хроматографии по размеру с применением колонки S200 (GE Healthcare) в буфере (10 мМ MOPS, рН 6,8 и 2 М NaCl) для очистки тетрамерной триптазы путем удаления энтерокиназы и любой нерасщепленной рекомбинантной триптазы.

Мутанты триптазы Y75C и I99C, а также каталитически неактивный мутант S195A (нумерация химотрипсиногена, соответствующая замене Ser224 на Ala полноразмерной последовательности триптазы SEQ ID NO: 71) очищали с помощью Ni-аффинной хроматографии, как описано выше. Затем дисульфидсвязанные димерные мутанты триптазы отделяли от недисульфидсвязанных мономерных мутантов триптазы с помощью эксклюзионной хроматографии по размеру S200. Дисульфидсвязанные димерные мутанты затем процессировали в тетрамеры, как описано выше для триптазы дикого типа.

(ii) Генерация моноклональных антител кролика и мыши против триптазы человека

Двух кроликов иммунизировали полученной из СНО триптазой бета 1 (тетрамер) с полным адъювантом Фрейнда (CFA). Кроликам вводили бустерную дозу одного и того же белка с неполным адъювантом Фрейнда (IFA) один раз каждые 2 недели. После 4 инъекций очищенные образцы сыворотки оценивали на связывание с помощью иммуноферментного анализа (ИФА) и ингибирование активности триптазы человека с помощью анализа ферментативной активности. В-клетки из селезенки, собранные у одного из кроликов, которые продемонстрировали ингибирование активности триптазы человека, затем были слиты с партнером по слиянию кроликов. Через 10-14 дней супернатанты собирали и скринировали на предмет связывания с белками с помощью ИФА.

Протокол ИФА был следующим. 96-луночные планшеты NUNC MAXISORB® для ИФА покрывали в течение ночи белком, связывающим биотин NeutrAvidin® (Thermo Scientific № по каталогу 31000, исходн. 10 мг/мл, 5 мкг/мл, 100 мкл/лунку). Лунки трижды промывали промывочным буфером (PBS с 0,05% TWEEN®-20) и промокали досуха. Затем лунки блокировали с применением блокирующего буфера 200 мкл/лунку (PBS с 0,5% бычьего сывороточного альбумина (BSA) и 0,05% TWEEN®-20) и инкубировали в течение периода времени, большего или равного 30 мин при комнатной температуре. Биотинилированный белок триптазы бета 1 человека (разбавленный в буфере для анализа; PBS с 0,5% BSA, 0,05% TWEEN®-20 и 0,1 мг/мл гепарина) добавляли в лунки в концентрации 1 мкг/мл и инкубировали при комнатной температуре в течение 1 часа ± 10 мин. Гепарин добавляли для обеспечения того, чтобы триптаза оставалась в виде тетрамера. Лунки промывали три раза промывочным буфером (200 мкл/лунку) и промокали досуха. Супернатанты гибридомы (образцы) или контроли (например, положительные контроли очищенных поликлональных антител YZ4209 кролика (исходн. 0,25 мг/мл) добавляли в лунки (разбавленные в буфере для анализа, 100 мкл/лунку) и инкубировали при комнатной температуре в течение 1 часа. Затем лунки трижды промывали промывочным буфером (200 мкл/лунку) и промокали досуха. Добавляли конъюгат пероксидазы хрена (HRP) (козье антитело к IgG кролика (Н+L) HRP; Thermo Scientific, № по каталогу 31460) (разбавленный 1:10000 в буфере для анализа, 100 мкл/лунку) и инкубировали при комнатной температуре в течение 30 мин. Лунки снова промывали три раза промывочным буфером (200 мкл/лунку) и промокали досуха. Добавляли субстрат (Субстрат BioFX ТМВ, № продукта: TMBW-1000-01) (100 мкл/лунку) и инкубировали в течение 5 мин при комнатной температуре. Реакцию останавливали добавлением 100 мкл/лунку стоп-раствора BioFX (№ продукта: BSTP-0100-01), и планшеты считывали при А650.

Все ИФА-положительные клоны очищали путем аффинной хроматографии с помощью стандартных способов (MabSelect SuRe™; GE Healthcare) и затем скринировали на предмет ингибирования активности триптазы человека в анализе активности рекомбинантной триптазы. Вкратце, антитела разводили от 0,007 до 100000 нг/мл (от 0,046 до 667 нМ) в PBS, рН 7,4. Рекомбинантную триптазу бета 1 человека разводили до 3 нМ в буфере TNH (200 мМ Трис, 150 мМ NaCl, 0,1 мг/мл гепарина, 0,01% TRITON™ Х-100, рН 8,0) и комбинировали в соотношении 1:1 с антителами против триптазы на черных 384-луночных планшетах (ViewPlate-384F, Black, Clear-Bottom, Perkin Elmer, № по каталогу 6007470). Планшеты инкубировали в течение 1 часа при температуре окружающей среды при осторожном перемешивании. Колориметрический субстрат S-2288 (Chromogenix, Part №82-0852-39) разбавляли до 900 мкМ в буфере TNH и добавляли на планшет. Конечные концентрации в лунках составляли 300 мкМ S-2288, 1 нМ рекомбинантной триптазы бета 1 человека, и от 0,015 до 222 нМ антител против триптазы. Планшеты инкубировали в течение 40 мин при температуре окружающей среды с осторожным перемешиванием, а затем считывали при А405. Полумаксимальную ингибирующую концентрацию (IC50) антител против триптазы определяли по четырехпараметрическому соответствию их соответствующих кривых. Клоны, демонстрирующие желаемое ингибирование, затем субклонировали путем ограничения разведения (отдельная клетка/лунка), повторно анализировали, как описано выше, и дополнительно характеризовали.

Мышиные гибридомы генерировали и подвергали скринингу, а положительные клоны анализировали аналогичным образом. Три мыши A/J (Harlan, Indianapolis, Ind.) иммунизировали очищенным триптазным белком в качестве антигена (ЕРС, Inc. #TR913). Ферментативно активную триптазу вводили в дозе 20 мкг/мышь на иммунизацию подкожно и внутрибрюшинно после смешивания и эмульгирования 1:1 с полным адъювантом Фрейнда (первая иммунизация) или неполным адъювантом Фрейнда (вторая, третья и четвертая иммунизация). Бустерная доза (пятая иммунизация) не содержала адъюванта. После четвертой иммунизации сыворотки от иммунизированных мышей анализировали с помощью ИФА, и мышей с сывороточным титром выше, чем OD450 >2.16 при разведении 1:1. 28×104, выбирали для слияния гибридомы. 107×106 выделенных клеток селезенки смешивали с 100×106 Sp2/0 клеток миеломы (АТСС) для слияния в присутствии полиэтиленгликоля (Sigma-Aldrich, № по каталогу Р7777-5G). Двадцать четыре клона подвергали скринингу на предмет связывания с триптазой и анализировали на ингибирование ферментативной активности триптазы. Клон Т31а (также называемый в данном документе "31А" и "mu. 31А") был выбран для гуманизации.

(iii) Молекулярное клонирование и переформатирование кроличьих анти-триптазных гибридомных клонов

Общую РНК экстрагировали из клеток гибридомы, продуцирующей кроличьи моноклональные антитела против триптазы (RNeasy® Mini Kit, Qiagen). Применяя набор для амплификации кДНК SMARTer® RACE (Clontech), РНК сначала подвергали обратной транскрипции, затем подвергали синтезу первой цепи кДНК и 5'-RACE-ПЦР-амплификации вариабельных доменов легкой цепи (VL) и тяжелой цепи (VH) со следующими праймерами:

Прямой праймер легкой цепи (LC):

Universal Primer Mix (набор для амплификации кДНК SMARTer® RACE, Clontech, № по каталогу 634858)

Прямой праймер тяжелой цепи (НС):

Universal Primer Mix (набор для амплификации кДНК SMARTer® RACE, Clontech, № по каталогу 634858)

Обратный праймер LC:

Обратный праймер НС:

Обратные праймеры LC и НС были разработаны для ренатурации до области в константном домене легкой цепи (CL) и константном домене тяжелой цепи 1 (СН1).

Продукты амплифицированной ПЦР секвенировали напрямую. Затем идентифицированную последовательность VL ДНК субклонировали в экспрессионный вектор клеток млекопитающих pRK, содержащий константный домен каппа человека. Последовательность VH ДНК встраивали в векторы pRK, кодирующие полноразмерный константный домен γ1 человека.

