Молекулы антител к cd73 и пути их применения




Владельцы патента RU 2791192:

НОВАРТИС АГ (CH)
СЕРФЕЙС ОНКОЛОДЖИ, ИНК. (US)

Изобретение относится к области биотехнологии, в частности к молекуле антитела, которая связывается с CD73 человека, к способу ее получения, а также к содержащей ее композиции. Также раскрыты нуклеиновая кислота, кодирующая вариабельную область тяжелой цепи, и нуклеиновая кислота, кодирующая вариабельную область легкой цепи вышеуказанной молекулы антитела, а также содержащая ее клетка и вектор. Изобретение также относится к способу обнаружения CD73 в биологическом образце или в субъекте, предусматривающему использование вышеуказанной молекулы антитела, которая связывается с CD73 человека. Изобретение эффективно для стимулирования иммунного ответа у субъекта, а также для лечения рака у субъекта. 17 н. и 13 з.п. ф-лы, 28 ил., 26 табл., 9 пр.

 

РОДСТВЕННЫЕ ЗАЯВКИ

Настоящая заявка испрашивает приоритет по заявке на патент США с порядковым № 62/523481, поданной 22 июня 2017 года, и заявке на патент США с порядковым № 62/636510, поданной 28 февраля 2018 года, содержание которых тем самым включено посредством ссылки во всей своей полноте.

ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Настоящая заявка содержит перечень последовательностей, который был подан в электронном виде в формате ASCII и включен в данный документ посредством ссылки во всей своей полноте. Указанная копия в формате ASCII, созданная 15 июня 2018 года, имеет название N2067-7123WO_SL.txt и размер 497959 байтов.

УРОВЕНЬ ТЕХНИКИ

Кластер дифференцировки 73 (CD73), также известный как экто-5'-нуклеотидаза (экто-5'NT), представляет собой гликозил-фосфатидилинозитол (GPI)-связанный фермент клеточной поверхности, присутствующий в большинстве тканей и, в частности, экспрессируемый в эндотелиальных клетках и подгруппах гематопоэтических клеток (Resta et al., Immunol Rev161:95-109 (1998) и Colgan et al., Prinergic Signal 2:351-60 (2006)). CD73 катализирует превращение аденозинмонофосфата (AMP) в аденозин. Аденозин является сигнальной молекулой, которая опосредует свои биологические эффекты с помощью нескольких рецепторов, в том числе рецепторов аденозина А1, А2А, А2В и А3. Рецептор A2A получил особое внимание из-за его обширной экспрессии на иммунных клетках. Аденозин характеризуется плейотропными эффектами в микроокружении опухоли, в том числе экспансией регуляторных Т-клеток (Tregs), ингибированием ответов эффекторных Т-клеток (Teff), опосредованных интерфероном (IFN)-γ, и экспансией супрессорных клеток миелоидного происхождения (MDSC). См., например, Allard B, et al., Curr Opin Pharmacol 29:7-16 (2016) и Allard D, et al., Immunotherapy 8:145-163 (2016).

CD73 также экспрессируется на раковых клетках, в том числе в случае рака толстой кишки, легкого, поджелудочной железы, яичника, мочевого пузыря, в случае лейкоза, глиомы, глиобластомы, меланомы, рака щитовидной железы, пищевода, простаты и молочной железы (Jin et al., Cancer Res 70:2245-55 (2010 ) и Stagg et al., PNAS 107: 1547-52 (2010); Zhang et al., Cancer Res 70:6407-11 (2010)). Сообщалось, что высокий уровень экспрессии CD73 коррелирует с неблагоприятным исходом при различных проявлениях рака, таких как рак легкого, меланома, трижды негативный рак молочной железы, плоскоклеточный рак головы и шеи и колоректальный рак. См., например, Allard B, et al., Expert Opin Ther Targets 18:863-881 (2014); Leclerc BG, et al., Clin Cancer Res 22:158-166 (2016); Ren ZH, et al., Oncotarget 7:61690-61702 (2016); Ren ZH, et al., Oncol Lett 12:556-562 (2016); и Turcotte M, et al., Cancer Res 75:4494-4503 (2015).

С учетом постоянной потребности в улучшенных стратегиях для нацеливания на заболевания, такие как рак, новые композиции и способы для регулирования активности CD73 и связанные с ними терапевтические средства являются весьма желательными.

КРАТКОЕ ОПИСАНИЕ

В данном документе раскрыты молекулы антител, которые связываются с CD73 (кластер дифференцировки 73) с высокой аффинностью и специфичностью. Также предусмотрены молекулы нуклеиновой кислоты, кодирующие молекулы антитела, векторы экспрессии, клетки-хозяева и способы получения молекул антитела. Также предусмотрены иммуноконъюгаты, молекулы мульти- или биспецифических антител и фармацевтические композиции, содержащие молекулы антител. Молекулы антитела к CD73, раскрытые в данном документе, можно применять (отдельно или в комбинации с другими средствами или терапевтическими воздействиями) для лечения, предупреждения и/или диагностики нарушений, в том числе иммунологических нарушений и рака. Таким образом, в данном документе раскрыты композиции и способы лечения и/или диагностики различных нарушений, в том числе рака и иммунологических нарушений, с применением молекул антитела к CD73.

Соответственно, в определенных аспектах в настоящем изобретении предусмотрена молекула антитела (например, выделенная или рекомбинантная молекула антитела), характеризующаяся одним или несколькими (например, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 или более, например, всеми) из следующих свойств:

(i) связывается с CD73, например CD73 человека, с высокой аффинностью, например, с константой диссоциации (KD), составляющей менее чем приблизительно 100 нМ, например менее чем приблизительно 10 нМ, 1 нМ, 0,1 нМ или 0,01 нМ, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением системы Octet;

(ii) связывается с растворимым CD73 человека или мембраносвязанным CD73 человека или и с тем, и с другим;

(iii) по сути связывается с CD73 приматов, отличных от человека, например с CD73 макака-крабоеда, с константой диссоциации (KD), составляющей менее чем приблизительно 100 нМ, например менее чем приблизительно 10 нМ, 1 нМ, 0,1 нМ или 0,01 нМ, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением системы Octet;

(iv) не связывается с CD73 мыши, например, при определении с применением системы Octet, например, как описано в примере 1;

(v) ингибирует или уменьшает ферментативную активность CD73 (например, растворимого CD73 человека или мембраносвязанного CD73 человека), например ингибирует опосредованное CD73 человека превращение аденозинмонофосфата (AMP) в аденозин или уменьшает его уровень, что например, измеряют с помощью способа, описанного в данном документе, например, при исследовании молекулы антитела в виде бивалентного антитела с помощью количественного определения фосфата по реакции с малахитовым зеленым (MG) или с помощью модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1;

(vi) увеличивает уровень пролиферации Т-клеток, стимулированных антителом к CD3/антителом к CD28, например Т-клеток CD4+, в присутствии аденозинмонофосфата (AMP), что например, измеряют с помощью описанного в данном документе способа, например, при исследовании молекулы антитела в виде бивалентного антитела в анализе пролиферации клеток CellTrace Violet (CTV), например, как описано в примере 1;

(vii) увеличивает уровень интернализации CD73 человека в клетку при связывании с CD73 человека, экспрессируемым на поверхности клетки, например увеличивает уровень интернализации CD73 человека в клетку в по меньшей мере 1,2 раза, 1,3 раза, 1,4 раза, 1,5 раза, 2 раза, 2,5 раза, 3 раза, 3,5 раза, 4 раза, 4,5 раза, 5 раз, 6 раз, 7 раз, 8 раз, 9 раз, 10 раз, 15 раз, 20 раз, 30 раз, 40 раз, 50 раз, 60 раз, 70 раз, 80 раз, 90 раз или 100 раз.

(viii) связывается с эпитопом на CD73, например таким же или сходным эпитопом, что и эпитоп, распознаваемый молекулой антитела, описанной в данном документе, например молекулой антитела к CD73 человека, описанной в данном документе, например молекулой антитела из таблицы 1;

(ix) связывается с таким же эпитопом (или по сути таким же) или эпитопом, перекрывающимся (или по сути перекрывающимся) с эпитопом второй молекулы антитела к CD73, где вторая молекула антитела представляет собой молекулу антитела, описанную в данном документе, например молекулу антитела, показанную в таблице 1;

(x) ингибирует, например, конкурентно ингибирует, связывание второй молекулы антитела к CD73, где вторая молекула антитела представляет собой молекулу антитела, описанную в данном документе, например, молекулу антитела, показанную в таблице 1;

(xi) характеризуется той же или аналогичной аффинностью или специфичностью связывания, или и тем, и тем, что и молекула антитела, описанная в таблице 1, например молекула антитела, содержащая вариабельную область тяжелой цепи и вариабельную область легкой цепи, показанная в таблице 1;