(iv) Гуманизация кроличьего моноклонального антитела Е104 против триптазы

VL (SEQ ID NO: 53) и VH (SEQ ID NO: 52) домены кроличьего моноклонального антитела Е104 против триптазы выравнивали с консенсусными последовательностями VL каппа I человека (VLKI) и VH подгруппы IV человека (VHIV) (SEQ ID NO: 92 и 93 соответственно). См., например, Dennis, Ch. 2 CDR Repair: A Novel Approach to Antibody Humanization in Current Trends in Monoclonal Antibody Development and Manufacturing, Eds. Shire et al. Springer, New York, NY. Гипервариабельные области (HVR) интегрировали в консенсусные акцепторные каркасы VLKI и VHIV человека для генерации вариантов с привитыми CDR. Из домена Е104 VL, положения 24-34 (L1), 50-56 (L2) и 89-97 (L3) прививали в VLKI. Из домена VH, положения 26-35b (Н1), 50-65 (Н2) и 93-102 (Н3) прививали в VHIV. Чтобы оценить верньерные положения каркаса, которые могут быть важными, выбранные верньерные положения мутировали обратно в последовательности кролика. Верньерные положения, которые были мутированы обратно в последовательности кролика, включали положения 2, 4, 43, 68 и 87 в VL и 37, 67, 71, 78 и 91 в VH.

Домены VL и VH из кроличьего моноклонального антитела Е104 против триптазы также выравнивали с консенсусными последовательностями VL каппа I человека (VLKI) и VH подгруппы III человека (VHIII) (SEQ ID NO: 92 и 94 соответственно). См. Dennis, выше. Гипервариабельные области (HVR) интегрировали в консенсусные акцепторные каркасы VLKI и VHIII человека для генерации CDR-привитых вариантов. Из домена rab. Е104 VL, положения 24-34 (L1), 50-56 (L2) и 89-97 (L3) прививали в VLKI. Из VH домена, положения 26-35 (Н1), 50-65 (Н2) и 93-102 (Н3) прививали в VHIII.

В общей сложности были синтезированы две разные версии гуманизированных последовательностей VL и шесть разных версий последовательностей гуманизированных VH, а затем субклонированы в экспрессионные векторы млекопитающих pRK. Путем комбинирования различных версий LC и НС было сгенерировано в общей сложности двенадцать различных гуманизированных вариантов Е104 (v1-v12) (Таблица 3). Все гуманизированные варианты антитела против триптазы экспрессировали в виде антител IgG1 или IgG4 в клетках млекопитающих. Антитела очищали путем аффинной хроматографии с помощью стандартных способов (MabSelect SuRe™; GE Healthcare). Все антитела IgG4, использованные в разделе "Примеры", включали мутацию S228P (нумерация EU) в константной области тяжелой цепи; однако изобретение, описанное в данном документе, не ограничивается вариантом IgG4 с мутацией S228P.

Последовательность ДНК, кодирующая домен VH антитела huE104.v2, продемонстрирована в SEQ ID NO: 109. Последовательность ДНК, кодирующая домен VL антитела huE104.v2, продемонстрирована в SEQ ID NO: 110. Последовательность ДНК, кодирующая тяжелую цепь (IgG1), продемонстрирована в SEQ ID NO: 111. Последовательность ДНК, кодирующая тяжелую цепь (IgG4. S228P), продемонстрирована в SEQ ID NO: 113. Последовательность ДНК, кодирующая легкую цепь (IgG1 и IgG4), продемонстрирована в SEQ ID NO: 112. Аминокислотная последовательность тяжелой цепи (НС) антитела huE104.v2 IgG1 продемонстрирована в SEQ ID NO: 80. Аминокислотная последовательность легкой цепи (LC) антитела huE104.v2 (IgG1 или IgG4) продемонстрирована в SEQ ID NO: 81. Аминокислотная последовательность НС антитела huE104.v2 IgG4 S228P продемонстрирована в SEQ ID NO: 82.

(v) Гуманизация мышиного моноклонального антитела 31А против триптазы

VL (SEQ ID NO: )20) и VH (SEQ ID NO: 19) домены из мышиного моноклонального антитела 31A ("mu. 31А") против триптазы выравнивали с консенсусными последовательностями VL каппа I человека (VLKI) и VH подгруппы III человека (VHIII) (SEQ ID NO: 92 и 93 соответственно). Гипервариабельные области (HVR) интегрировали в консенсусные акцепторные каркасы VLKI и VHIII человека для генерации CDR-привитых вариантов. Из домена mu. 31A VL, положения 24-34 (L1), 50-56 (L2) и 89-97 (L3) прививали в VLKI. Из домена mu. 31А VH, положения 26-35 (Н1), 50-65 (Н2) и 93-102 (Н3) прививали в VHIII. Чтобы оценить важность верньерных положений каркаса, выбранные верньерные положения мутировали обратно в последовательности мыши. Верньерные положения, которые были мутированы обратно в последовательности мыши, включали положения 4, 43, 46, 47 и 71 в VL и положение 49 в VH.

В общей сложности были синтезированы три гуманизированных LC и пять гуманизированных НС, а затем субклонированы в экспрессионные векторы млекопитающих pRK. Путем комбинирования различных версий LC и НС было сгенерировано в общей сложности пятнадцать различных гуманизированных вариантов антитела 31A (от v1 до v15) ("hu31A") (Таблица 4).

Все гуманизированные варианты антитела против триптазы экспрессировали в виде антител IgG1 или IgG4 в клетках млекопитающих. Антитела очищали путем аффинной хроматографии с помощью стандартных способов (MabSelect SuRe™; GE Healthcare, Piscataway, NJ, USA).

Последовательность ДНК, кодирующая домен VH антитела hu31A.v11, продемонстрирована в SEQ ID NO: 104. Последовательность ДНК, кодирующая домен VL антитела hu31A.v11, продемонстрирована в SEQ ID NO: 105. Последовательность ДНК, кодирующая тяжелую цепь (IgG1), продемонстрирована в SEQ ID NO: 106. Последовательность ДНК, кодирующая тяжелую цепь (IgG4. S228P), продемонстрирована в SEQ ID NO: 108. Последовательность ДНК, кодирующая легкую цепь (IgG1 и IgG4), продемонстрирована в SEQ ID NO: 107. Аминокислотная последовательность НС антитела hu31A.v11 IgG1 продемонстрирована в SEQ ID NO: 76. Аминокислотная последовательность LC антитела hu31A.v11 IgG1 продемонстрирована в SEQ ID NO: 77. Аминокислотная последовательность НС антитела hu31A.v11 IgG4 S228P продемонстрирована в SEQ ID NO: 78. Аминокислотная последовательность LC антитела hu31A.v11 IgG4 S228P продемонстрирована в SEQ ID NO: 79.

(vi) Клонирование, экспрессия и очистка Fab-фрагментов.

Fab клонировали и экспрессировали в Е. coli, как описано ранее (см. Simmons et al. J. Immunol. Methods 263: 133-147, 2002; Lombana et al. Sci. Rep. 5: 17488, 2015). Клеточную суспензию E. coli, содержащую экспрессированный Fab, собирали в результате ферментации экспрессирующих Fab, и растворяли в буфере PBS, содержащем 25 мМ ЭДТК и 1 мМ фенилметилсульфонилфторида (PMSF). Смесь гомогенизировали и затем дважды пропускали через микрофлюидизатор. Затем суспензию центрифугировали при 21500 × г в течение 60 минут. Супернатант затем загружали в колонку с белком G, уравновешенную PBS со скоростью 5 мл/мин. Колонку промывали буфером PBS до исходного уровня, а затем белки элюировали с применением 0,6% уксусной кислоты. Фракции, содержащие Fab, согласно анализу с помощью ДСН-ПААГ-электрофореза, объединяли и затем загружали в колонку SP SEPHAROSE® объемом 50 мл, уравновешенную в 20 мМ MES (рН 5,5). Колонку промывали 20 мМ MES буфером (рН 5,5) для 2 объемов колонки и затем элюировали с линейным градиентом до 0,5 М NaCl в 20 мМ MES буфере (рН 5,5). Для окончательной очистки, Fab-содержащие фракции, полученные после ионообменной хроматографии, концентрировали и загружали в колонку S75 для эксклюзионной хроматографии по размеру в буфере PBS. Аналогичный протокол использовали для всех Fab, применяемых в экспериментах.

(vii) Анализ гуманизированных вариантов антител против триптазы с применением поверхностного плазмонного резонанса (SPR) BIAcore®

В этом эксперименте все гуманизированные варианты были экспрессированы в виде IgG путем временной трансфекции клеток 293. IgG очищали с помощью аффинной хроматографии с белком G. Аффинность каждого варианта к рекомбинантному His-меченому мономеру триптазы бета 1 человека (SEQ ID NO: 128) определяли с помощью анализа SPR с применением BIAcore® Т200. Сенсорные чипы BIAcore® серии S СМ5 иммобилизовали моноклональным мышиным антителом против IgG (Fc) человека (Набор для захвата антител человека (Human antibody capture kit) от компании GE Healthcare), и антитела против триптазы впоследствии захватывались в проточной ячейке. Последовательные 3-кратные разведения мономера триптазы бета 1 человека вводили при скорости потока 30 мкл/мин. Каждый образец анализировали с 3-минутной ассоциацией и 10-минутной диссоциацией. После каждого введения чип регенерировали с применением 3 М MgCl2. Ответ связывания корректировали путем вычитания единиц ответа (RU) из проточной ячейки, захватывающей нерелевантный IgG с аналогичной плотностью. Для анализа кинетики применяли модель Ленгмюра 1:1 одновременной подгонки kon и koff.

(viii) Анализ ингибирующей активности гуманизированных вариантов антител против триптазы

a. Ферментативный анализ триптазы

Ингибирование активности триптазы человека гуманизированными антителами против триптазы измеряли с помощью анализа активности рекомбинантной триптазы. Антитела hu31a.v11 IgG4 и hu31a.v11 IgG1 разводили от 0,05 до 100 мкг/мл (от 0,30 до 667 нМ) в PBS, рН 7,4, а антитела huE104.v2 IgG4 и huE104.v2 IgG1 разводили от 0,02 до 50 мкг/мл (от 0,15 до 333 нМ) в PBS, рН 7,4. Активный фермент тетрамера рекомбинантной триптазы бета 1 человека разводили до 0,75 нМ в буфере TNH (200 мМ Трис, 150 мМ NaCl, 0,1 мг/мл гепарина, 0,01% TRITON™ Х-100, рН 8,0) и комбинировали в соотношении 1:1 с антителами против триптазы на черных 384-луночных планшетах (ViewPlate-384 F, Black, Clear-Bottom, Perkin Elmer, № по каталогу 6007470). Планшеты инкубировали в течение 1 часа при температуре окружающей среды при осторожном перемешивании. Колориметрический субстрат S-2288 (Chromogenix, Part No. 82-0852-39) разбавляли до 1200 мкМ в буфере TNH и добавляли на планшет. Конечные концентрации в лунках составляли 400 мкМ S-2288, 0,25 нМ рекомбинантного тетрамера триптазы бета 1 человека, 66 мкг/мл гепарина и от 0,10 нМ до 222 нМ антител против триптазы для hu31A.v11 и от 0,05 нМ до 111 нМ для huE104.v2. Планшеты инкубировали в течение 40 мин при температуре окружающей среды с осторожным перемешиванием, а затем считывали при А405. Значение IC50 антител против триптазы определяли по четырехпараметрическому соответствию их соответствующих кривых.

b. Анализ пролиферации и коллаген-зависимого сокращение клеток гладких мышц бронхов

Клетки гладких мышц бронхов человека (BSMC; № по каталогу СС-2576, Lonza Minneapolis, MN) культивировали в увлажненном инкубаторе при 37°С с 5% СО2 в полной питательной среде SmGM-2 (№ по каталогу СС-3182, Lonza). Среда для анализа представляла собой культуральную среду SmGm-2 без добавленной человеческой сыворотки или добавок (№ по каталогу СС-3181, Lonza). В указанных концентрациях применяли тетрамерную триптазу дикого типа человека или каталитически неактивный фермент триптазы S195A человека (нумерация химотрипсиногена). В указанных концентрациях применяли антитела против триптазы человека hu31A.v11 IgG4 и E104.v2 IgG4.

Для анализа пролиферации, за 1 день до проведения анализа, BSMC высевали в количестве 2×105 клеток/мл на 96-луночный планшет для тканевых культур (№ по каталогу 353072, Falcon BD) в полной культуральной среде. Через 24 часа культуральную среду заменяли средой для анализа, и клетки инкубировали в течение дополнительных 24 часов. Антитела против триптазы человека серийно разводили в 3,3 раза в среде для анализа на 96-луночном планшете для тканевых культур (№ по каталогу 353072, Falcon BD). 100 мкл разведенного антитела hu31A.v11 IgG4 переносили на 96-луночный планшет, содержащий 100 мкл 200 нМ триптазы человека. Активную триптазу и антитела против триптазы человека инкубировали в течение 30 мин при комнатной температуре. В это время среду для анализа удаляли из посаженных клеток и заменяли 100 мкл разведенных антител с триптазой. Конечная концентрация антител составляла от 2,0 мкМ до 4 пМ. Конечная концентрация триптазы составляла 100 нМ (без гепарина). Конечная концентрация соли составляла около 130 мМ. Лунки с одной только триптазой были включены в качестве стимулированных контролей. Лунки с одной только средой для анализа были включены в качестве нестимулированных контролей. Планшеты инкубировали в течение 24 ч при 37°С до добавления 1 мкКи Н3-тимидина на лунку. После дополнительных 6 ч инкубации пролиферацию измеряли по включению Н3-тимидина. Ассоциированную с клетками радиоактивность определяли количественно путем сцинтилляционного подсчета. Результаты выражали как среднее из трех образцов. Генерировали графики и проводили статистический анализ с применением KaleidaGraph (Synergy Software).

Для анализа коллаген-зависимого сокращения, за 1 день до проведения анализа, BSMC помещали в коллаген в количестве 9×106 клеток/мл на 24-луночный планшет (№ по каталогу 353047, Falcon BD) следуя рекомендациям производителя (№ по каталогу СВА-201, Cell BioLabs Inc.). После 1 ч инкубации при 37°С, на клетки наслаивали 1 мл среды для анализа. После 24 ч инкубации при 37°С, среду заменяли 250 мкл свежей среды для анализа. Триптазу разбавляли в 250 мкл среды для анализа до 660 нМ в присутствии или в отсутствие 4 мкМ антител против триптазы человека и инкубировали в течение 30 мин при 37°С до добавления в указанную лунку, содержащую матрикс клетка: коллаген. Конечные концентрации составляли 330 нМ триптазы и 2 мкМ антитела (без гепарина). Конечная концентрация соли составляла около 130 мМ. Сокращение клеток инициировали высвобождением матрикса матрикс клетка: коллаген из лунки планшета с помощью наконечника стерильной пипетки. Лунки с одной только средой для анализа применяли в качестве нестимулированного контроля. В начале сокращения клеток (t=0) матриксы клетка: коллаген визуализировали, отображали и регистрировали с помощью ProteinSimple AlphaImager®. Клетки инкубировали при 37° в течение дополнительных 3 ч и матриксы клетка: коллаген повторно анализировали и регистрировали (t=3). Данные анализировали с помощью программного обеспечения NIH Image J. Данные представляли как процентное изменение в диаметре матрикса клетка: коллаген от начала сокращения (t=0) до момента времени 3 часа (t=3). Результаты выражали как среднее из трех образцов.

с. Анализ высвобождения гистамина из тучных клеток

Применяли линию тучных клеток человека LAD2. Клетки LAD2 культивировали в увлажненном инкубаторе при 37°С с 5% СО2 в бессывороточной ростовой среде StemPro®-34, содержащей питательную добавку StemPro®-34 (№ по каталогу 10640-019, Gibco/Life Technologies), 1х пенициллин-стрептомицин-глютамина (№ по каталогу 10378-016, Gibco/Life Technologies) и 100 нг/мл рекомбинантного фактора стволовых клеток человека (SCF) (№ по каталогу 573908, BioLegend). См. публикацию Kirshenbaum et al. Leukemia Research 27: 677-682, 2003. Триптазу дикого типа человека или мутантную триптазу S195A человека применяли в указанных концентрациях. IgE против NP человека (JW8.5.13; see Jackman et al. J. Biol Chem. 285(27): 20850-20859, 2010) получали от компании Serotec Inc. NP-BSA (№ по каталогу N5050H-10, Biosearch Technologies, Petaluma, CA) применяли в указанной концентрации для запуска высвобождения гистамина. В указанных концентрациях применяли антитела против триптазы человека hu31A.v11 IgG4 и E104.v2 IgG4. Низкомолекулярный ингибитор G02849855 применяли в указанной концентрации. Стимуляции клеток осуществляли с применением соли Тироде (№ по каталогу Т-2397, Sigma). Уровень гистамина измеряли с помощью набора ИФА для гистамина (GenWay. № по каталогу 40-371-25010).