(xii) связывается с N-концевым доменом CD73 человека;

(xiii) связывается с A-петлей и/или B-петлей CD73 человека;

(xiv) уменьшает уровень водородно-дейтериевого обмена по одной или нескольким областям белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена;

(xv) при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), вызывает конформационное изменение остатков 368-387 из SEQ ID NO: 105;

(xvi) взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105;

(xvii) взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105;

(xviii) взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 368-387 из SEQ ID NO: 105 или 106;

(xix) взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 87-104 из SEQ ID NO: 105;

(xx) связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии;

(xxi) предпочтительно связывается с CD73 в открытой конформации, например в каталитически неактивной конформации, а не с CD73 в закрытой конформации, например в каталитически активной конформации, например не связывается или связывается с CD73 в закрытой конформации, например с CD73 в каталитически активной конформации, с более низкой аффинностью, например с аффинностью, которая ниже на 50%, 60%, 70%, 80%, 90%, 95%, или 99%, чем при связывании молекулы антитела с CD73 в открытой конформации, например каталитически неактивной конформации;

(xxii) блокирует CD73 человека в каталитически неактивной открытой конформации;

(xxiii) предотвращает превращение CD73 человека из каталитически неактивной открытой конформации в каталитически активную закрытую конформацию или уменьшает его уровень, например уменьшает уровень превращения в по меньшей мере 1,5 раза, 2 раза, 5 раз, 10 раз, 20 раз, 30 раз, 40 раз, 50 раз, 60 раз, 70 раз, 80 раз, 90 раз или 100 раз;

(xxiv) характеризуется одним или несколькими биологическими свойствами молекулы антитела, описанной в данном документе, например молекулы антитела, показанной в таблице 1;

(xxv) характеризуется одним или несколькими фармакокинетическими свойствами молекулы антитела, описанной в данном документе, например молекулы антитела, показанной в таблице 1;

(xxvi) модулирует (например, ингибирует) один или несколько видов активности CD73, например, приводит к одному или нескольким из следующего: ингибирование или снижение ферментативной активности CD73; ингибирование превращения аденозинмонофосфата (AMP) в аденозин или уменьшение его уровня; увеличение уровня пролиферации Т-клеток, стимулированных антителом к CD3/антителом к CD28, например Т-клеток CD4+, в присутствии аденозинмонофосфата (AMP); ингибирование пролиферации регуляторных Т-клеток; увеличение уровней ответов эффекторных Т-клеток; и/или ингибирование миграции, инфильтрации или размножения супрессорных клеток миелоидного происхождения.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии. В одном варианте осуществления первый или второй мономер CD73 содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105. В одном варианте осуществления первый или второй мономер CD73 состоит из аминокислотной последовательности под SEQ ID NO: 171.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35% или 40% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2. В одном варианте осуществления в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35% или 40% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии (SEC), предусматривающей следующие стадии:

(i) инкубирование образца, содержащего эквимолярное количество молекулы бивалентного антитела и мономера CD73, в течение ночи при 4°С;

(ii) пропускание образца через колонку для SEC (например, колонку Shodex Protein KW-803 (ID 8×300 мм)) при комнатной температуре в буфере, содержащем 90% 2x PBS и 10% изопропанола по объему; и

(iii) анализ пиков SEC с получением относительных процентных значений различимых видов антитела к CD73 путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 70%, 75% или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2. В одном варианте осуществления в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 70%, 75% или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии (SEC), предусматривающей следующие стадии:

(i) инкубирование образца, содержащего эквимолярное количество молекулы бивалентного антитела и мономера CD73, в течение ночи при 4°С;

(ii) пропускание образца через колонку для SEC (например, колонку Shodex Protein KW-803 (ID 8×300 мм)) при комнатной температуре в буфере, содержащем 90% 2x PBS и 10% изопропанола по объему; и

(iii) анализ пиков SEC с получением относительных процентных значений различимых видов антитела к CD73 путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела).

В одном аспекте в данном документе раскрыто несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 60%, 65% или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекул антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2. В одном варианте осуществления в данном документе раскрыто несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 60%, 65% или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии (SEC), предусматривающей следующие стадии:

(i) инкубирование образца, содержащего эквимолярное количество молекулы бивалентного антитела и мономера CD73, в течение ночи при 4°С;

(ii) пропускание образца через колонку для SEC (например, колонку Shodex Protein KW-803 (ID 8×300 мм)) при комнатной температуре в буфере, содержащем 90% 2x PBS и 10% изопропанола по объему; и

(iii) анализ пиков SEC с получением относительных процентных значений различимых видов антитела к CD73 путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела).

В одном аспекте в данном документе раскрыто несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25% или 30% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекул антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2. В одном варианте осуществления в данном документе раскрыто несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25% или 30% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии (SEC), предусматривающей следующие стадии:

(i) инкубирование образца, содержащего эквимолярное количество молекулы бивалентного антитела и мономера CD73, в течение ночи при 4°С;

(ii) пропускание образца через колонку для SEC (например, колонку Shodex Protein KW-803 (ID 8×300 мм)) при комнатной температуре в буфере, содержащем 90% 2x PBS и 10% изопропанола по объему; и

(iii) анализ пиков SEC с получением относительных процентных значений различимых видов антитела к CD73 путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, при этом молекула антитела предпочтительно связывается с CD73 в открытой конформации, например каталитически неактивной конформации, а не с CD73 в закрытой конформации, например каталитически активной конформации, например не связывает совсем или связывается с CD73 в закрытой конформации, например с CD73 в каталитически активной конформации, с более низкой аффинностью, например с аффинностью, которая ниже на 50%, 60%, 70%, 80%, 90%, 95%, или 99%, чем при связывании молекулы антитела с CD73 в открытой конформации, например каталитически неактивной конформации.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела предотвращает превращение CD73 человека из каталитически неактивной открытой конформации в каталитически активную закрытую конформацию или уменьшает его уровень, например уменьшает уровень превращения в по меньшей мере 1,5 раза, 2 раза, 5 раз, 10 раз, 20 раз, 30 раз, 40 раз, 50 раз, 60 раз, 70 раз, 80 раз, 90 раз или 100 раз по сравнению с уровнем превращения в отсутствие молекулы антитела.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остатку(-ам) XC, выбранным из коровой области С (остатки 368-387 из SEQ ID NO: 105), в большей степени, чем по остатку(-ам) XA, выбранным из коровой области A (остатки 158-172 из SEQ ID NO: 105), по остатку(-ам) XB, выбранным из коровой области В (остатки 206-215 из SEQ ID NO: 105), или по остатку(-ам) XD, выбранным из коровой области D (остатки 297-309 из SEQ ID NO: 105), например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре, при этом

XC равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, или 20,

XA равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, или 14,

XB равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, или 10, и

XD равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, или 13.

В одном варианте осуществления молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по 20 остаткам, выбранным из коровой области С, в большей степени, чем по

(i) 14 остаткам, выбранным из коровой области A,

(ii) 10 остаткам, выбранным из коровой области B, или

(iii) 13 остаткам, выбранным из коровой области D,

например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A и коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области B и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A, коровой области B и коровой области D.

В одном варианте осуществления молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по 15 остаткам, выбранным из коровой области С, в большей степени, чем по

(i) 10 остаткам, выбранным из коровой области A,

(ii) 8 остаткам, выбранным из коровой области B, или

(iii) 10 остаткам, выбранным из коровой области D,

например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A и коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области B и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A, коровой области B и коровой области D.

В одном варианте осуществления молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по 10 остаткам, выбранным из коровой области С, в большей степени, чем по

(i) 7 остаткам, выбранным из коровой области A,

(ii) 5 остаткам, выбранным из коровой области B, или

(iii) 7 остаткам, выбранным из коровой области D,

например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A и коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области B и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области C в большей степени, чем в коровой области A, коровой области B и коровой области D.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остатку(-ам) XA, выбранным из коровой области А (остатки 158-172 из SEQ ID NO: 105), в большей степени, чем по остатку(-ам) XB, выбранным из коровой области В (остатки 206-215 из SEQ ID NO: 105), по остатку(-ам) XC, выбранным из коровой области С (остатки 368-387 из SEQ ID NO: 105), или по остатку(-ам) XD, выбранным из коровой области D (остатки 297-309 из SEQ ID NO: 105), например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре, при этом:

XA равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, или 14,

XB равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, или 10,

XC равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, или 20, а

XD равняется 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, или 13.