Для анализа высвобождения гистамина, запускаемого посредством IgE человека, клетки LAD2 высевали в количестве 4×106 клеток/4 мл в 2 лунках 6-луночного планшета. Анти-NP IgE (100 нг/мл) добавляли в одну лунку и клетки инкубировали в течение ночи при 37°С до примирования клеток. В другой лунке клетки культивировали только в среде без добавления анти-NP IgE для получения отрицательного контроля. После инкубации в течение ночи клетки промывали 3 раза средой для культивирования клеток для удаления несвязанного IgE. Клетки ресуспендировали в 4 мл солей Тироде (плотность клеток 1×106 клеток/мл) и аликвотировали в пробирки Eppendorf® (300000 клеток/пробирку). Образцы инкубировали с 100 мкг/мл hu31A.v11 IgG4 или 10 мкМ G02849855, тщательно перемешивали и инкубировали при комнатной температуре в течение 1 часа. После этой инкубации к образцам добавляли NP-BSA в конечной концентрации 0,1 мкг/мл для запуска дегрануляции клеток. Образцы тщательно перемешивали и инкубировали при 37°С в СО2 инкубаторе в течение 1 часа. Затем клетки центрифугировали при 3000 об/мин в течение 5 минут при комнатной температуре, и собирали супернатант для измерения уровня гистамина. Уровень гистамина в дегрануляционном супернатанте определяли количественно с помощью набора ИФА для гистамина. Данные представляли как среднее значение дубликатов образцов.

Для анализа высвобождения гистамина, запускаемого посредством триптазы человека, клетки LAD2 ресуспендировали в солях Тироде в концентрации 106 клеток/мл) и аликвотировали в пробирки Eppendorf® (300000 клеток/пробирку). Для ускорения дегрануляции клеток, клетки обрабатывали 3 мкг/мл триптазы (дикого типа или мутанта S195A) или 3 мкг/мл триптазы, которые предварительно инкубировали с 100 мкг/мл hu31A.v11 в течение 45 минут при комнатной температуре. PBS применяли в качестве контроля без стимуляции. Образцы тщательно перемешивали и инкубировали при 37°С в СО2 инкубаторе в течение 1 часа. Конечная концентрация соли составляла около 140 мМ. Затем клетки центрифугировали при 3000 об/мин в течение 5 минут при комнатной температуре, и собирали супернатант для измерения уровня гистамина. Уровень гистамина в дегрануляционном супернатанте определяли количественно с помощью набора ИФА для гистамина. Данные представляли как среднее значение дубликатов образцов.

(ix) Очистка тетрамеров и мономеров рекомбинантной триптазы.

Триптазу человека без эндогенного сигнального пептида (аминокислотные остатки 1-15 SEQ ID NO: 71) и пропептида (аминокислотные остатки 16-30 SEQ ID NO: 71) экспрессировали в клетках СНО млекопитающих в виде His-меченого рекомбинантного белка с сконструированным сайтом расщепления энтерокиназой и подвергали 5-кратной ультрафильтрации с последующим 5-кратным разведением в PBS. Среду затем загружали на колонку Ni-NTA и элюировали с применением 250 мМ имидазола. Элюат диализовали в 10 мМ MOPS, 0,2 М NaCl, рН 6,8 буфера с получением мономерной триптазы. Нерасщепленные His6-меченые мономеры триптазы остаются мономерными и не образуют тетрамеров.

Для генерации тетрамерной триптазы, мономерную триптазу, содержащую His-метку, расщепляли с помощью 0,1 мг/мл фермента энтерокиназы и стабилизировали натриевой солью декстрансульфата-10 в концентрации 0,5 мг/мл в течение 16-20 часов при комнатной температуре. Белок пропускали через колонку SUPERDEX™ 200 в конечный буфер 10 мМ MOPS, 2 М NaCl, рН 6,8 для отделения тетрамеров от мономеров и от любой остаточной загрязняющей протеазы. Типовый очищенный тетрамер продемонстрирован на Фиг. 3А, пик 1. Объединенную тетрамерную триптазу применяли для анализа иммунизации и активности.

В. Результаты

(i) Клонирование гибридомы

Молекулярное клонирование пяти кроличьих антител из ИФА-положительных клонов гибридомы выявило четыре уникальных клона против триптазы. Из них клон Е104 продемонстрировал наиболее сильную ингибирующую активность в ферментативном анализе и был выбран для дальнейшей инженерии. Параллельно, клон 31А мышиного моноклонального антитела против триптазы, который проявлял ингибирующую активность в ферментативном анализе, также был выбран для дальнейшей инженерии.

(ii) Генерация химерных вариантов Е104 (chE104)

Легкая цепь кроличьего моноклонального антитела против триптазы Е104 представляет собой легкую цепь каппа кролика, которая содержит дисульфидный мостик между Cys80 в FR3 вариабельного домена (VL) и Cys170 в константном домене (CL). С целью оценки важности Cys80 в VL, создали химерный вариант Е104 с цистеином в положении 80, мутированным в аланин (Cys80Ala). Как продемонстрировано в Таблице 2, нет никаких отличий между двумя вариантами с точки зрения выхода или агрегации, о чем свидетельствует высокий процент мономера в химерных вариантах как Cys80, так и Cys80Ala, определенных с помощью эксклюзионной хроматографии по размеру. Таким образом, было определено, что остаток Cys80 не был критически важным, и в гуманизированной версии Cys80 был заменен на остаток пролина, как в варианте с привитым VH4. Кроме того, химерные антитела Е104 с мутацией Cys80Ala в вариабельном домене FR3, слитые с константными доменами либо IgG1, либо IgG4 человека, продемонстрировали сходную ингибирующую активность, что и кроличье моноклональное антитело с цистеином в положении 80 (данные не приведены).

(iii) Гуманизация клона кроличьего моноклонального антитела Е104 против триптазы и клона мышиного моноклонального антителао против триптазы 31А

Все гуманизированные варианты были экспрессированы в виде IgG, а их аффинность связывания оценивали в анализе BIAcore® SPR. В целом, все гуманизированные варианты Е104 (huE104) демонстрировали сходные показатели аффинности связывания с мономером триптазы бета 1 человека (Таблица 3). В Таблице 3 перечислены варианты huE104, а также аффинность связывания (в показателях KD), как определено с помощью анализа BIAcore® SPR. В Таблице 3 также приведены SEQ ID NO доменов VH и VL для каждого варианта. Каждый клон в Таблице 3 был проанализирован в формате IgG1. Соответственно, очень похожие значения IC50 наблюдались для этих антител в анализе ферментативной активности, описанном выше, за исключением того, что клоны huE104.v1 и huE104.v5 и, в меньшей степени, huE104.v11 и huE104.v12, продемонстрировали некоторый "хук-эффект" (при котором увеличение ферментативной активности, то есть уменьшение ингибирующей активности антител, наблюдалось при высоких концентрациях антител) в ферментативном анализе. Модификации в области FR3 тяжелой цепи от V71 гуманизированного антитела к исходному остатку Arg кроличьего моноклонального антитела (V71R) и F78 гуманизированного антитела к исходному остатку Val кроличьего моноклонального антитела (F78V) устраняли наблюдаемый хук-эффект в E104.v1, v5, v11 и v12. Химерный клон Е104.v9 содержит R71 и V78, как в родительском кроличьем моноклональном антителе Е104. См. Таблицу 3. Как продемонстрировано на Фиг. 12В, остаток аргинина (R) в положении 71 и остаток валина (V) в положении 78 (оба по нумерации Кабата) могут играть важную роль в конформации HVR-H2 и, следовательно, в связывании антитела с триптазой. В результате, модификации V71R и F78V в huE104.v2, возможно, повлияли на конформацию петли триптазы 80, что важно при объединении двух протомеров, которые образуют малую поверхность контакта. См. Пример 3 ниже. Таким образом, hu104.v2, который имеет реверсии V71R и F78V, обладает улучшенной связывающей и ингибирующей активностью по сравнению с v1, который имеет V в положении 71 и F в положении 78. Все варианты, кроме v1, v5, v11 и v12, продемонстрировали полное ингибирование активности триптазы, что измерено с помощью ферментативного анализа, описанного выше. Гуманизированный клон huE104.v2 был выбран для дальнейшей оценки. Аминокислотные последовательности вариабельных доменов тяжелой и легкой цепей антитела huE104.v2 продемонстрированы на Фиг. 1.

В Таблице 4 перечислены варианты hu31A, а также аффинность связывания (в показателях KD, наномолярных), что определено с помощью анализа BIAcore® SPR. В Таблице 4 также приведены SEQ ID NO доменов VH и VL для каждого антитела. Все варианты продемонстрировали полное ингибирование активности триптазы, что измерено с помощью ферментативного анализа (данные не приведены). Каждый клон в Таблице 4 был проанализирован в формате IgG1. Клон hu31A.v11 продемонстрировал лучшую аффинность и лучшую ингибирующую активность в ферментативном анализе и поэтому был выбран для дальнейшей оценки. Аминокислотные последовательности вариабельных доменов тяжелой и легкой цепей антитела hu31A.v11 продемонстрированы на Фиг. 1.

Ингибирующую активность гуманизированных антител против триптазы также определяли с помощью анализа ферментативной активности рекомбинантной триптазы, описанного выше. Как h31A.v11, так и huE104.v2, IgG1 и IgG4, полностью ингибировали активность триптазы в ферментативном анализе (см. Фиг. 2А). Значения IC50 приведены ниже (Таблица 5).

Как hu31A.v11, так и huE104.v2 связывают и ингибируют триптазу бета 2 и бета 3 человека в дополнение к триптазе бета 1. Репрезентативные данные приведены ниже в Таблице 6 на основе протоколов, описанных выше для анализа аффинности и ферментативного анализа с применением триптазы бета 1 человека в качестве мишени. Как hu31A.v11, так и huE104.v2 также связывают и ингибируют триптазу D1 яванского макака.

Ингибирующую активность IgG4 hu31A.v11 или IgG4 huE104.v2 дополнительно оценивали на нескольких моделях ex vivo функции первичных глад ко мышечных клеток (ГМК) дыхательных путей человека. Добавление триптазы бета 1 к культуральной среде приводило к увеличению пролиферации первичных ГМК дыхательных путей человека (Фиг. 2В), а также к сокращению клеток (Фиг. 2С). Добавление hu31A.v11 или huE104.v2 приводило к дозозависимому снижению пролиферации, а при концентрации 300 мкг/мл ингибировало пролиферацию до исходных уровней (Фиг. 2В). Точно так же добавление hu31A.v11 или huE104.v2 уменьшало сокращение до исходных уровней (Фиг. 2С). Эти данные демонстрируют, что антитела против триптазы hu31A.v11 и huE104.v2 ингибируют функцию триптазы.

Добавление триптазы или IgE к тучным клеткам приводило к дегрануляции и высвобождению гистамина (Фиг. 2D-2E). Оценивали способность hu31A.v11 ингибировать высвобождение гистамина. Триптаза бета 1 с заменой S195A является каталитически неактивной. Добавление hu31A.v11 блокировало способность триптазы стимулировать высвобождение гистамина (Фиг. 2D-2E). Степень ингибирования (30-50%) была сходна с низкомолекулярным ингибитором активности триптазы бета 1, G02849855 (Фиг. 2Е). Эти результаты дополнительно демонстрируют, что антитело против триптазы hu31A.v11 ингибирует функцию триптазы.

Пример 2: hu31A.v11 и huE104.v2 IgG диссоциируют тетрамер триптазы бета человека

Кристаллическая структура активной тетрамерной триптазы демонстрирует, что каталитический сайт каждого протомера (представленный S195, Н57 и D102 каждого протомера, нумерация химотрипсиногена) расположен внутри поры тетрамера, и что доступ к активным сайтам ограничен таким образом, что только пептидные субстраты и более мелкие молекулы могут получить доступ (Pereira et al. Nature 392: 306-11, 1999). На сегодняшний день не известно, ингибируют ли ингибиторы сериновой протеазы млекопитающих протеолитическую активность триптазы. Ингибиторы сериновой протеазы человека с архитектоникой типа домена Кунитца слишком велики для доступа к активным сайтам. Не существует известных природных ингибиторов триптазы у людей. Единственными известными природными макромолекулярными ингибиторами триптазы на сегодняшний день являются ингибитор триптазы, полученный из пиявки (LDTI) (Sommerhoff et al. Biol. Chem. 373: 685-94, 1997) и ингибитор протеазы, полученный из клеща (TdPI) (Paesen et al. J. Mol. Biol. 368: 1172-86, 2007). LDTI (4,7 кДа) и TdPI (11,1 кДа) обладают способностью блокировать два или три из четырех активных сайтов тетрамера триптазы, соответственно. LDTI и TdPI не диссоциируют тетрамер триптазы. Как IgG, так и Fab антитела hu31A.v11 являются намного больше, чем LDTI или TdPI, и, тем не менее, они полностью ингибируют триптазу.

Авторы определили стехиометрию связывания Fab hu31A.v11 с тетрамерной триптазой в растворе. Активную тетрамерную триптазу бета 1 смешивали с 2-кратным молярным избытком Fab hu31A.v11 для каждого протомера, и комплексообразованию позволяли достичь равновесия. Поскольку тетрамер собран нековалентно, диссоциирующий эффект каждого антитела на тетрамерную структуру анализировали с помощью эксклюзионной хроматографии по размеру (SEC) и определяли время удерживания/объемы и молекулярные массы отдельных пиков белка. Фракции, содержащие белок, характеризовали с помощью ДСН-ПААГ-электрофореза для определения белковых компонентов (Фиг. 3А). Время удерживания одной тетрамерной триптазы было значительно короче (tr=26 мин, прогон 1, пик 1) чем в комплексе с Fab hu31A.v11 (tr=28,1 мин, прогон 3, пик 3). Дополнительный анализ SEC в сочетании с анализом многоуглового рассеяния лазерного излучения (MALS) выполняли для определения молекулярной массы элюированных белковых комплексов. Тетрамерная триптаза имела молекулярную массу 120 кДа ± 0,2% в соответствии с MALS, что согласуется с теоретической молекулярной массой 109,537 кДа, основанной на аминокислотной последовательности (исключая гликозилирование). Измерено, что пик белка, содержащего триптазу в комплексе с Fab hu31A.v11, составляет 67,7 кДа ± 3% согласно MALS (пик 3), что отражает комплекс, содержащий 1 мономер триптазы, связанный с 1 Fab. Это указывает на то, что тетрамер триптазы диссоциирует на мономеры при связывании с Fab hu31A.v11, что дополнительно подтверждается кристаллической структурой (см. Пример 3) и ингибирующей активностью hu31A.v11 Fab.

Когда тот же самый комплекс тетрамерная триптаза/Fab hu31A.v11 был проанализирован с помощью SEC в буфере для анализа ферментов, который содержал высокую концентрацию гепарина, например, 100 мкг/мл гепарина (прогон 2), время удерживания комплекса триптаза-Fab лишь немного сократилось с 28,1 мин (прогон 3, пик 3) до 27,6 мин (прогон 2, пик 2), вероятно, из-за связывания гепарина с белковым комплексом мономера триптазы и Fab. Гепарин из слизистой оболочки кишечника свиньи представляет собой смесь полианионных цепей, имеющих молекулярные массы в диапазоне от 6 кДа до 30 кДа, с большинством цепей с молекулярной массой в диапазоне от 17 кДа до 19 кДа. Этот результат указывает на то, что стабилизирующее действие гепарина на тетрамерную триптазу также нейтрализуется или нарушается посредством Fab hu31A.v11; даже высокая концентрация 100 мкг/мл гепарина не может помешать Fab hu31A.v11 полностью диссоциировать тетрамер. См. Фиг 3А.