В одном варианте осуществления молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по 14 остаткам, выбранным из коровой области A, в большей степени, чем по

(i) 10 остаткам, выбранным из коровой области B,

(ii) 20 остаткам, выбранным из коровой области С, или

(iii) 13 остаткам, выбранным из коровой области D,

например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области С. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В и коровой области С. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области С и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В, коровой области С и коровой области D.

В одном варианте осуществления молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по 10 остаткам, выбранным из коровой области A, в большей степени, чем по

(i) 8 остаткам, выбранным из коровой области B,

(ii) 15 остаткам, выбранным из коровой области С, или

(iii) 10 остаткам, выбранным из коровой области D, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области С. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В и коровой области С. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области С и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В, коровой области С и коровой области D.

В одном варианте осуществления молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по 7 остаткам, выбранным из коровой области A, в большей степени, чем по

(i) 5 остаткам, выбранным из коровой области B,

(ii) 10 остаткам, выбранным из коровой области С, или

(iii) 7 остаткам, выбранным из коровой области D,

например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области B. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области С. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В и коровой области С. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области С и коровой области D. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена в коровой области А в большей степени, чем в коровой области В, коровой области С и коровой области D.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105. В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105. В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 368-387 из SEQ ID NO: 105 или 106. В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела взаимодействует, например прямо или косвенно, с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 87-104 из SEQ ID NO: 105.

В одном варианте осуществления молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105. В одном варианте осуществления молекула антитела связывается с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105.

В качестве альтернативы или в комбинации с вариантом осуществления, описанным в данном документе, молекула антитела обеспечивает уменьшение уровня мечения с помощью метки для тандемной масс-спектрометрии (™T) по остатку K136 (пронумерованному в соответствии с SEQ ID NO: 105) белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, при его связывании, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением изотопного мечения с помощью ТМТ, например, с применением способов, описанных в примере 9, например, с применением изотопного мечения с помощью ТМТ, проводимого в течение времени мечения, составляющего 30 с, при этом необязательно молекула антитела дополнительно обеспечивает уменьшение уровня мечения с помощью ТМТ по одному или нескольким из остатков K133, K162, K179, K206, K214, K285, K291 и K341 (пронумерованных в соответствии с SEQ ID NO: 105) белка, например по одному или нескольким из остатков K162, K206, K214, K285, K291 и K341 (пронумерованных в соответствии с SEQ ID NO: 105) белка. В одном варианте осуществления молекула антитела обеспечивает увеличение уровня мечения с помощью ТМТ по одному или обоим из остатков K262 и K274 (пронумерованным в соответствии с SEQ ID NO: 105) белка при связывании с ним, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением изотопного мечения с помощью ТМТ, например, с применением способов, описанных в примере 9, например, с применением изотопного мечения с помощью ТМТ, проводимого в течение времени мечения, составляющего 30 с. В одном варианте осуществления молекула антитела обеспечивает уменьшение уровня мечения с помощью метки для тандемной масс-спектрометрии (™T) по остаткам K206 и K214 (пронумерованным в соответствии с SEQ ID NO: 105) белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, при его связывании, при этом уменьшение по остатку K214 составляет не менее 90, 80, 70, 60 или 50% от уменьшения по остатку K206, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением изотопного мечения с помощью ТМТ, например, с применением способов, описанных в примере 9, например, при этом уменьшение по остатку K214 составляет не менее 90, 80, 70, 60 или 50% от уменьшения по остатку K206 при применении изотопного мечения с помощью ТМТ, проводимого в течение времени мечения, составляющего 30 с, например, при этом уменьшение по остатку K214 составляет не менее 90, 80, 70, 60, 50, 40 или 30% от уменьшения по остатку K206 при применении изотопного мечения с помощью ТМТ, проводимого в течение времени мечения, составляющего 300 с. В одном варианте осуществления молекула антитела обеспечивает уменьшение уровня мечения с помощью метки для тандемной масс-спектрометрии (™T) по остатку K162 (пронумерованному в соответствии с SEQ ID NO: 105) белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, при его связывании при исследовании молекулы антитела с применением изотопного мечения с помощью ТМТ, проводимого в течение времени мечения, составляющего 30 с, при этом

(i) молекула антитела не обеспечивает уменьшение уровня мечения с помощью ТМТ по остатку K162 при исследовании с применением изотопного мечения с помощью ТМТ, проводимого в течение времени мечения, составляющего 300 с, или

(ii) молекула антитела обеспечивает уменьшение уровня мечения с помощью ТМТ по остатку K162 при исследовании с применением изотопного мечения с помощью ТМТ, проводимого в течение времени мечения, составляющего 300 с, при этом уменьшение по остатку K162 при времени мечения, составляющем 300 с составляет не более 20, 30, 40 или 50% от уменьшения по остатку K162 при времени мечения, составляющем 30 с,

например, при исследовании молекулы антитела в виде молекулы бивалентного антитела, например, с применением способов, описанных в примере 9.