Также определяли стехиометрию связывания huE104.v1 и huE104.v2 Fab с тетрамерной триптазой в растворе. Активную тетрамерную триптазу смешивали с 2-кратным молярным избытком Fab для каждого протомера, и комплексообразованию позволяли достичь равновесия. Полученную комплексную смесь разделяли с помощью SEC с триптазой SEC-буфером без гепарина и определяли время удерживания/объемы и молекулярные массы отдельных пиков белка). Фракции, содержащие белок, характеризовали с помощью ДСН-ПААГ-электрофореза для определения белковых компонентов (данные не приведены). Тетрамерная триптаза WT имела время удерживания tr=26 мин (см., например, пик 1 на Фиг. 3А) и молекулярную массу 120 кДа ± 0,2% в соответствии с MALS, что согласуется с теоретической молекулярной массой 109,537 кДа, основанной на аминокислотной последовательности (исключая гликозилирование).

huE104.v1 Fab образовали гомогенный комплекс с тетрамерной триптазой WT со временем удерживания tr=21,6 мин и молекулярной массой 276,1 кДа, что определено с помощью SEC-MALS (данные не приведены). Это будет представлять собой комплекс тетрамера триптазы с 4 Fab, связанными с ним. Анализ методом ДСН-ПААГ-электрофореза фракций с этого пика подтвердил присутствие Fab и протомеров триптазы. Таким образом, huE104.v1 Fab образовывали стабильный комплекс с тетрамерной триптазой и не влияли на стабильность тетрамера (данные не приведены).

Мономерную His6-меченую триптазу (Фиг. 3В, прогон 1) или тетрамерную триптазу WT (Фиг. 3В, прогон 2) смешивали с 2-кратным молярным избытком huE104.v2 Fab и каждую сложную смесь анализировали индивидуально с помощью SEC. Первый пик белка каждой хроматограммы имел время удерживания tr=25,8 мин (Фиг. 2В, прогон 1, пик 2) и tr=26 мин (Фиг. 2В, прогон 2, пик 3) соответственно. Анализ методом ДСН-ПААГ-электрофореза фракций из этих двух первых пиков продемонстрировал, что в этом пике присутствуют как триптаза, так и E104.v2 Fab. Оба пика белка также анализировали с помощью MALS, и определяли молекулярную массу, составляющую 68 кДа ± 3%, что отражает комплекс, содержащий 1 мономер триптазы, связанный с 1 Fab. Второй пик каждого прогона имел время удерживания tr=31,6 мин (прогон 1, пик 6) и tr=31,8 (прогон 2, пик 7), соответственно, и содержал только Fab huE104.v2, что определено с помощью ДСН-ПААГ-электрофореза. Хроматограммы обоих прогонов SEC практически совмещались, что указывает на то, что связывание huE104.v2 Fab диссоциирует тетрамерную триптазу WT на мономеры, поскольку время удерживания было практически идентичным, независимо от того, применяли тетрамерную триптазу или His-меченную мономерную триптазу для образования комплекса.

Когда тетрамерную триптазу снова смешивали с избытком Fab huE104.v2 в присутствии гепарина 100 мкг/мл и анализировали с помощью SEC в буфере TNH в качестве рабочего буфера (прогон 3), наблюдали 3 пика белка: первый пик имел намного более короткое время удерживания (tr=21 мин, Фиг. 3В, прогон 3, пик 1) по сравнению с тетрамерной триптазой WT, взятой отдельно (tr=26 мин, например, Фиг. 3А, пик 1). Второй пик имел время удерживания tr=27,2 мин (Фиг. 3В, прогон 3, пик 4), а последний пик имел время удерживания tr=31,2 мин (Фиг. 3В, прогон 3, пик 5), который является показателем Fab, взятого отдельно. Анализ с помощью ДСН-ПААГ-электрофореза продемонстрировал, что как триптаза, так и Fab присутствовали в пиках 1 и 4, причем пик 1 содержал активный тетрамер, связанный с huE104.v2 Fab, а пик 4 содержал мономер триптазы, связанный с huE104.v2 Fab (данные не приведены). Это позволило сделать вывод о том, что в присутствии высокой концентрации гепарина 100 мкг/мл только фракция тетрамерной триптазы диссоциировалась посредством huE104.v2 Fab, как в пике 4, тогда как большая часть триптазы оставалась тетрамерной триптазой, связанной с hu104.v2 Fab в пике 1. Таким образом, huE104.v1 Fab не демонстрировал определяемой ингибирующей активности, в то время как антитело huE104.v2 Fab полностью диссоциировало тетрамер триптазы. Однако в отличие от hu31A.v11 Fab или huE104.v2 IgG, способность huE104.v2 Fab диссоциировать тетрамер частично нейтрализовалась высокой концентрацией гепарина. Таким образом, на основании этих данных можно сделать вывод о том, что hu.31A.v11 Fab способен диссоциировать тетрамер триптазы с высокой концентрацией гепарина или без нее, a huE104.v2 Fab способен диссоциировать тетрамер триптазы в отсутствие высокой концентрации гепарина.

Каждый мономер триптазы имеет идентичный набор каталитической триады, и четыре мономера собираются вместе, образуя тетрамер с четырьмя каталитическими сайтами, обращенными к средней поре, в которую входит субстрат. См. Pereira et al., выше. Pereira et al. обсуждают конструкцию низкомолекулярных ингибиторов триптазы путем блокирования активных сайтов. Разработка нескольких низкомолекулярных ингибиторов триптазы была прекращена из-за низкой селективности или низкой биодоступности. См., например, Cairns, J.А., 2005, Pulmonary Pharmacology & Therapeutics 18: 55-66.

Тетрамерная триптаза дикого типа ко валентно не удерживается в собранном виде и может диссоциировать на мономеры в физиологических условиях (Schwartz et al. J. Biol. Chem. 261: 7372-7370, 1986; Alter et al. Biochem. J. 248: 821-827, 1987; Schwartz et al. J. Immunol. 144: 2304-2311, 1990). Сообщалось, что зрелая триптаза демонстрирует высокую ферментативную активность в форме тетрамера и неактивна в форме мономера в физиологически релевантных условиях. (Schwartz et al., J. Biol. Chem. 261: 7372-7379, 1986). Представленные в данном документе данные демонстрируют, что и hu31.v11, и huE104.v2 связываются с мономерами триптазы, диссоциируют тетрамер на мономеры, по меньшей мере при низкой концентрации гепарина, и после диссоциации остаются связанными с мономерами. Также сообщалось, что мономерная триптаза может быть ферментативно активной при определенных условиях. (Fukuoka et al. J. Immunol. 176: 3165, 2006; Fajardo et al., 2003, Biochem. J. 369: 603-610). Полученные наблюдения ставят вопрос о том, будет ли диссоциирующее антитело против триптазы уступать ингибитору, блокирующему активный сайт, такому как антитело, стабилизирующее тетрамер и блокирующее активный сайт, поскольку неактивный мономер в сыворотке может действовать как основной потребитель для диссоциирующих антител, которые связываются с мономерами. При этом антитело, стабилизирующее тетрамер и блокирующее активный сайт, может быть более выгодным в качестве терапевтического, если мономеры могут быть ферментативно активными при определенных условиях.

Сначала авторы исследовали эффективность тетрамер-диссоциирующего антитела по сравнению с тетрамер-стабилизирующим, нейтрализующим антителом в экспериментах in silico с применением модели фармакокинетики-фармакодинамики (ФКФД). Модель была разработана в программном обеспечении Simbiology® (Mathworks Inc., Cambridge, MA) для моделирования генерации, диссоциации и клиренса тетрамерной триптазы в циркулирующей крови и легочной ткани, а также ФК и связывающих эффектов антител против триптазы. Рассматриваются два типа антител: (1) диссоциирующее антитело, которое быстро диссоциирует тетрамер при связывании, но также связывает мономер; и (2) стабилизирующее, специфическое к тетрамеру антитело, которое связывает только активный тетрамер и нейтрализует его активность, блокируя доступ к его субстратам, но также продлевает период полужизни тетрамера. Антитело, диссоциирующее тетрамер со значением KD, составляющим 0,2 нМ, моделировали при гипотетической дозе 300 мг, вводимой подкожно каждые четыре недели. Авторы предположили 10% коэффициент легочного распределения антитела. Для исходного сценария авторы исходили из уровня общей триптазы в сыворотке - 4 нг/мл и общей триптазы в тканевом компартменте - 10 нг/мл, а для сценария с высоким содержанием триптазы авторы исходили из уровня триптазы в сыворотке - 10 нг/мл и триптазы в ткани - 40 нг/м. Относительные константы скорости физиологической диссоциации тетрамера на мономер и клиренса каждого вида приводят к соотношению мономера к тетрамеру 8:1 в пулах общей триптазы.