В качестве альтернативы или в комбинации с вариантом осуществления, описанным в данном документе, молекула антитела связывается с одним или несколькими остатками CD73, например, посредством электростатического взаимодействия и/или водородной связи, где один или несколько остатков выбраны из группы, состоящей из остатков Y110, K136, L132, L157, K162, S155 и T209, пронумерованных в соответствии с SEQ ID NO: 105, что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8. В одном варианте осуществления молекула антитела содержит вариабельную область тяжелой цепи и вариабельную область легкой цепи, где молекула антитела характеризуется одним или несколькими (например, 1, 2, 3, 4 или всеми) из следующих свойств:

(i) молекула антитела (например, вариабельная область тяжелой цепи, например R54 из вариабельной области тяжелой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с Y110 (например, с карбонилом главной цепи Y110) или с K136 (например, с карбонилом главной цепи K136) из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), например, посредством электростатического взаимодействия, что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8,

(ii) молекула антитела (например, вариабельная область тяжелой цепи, например R31 из вариабельной области тяжелой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с L132 (например, с карбонилом главной цепи L132) или с L157 (например, с карбонилом главной цепи L157) из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), например, посредством электростатического взаимодействия, что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8,

(iii) молекула антитела (например, вариабельная область тяжелой цепи, например S99 (например, карбонил главной цепи S99), R31 (например, карбонил главной цепи R31) или E95 (например, боковая цепь E95) из вариабельной области тяжелой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с K162 (например, боковой цепью K162) из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), например, посредством электростатического взаимодействия, что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8,

(iv) молекула антитела (например, вариабельная область тяжелой цепи, например E98 из вариабельной области тяжелой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с S155 (например, боковой цепью S155) из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), например, посредством водородной связи, что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8, и

(v) молекула антитела (например, вариабельная область легкой цепи, например W32 (например, боковая цепь W32) из вариабельной области легкой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с T209 (например, боковой цепью T209) из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), например, посредством водородной связи, что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8.

В одном варианте осуществления молекула антитела связывается с одной или несколькими областями CD73, например, посредством комплементарности формы и/или вандерваальсовых взаимодействий, при этом одна или несколько областей выбраны из группы, состоящей из остатков 155-170, 136-138 и 209-210, пронумерованных в соответствии с SEQ ID NO: 105, что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8. В одном варианте осуществления молекула антитела содержит вариабельную область тяжелой цепи и вариабельную область легкой цепи, при этом молекула антитела характеризуется одним или несколькими (например, 1, 2 или всеми) из следующих свойств:

(i) молекула антитела (например, вариабельная область тяжелой цепи, например остатки 33, 50, 52, 56, 97, 98, 100 или 100a вариабельной области тяжелой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с остатками 155-170 из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), например, посредством комплементарности формы и/или вандерваальсовых взаимодействий, что, например, определено с применением анализа кристаллической структуры, например, с применением способов, описанных в примере 8,

(ii) молекула антитела (например, вариабельная область тяжелой цепи, например остатки 30 или 31 вариабельной области тяжелой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с остатками 136-138 из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), например, посредством комплементарности формы и/или вандерваальсовых взаимодействий, что, например, определено с применением анализа кристаллической структуры, например, с применением способов, описанных в примере 8, и