Для смоделированной схемы введения либо диссоциирующих, либо стабилизирующих антител по 300 мг подкожно один раз в 4 недели, на Фиг. 4А левые панели демонстрируют концентрацию как общего антитела, так и свободного/несвязанного антитела в легком при исходном сценарии, а правые панели демонстрируют соответствующие уровни триптазы в легком (свободная триптаза) относительно уровней до обработки как для мономера, так и для тетрамера. Результаты демонстрируют, что для диссоциирующего антитела со значением KD=0,2 нМ (верхние панели), большая часть антитела легких остается свободной (верхняя левая панель), что указывает на адекватную доступность лекарственного средства, несмотря на связывание с мономером и тетрамером; результаты также указывают на то, что диссоциирующее антитело достигнет устойчивого снижения, более чем на 90%, уровня тетрамерной (активной) триптазы (верхняя правая панель). Для стабилизирующего антитела (нижние панели), почти все антитело является свободным (нижняя левая панель); однако снижение уровня тетрамерной триптазы поддерживается только на 80% или выше.

Поскольку специфичность стабилизирующего антитела к тетрамеру можно считать выгодной в условиях высокого уровня общей триптазы, эти моделирования повторяли в сценарии с более высоким уровнем триптазы (Фиг. 4В). В этих условиях, более диссоциирующее антитело связывается с неактивной мономерной триптазой, что приводит к более низкому уровню свободного антитела (сравните верхнюю левую панель на Фиг. 4В с изображением на Фиг. 4А) и приводит к меньшей, но все же хорошей нейтрализации тетрамера (минимум ~80). %) посредством диссоциирующего антитела (Фиг. 4В, верхняя правая панель). Для сравнения, для антитела, стабилизирующего тетрамер, несмотря на большее свободное антитело из-за отсутствия связывания с мономером (Фиг. 4В, нижняя левая панель), указанное антитело достигает меньшей нейтрализации (минимум ~70%) по сравнению с диссоциирующим антителом в те же условиях, несмотря на в 10 раз более высокую аффинность, предполагаемую для стабилизирующего антитела (KD=0,02 нМ) при моделировании (Фиг. 4В, нижняя правая панель). Меньшая нейтрализация обусловлена большей стабильностью (период полужизни) связанной мишени, которая служит "резервуаром" для тетрамера. Таким образом, моделирование авторов предполагает, что диссоциирующее антитело является перспективным и будет работать лучше, чем специфическое к тетрамеру, стабилизирующее антитело при различных проанализированных сценариях.

Затем авторы проанализировали, как диссоциирующее антитело сравнивается с тетрамер-специфическим стабилизирующим антителом при разных дозах антитела. На Фиг. 4С продемонстрирована нейтрализация тетрамера для обоих типов антител как при исходном сценарии, так и при сценарии с высоким содержанием триптазы, в зависимости от уровня дозы антитела (30, 100, 300 мг подкожно 1 раз - в 4 недели). При исходном сценарии (Фиг. 4С, левые панели) диссоциирующее антитело последовательно снижает активность тетрамера в большей степени, чем стабилизирующее антитело, во всех рассматриваемых дозах. При сценарии с высоким содержанием триптазы (Фиг. 4С, правые панели) диссоциирующее антитело превосходит стабилизирующее антитело в отношении нейтрализации тетрамера во всех случаях, кроме самой низкой дозы (30 мг), в этот момент оба антитела действуют сравнимо. Как правило, меньшая нейтрализация достигается при применении стабилизирующего антитела, несмотря на 10-кратное увеличение аффинности (KD=0,02 нМ), по сравнению с диссоциирующим антителом (KD=0,2 нМ), что указывает на гораздо более высокую аффинность (>10х) для сопоставимой нейтрализации тетрамера при применении стабилизирующего антитела по сравнению с диссоциирующим антителом. Для обоих сценариев оптимальная доза для (90%) нейтрализации тетрамера является ниже для диссоциирующего антитела, чем для стабилизирующего антитела (результаты не приведены), несмотря на в 10 раз более высокую аффинность, предполагаемую для стабилизирующего антитела. Таким образом, согласно этой модели, диссоциирующее антитело будет превосходить или, по меньшей мере, соответствовать стабилизирующему антителу, которое имеет в 10 раз более высокую аффинность, во всем диапазоне доз и в анализируемых концентрациях триптазы в сыворотке и легком. Кроме того, авторы продемонстрировали, что hu31A.v11 и huE104.v2 IgG полностью ингибируют всю активность триптазы. См. Фиг. 2А и Таблицу 5.

Насколько авторам известно, не было ни одного примера антитела, диссоциирующего тетрамерную триптазу, и разработанного для терапевтического применения. Известно, что воспалительные локусы пораженных тканей, включая острое астматическое легкое, являются кислыми по сравнению с контрольными субъектами; см., например, Hunt et al. Am. J. Respir. Crit. Care Med. 161: 694-699, 2000; Steen et al. J. Neuroscience 15: 3982, 1995; Bellocq et al. J. Biol. Chem. 273: 5086, 1998; и Lardner J. Leukocyte Biol. 69: 522, 2001). Опубликованные данные продемонстрировали, что мышиное моноклональное антитело В12 против триптазы нейтрализует триптазу бета человека при нейтральном рН, но не способно нейтрализовать активность триптазы бета человека в ферментативном анализе при кислом рН 6 (см. Fukuoka et al. J. Immunol. 176: 3165, 2006). Поэтому авторы проанализировали антитела hu31a.v11 и huE104.v2 на их способность ингибировать активность триптазы бета человека при расщеплении фибриногена как при нейтральном рН, так и при кислом рН.

Вкратце, тетрамер триптазы бета человека (1,0 мкг/мл) предварительно инкубировали с исследуемым антителом в течение 30 мин в буфере TNH при рН 6,0 или 7,5 (50 мМ Трис, 150 мМ NaCl, 0,1 мг/мл гепарина) при комнатной температуре. Затем смесь инкубировали с 5 мкг фибриногенного субстрата человека (Haematologic Technologies, Inc., № по каталогу HIC-0150R) в течение 2,5 ч при 37°С. Каждое из антител hu31A.v11 Fab, huE104.v2 Fab и B12 mIgG1 анализировали в концентрации 200 мкг/мл. Продукты расщепления анализировали с помощью ДСН-ПААГ-электрофореза с окрашиванием Кумасси синим.

Как продемонстрировано на Фиг. 5А и 5В, триптаза бета 1 человека расщеплялась альфа- и бета-цепями фибриногена как при рН 6, так и при рН 7,5 (сравните полосу 1 - только фибриноген, с полосой 2 - фибриноген плюс триптаза бета 1). Антитело hu31A.v11 Fab ингибировало триптазу бета человека как при рН 6, так и при рН 7,5 (полоса 3), тогда как антитело huE104.v2 Fab в условиях анализа с высокой концентрацией гепарина 0,1 мг/мл, этого не осуществляло (полоса 5). Полоса 6 представляет собой только В12 mIgG1. Снижение интенсивности альфа-цепи фибриногена указывает на протеолитическую активность триптазы. Бета-цепь фибриногена также расщепляется, но расщепление бета-цепи имеет тенденцию затеняться на геле. Таким образом, интенсивность альфа-цепи была определена количественно и продемонстрирована на нижних панелях Фиг. 5А и 5В. Таким образом, антитело hu31A.v11 Fab ингибировало активность триптазы при рН 6 и 7,5, в то время как антитело huE104.v2 Fab в условиях анализа с высокой концентрацией гепарина не было ингибирующим.

Ингибирующую активность антител формата IgG (hu31A.v11 IgG4 и huE104.v2 IgG4) также оценивали с применением пептида S-2288 в качестве субстрата в анализе ингибирования в присутствии 1 нМ триптазы и 400 мкМ хромогенного S-2288 в буфере TNH при рН 6, 7 или 8. Конечная концентрация гепарина в этом эксперименте составляла около 95 мкг/мл. Как h31A.v11, так и hu.E104.v2 в формате IgG полностью ингибировали активность триптазы при рН 6, 7 и 8 (данные не приведены).

Следовательно, оба антитела: hu31A.v11 IgG и huE104.v2 IgG связываются с триптазой с высокой аффинностью, а также эффективно ингибируют активность триптазы в физиологически релевантных условиях при нарушениях, ассоциированных с триптазой, таких как астма. Представляет интерес тот факт, что в экспериментальных условиях авторов мышиное моноклональное антитело В12 IgG1 против триптазы человека также продемонстрировало ингибирование триптазы бета человека при рН 6 (Фиг. 5А, полоса 4), в отличие от опубликованных результатов. Несоответствие может быть связано с какой-либо остаточной активностью нетриптазной протеазы, присутствующей в материале, использованном для анализа в опубликованных данных, которая активировалась посредством кислого рН и была устойчивой к ингибированию В12.

Пример 3: Структурный анализ антител против триптазы

А. Антитела семейства 31А

(i). Рентгеновская кристаллография

Тетрамерную триптазу дикого типа смешивали с 1,5-кратным молярным избытком Fab hu31A.v11 и 2-кратным молярным избытком ингибитора трипсина сои (STI) (Roche) и инкубировали в течение 10 минут при комнатной температуре. STI добавляли для облегчения кристаллизации. Затем смесь подвергали анализу SEC с применением колонки S200 (GE Healthcare) в 10 мМ MOPS (рН 6,8), 0,5 М NaCl. Фракции, содержащие тройной комплекс триптазы, STI и Fab hu31A.v11, объединяли и концентрировали до 40 мг/мл.

Кристаллы триптазы/Fab hu31A.v11/STI выращивали при 19°С с помощью метода диффузии паров в подвесных каплях. Буфер для кристаллизации, содержащий 0,1 М Трис (рН 7,5), 0,2 М сульфата лития и 5% полиэтиленгликоля (ПЭГ) 4000, смешивали в равном объеме с белковым раствором. Кристаллы погружали в искусственный маточный раствор, содержащий 25% этиленгликоля, и остекловывали в жидком азоте.

В таблице 7 приведены собранные рентгеновские данные и информация о усовершенствовании структуры Fab hu31A.v11/триптаза/STI. Данные дифракции, распространяющиеся до 2,15 , собирали в гексагональной решетке в ALS Beamline 5.0.2. Сокращение и масштабирование данных позволили присвоить класс Лауэ 6/mmm (Otwinowski, Methods in Enzymol. 276, 307-326, 1997; Winn et al. Acta Crystallogr. Sect. D-Biol. Crystallogr. 67, 235-242, 2011). Исходя из объема элементарной ячейки и предполагаемого содержания белка, в кристаллографической асимметричной единице ожидался один комплекс Fab hu31A.v11/триптаза/STI. Структура была расшифрована с применением молекулярной замены (McCoy et al. J. Appl. Crystallogr. 40: 658-674, 2007) в пространственной группе P6222. Применяли следующие поисковые зонды, каждый в виде отдельных тел: ранее определенный протомер триптазы, полученный из PDB (База данных структуры белков), номер доступа 4A6L (Liang et al. Bioorg. Med. Chem. Lett. 22: 1049-1054, 2012), STI из PDB 1AVU (Song et al. J. Mol. Biol. 275: 347-363, 1998), фрагмент Fv, лишенный петель CDR из PDB 1FVC (Eigenbrot et al. J. Mol. Biol. 229: 969-995, 1993) и константную область из PDB 1FVD. После некоторого ограниченного усовершенствования (Murshudov et al. Acta Crystallogr. Sect. D-Biol. Crystallogr. 67: 355-367, 2011), карты распределения электронной плотности позволили исправить последовательность белка Fab и привести недостающие остатки и боковые цепи в чистую плотность (Emsley et al. Acta Crystallogr. Sect. D-Biol. Crystallogr. 66: 486-501, 2010). Воды добавляли автоматически (Adams et al. Acta Crystallogr. Sect. D-Biol. Crystallogr. 66: 213-221, 2010). В результате дополнительных этапов корректировки и усовершенствования модели (программное обеспечение BUSTER; Global Phasing Ltd., 2011) получили окончательную модель. Модель является континуальной для остатков триптазы Ile16 - Lys244 (нумерация химотрипсиногена), остатков STI Asp1 - Asp177, остатков легкой цепи Fab Asp1 - Cys214 (нумерация Кабата) (Kabat, Sequences of Proteins of Immunological Interest. Bethesda, MD, U.S. Dept. of Health and Human Services, Public Health Service, National Institutes of Health, 1991). Тяжелая цепь Fab является непрерывной за исключением промежутка в пять аминокислотных остатков в константном домене. Значение статистики комплементарности формы (Sc) (Lawrence et al. J. Mol. Biol. 234: 946-950, 1993) составляет 0,73, что согласуется с другими прочно связывающимися комплексами Fab/антиген. Самая большая область межбелковых контактов представляет собой область между триптазой и STI, поскольку каждый из элементов теряет 1260 доступной для растворителя поверхности (Broger С, xsae, F. Hoffman-La Roche, Basel, Switzerland, 2000) на своих контактных поверхностях. Напротив, контакт Fab/триптаза составляет только 760 с каждой стороны, равномерно распределенный между легкой и тяжелой цепями Fab. Контакты упаковки кристаллов, составляющие 4 или менее, хорошо распределены вокруг STI, триптазы и всех четырех доменов Fab и включают многочисленные водородные связи, а также гидрофобные контакты.

(ii) Эпитопное картирование антител против триптазы, проанализированное посредством водородно-дейтериевого обмена (HDX) и измеренное с помощью МС

Скорости поглощения дейтерия мономерной триптазой в присутствии и в отсутствие антитела измеряли для определения структурных областей, которые модифицируются при связывании антител. Связанные образцы содержали смесь триптазы и соответствующего антитела в соотношении 1:1, приготовленную и инкубированную при комнатной температуре в течение 1 часа. Концентрация триптазы до мечения дейтерием составляла 30 мкМ в связанных и несвязанных с антителами образцах. Эксперименты с HDX включали разведение образцов в 15 раз в буфере с меченым дейтерием, содержащем 20 мМ гистидина ацетата при pD 7,0. Шесть раз мечения, отобранные логарифмически между 30 с и 1000 мин, отбирали в трех экземплярах, гасили путем понижения рН до рН 2,5 и добавления 2 М хлорида гуанидиния (GdmCl) и 0,25 М трис(2-карбоксиэтил)фосфина (ТСЕР), и вводили в холодную онлайновую систему, как описано ранее (Mayne et al., J. Am. Soc. Mass. Spectrom. 22: 1898-1905, 2011).

Вкратце, образцы сначала пропускали через колонку с иммобилизованным пепсином (2,1×30 мм, Applied Biosystems) и загружали в предколонку (Acquity Vanguard С8) для обессоливания. Пептидные фрагменты затем разделяли с помощью обращенно-фазовой хроматографии с применением колонки Acquity UPLC™ ВЕН C18 (размер частиц 1,7 мкм, 1,0×50 мм) и вводили в масс-спектрометр (Thermo Orbitrap Elite™, разрешение 120 кГц при m/z 400) для масс-анализа. Хроматографические подвижные фазы готовили, как описано ранее, для минимизации обратного обмена дейтерия (Walters et al., J. Am. Soc. Mass Spectrom. 23: 2132-2139, 2012). Программу ExMS (Kan et al. J. Am. Soc. Mass. Spectrom. 22: 1906-1915, 2011) применяли для идентификации дейтерированных пептидов и подготовки экстрагированных ионных хроматограмм, которые затем анализировали с помощью внутрилабораторных сценариев Python (Walters et al. Proc. Natl. Acad. Sci. USA 110: 18898-18903, 2013). Эти сценарии объединяют вырожденные зарядовые состояния, подбирают изотопные распределения с помощью биномов и экстрагируют количество дейтерия, переносимого в среднем каждым пептидом.

(iii) Определение интактной массы методом жидкостной хроматографии/масс-спектрометрии (ЖХ/МС)

Очищенные белки (включая триптазу и ее мутанты) подкисляли 0,1% трифторуксусной кислотой (TFA) (Thermo, Rockford, IL) и разбавляли до конечной концентрации 10 мкМ. Образцы анализировали на квадрупольном времяпролетном (Q-TOF) спектрометре Agilent 6520 с точным измерением массы (Agilent 6520 Accurate-Mass quadrupole time-of-flight (Q-TOF)) в сочетании с хроматографом Agilent 1260 Infinity для высокопроизводительной жидкостной хроматографии (ВЖЭХ)-Chip Cube Interface (Agilent, Santa Clara, CA). Белки раз