(iii) молекула антитела (например, вариабельная область легкой цепи, например остатки 30 или 32 вариабельной области легкой цепи, пронумерованной в соответствии с нумерацией по Kabat) связывается с остатками 209-210 из CD73 (пронумерованного в соответствии с SEQ ID NO: 105), что, например, определено с применением анализа кристаллической структуры, например с применением способов, описанных в примере 8.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где молекула антитела содержит по меньшей мере одну, две, три, четыре, пять или шесть определяющих комплементарность областей (CDR) (или в совокупности все CDR) из вариабельной области тяжелой и/или вариабельной области легкой цепи, содержащей аминокислотную последовательность, показанную в таблице 1 (например, из последовательностей вариабельной области тяжелой и легкой цепи антитела, раскрытого в таблице 1, например, антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398), или кодируемой нуклеотидной последовательностью, показанной в таблице 1. В некоторых вариантах осуществления CDR определены в соответствии со схемой нумерации по Kabat (например, как изложено в таблице 1). В некоторых вариантах осуществления CDR определены в соответствии со схемой нумерации по Chothia (например, как изложено в таблице 1). В некоторых вариантах осуществления CDR определены в соответствии с комбинированной схемой нумерации, основанной на нумерации по Kabat и нумерации по Chothia (например, как изложено в таблице 1). В некоторых вариантах осуществления CDR определены в соответствии со схемой нумерации по IMGT (например, как изложено в таблице 1). В одном варианте осуществления одна или несколько CDR (или в совокупности все CDR) имеют одно, два, три, четыре, пять, шесть или более изменений, например, аминокислотных замен (например, консервативных аминокислотных замен) или делеций по сравнению с аминокислотной последовательностью, показанной в таблице 1, или кодируемой нуклеотидной последовательностью, показанной в таблице 1.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, содержащая вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, содержащая:

(i) вариабельную область тяжелой цепи (VH), содержащую одно, два или три из аминокислотной последовательности X1X2AMS из определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотной последовательности X1IX2GX3GX4X5TYYADSVKG из VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотной последовательности GGLYGSGSYLSDFDL из VHCDR3 (SEQ ID NO: 37); и/или

(ii) вариабельную область легкой цепи (VL), содержащую одно, два или три из аминокислотной последовательности RASQSVGSNLA из определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотной последовательности GASTRAT из VLCDR2 (SEQ ID NO: 49); и аминокислотной последовательности QQHNAFPYT из VLCDR3 (SEQ ID NO: 50).

В некоторых вариантах осуществления молекула антитела к CD73 содержит:

(i) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 38, аминокислотной последовательности VHCDR2 под SEQ ID NO: 36 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 37 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 48, аминокислотной последовательности VLCDR2 под SEQ ID NO: 49 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 50 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен);

(ii) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 72, аминокислотной последовательности VHCDR2 под SEQ ID NO: 71 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 37 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 48, аминокислотной последовательности VLCDR2 под SEQ ID NO: 49 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 50 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен);

(iii) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 38, аминокислотной последовательности VHCDR2 под SEQ ID NO: 71 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 37 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 48, аминокислотной последовательности VLCDR2 под SEQ ID NO: 49 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 50 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен);

(iv) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 137, аминокислотной последовательности VHCDR2 под SEQ ID NO: 136 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 37 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 48, аминокислотной последовательности VLCDR2 под SEQ ID NO: 49 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 50 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен);

(v) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 137, аминокислотной последовательности VHCDR2 под SEQ ID NO: 146 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 37 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 48, аминокислотной последовательности VLCDR2 под SEQ ID NO: 49 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 50 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); или

(vi) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 137, аминокислотной последовательности VHCDR2 под SEQ ID NO: 154 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 37 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 48, аминокислотной последовательности VLCDR2 под SEQ ID NO: 49 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 50 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен).

В некоторых вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 44, 77, 84, 142, 151 или 159 или аминокислотную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 44, 77, 84, 142, 151 или 159.

В некоторых вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 55, или аминокислотную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 55.

В некоторых вариантах осуществления молекула антитела к CD73 содержит тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 46, 79, 86, 114, 116 или 117 или аминокислотную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 46, 79, 86, 114, 116 или 117.

В некоторых вариантах осуществления молекула антитела к CD73 содержит легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 57 или аминокислотную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 57.

В некоторых вариантах осуществления молекула антитела к CD73 содержит:

(i) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 44 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 55 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(ii) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 77 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 55 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(iii) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 84 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 55 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(iv) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 142 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 55 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(v) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 151 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 55 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней); или

(vi) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 159 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 55 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней).

В некоторых вариантах осуществления молекула антитела к CD73 содержит:

(i) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 46 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней) и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 57 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(ii) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 114 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 57 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(iii) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 79 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 57 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(iv) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 116 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 57 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(v) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 86 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 57 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней); или

(vi) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 117 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 57 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, содержащая вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, содержащая:

(i) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и/или

(ii) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В некоторых вариантах осуществления молекула антитела к CD73 содержит:

(i) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 61, аминокислотной последовательности VHCDR2 под SEQ ID NO: 60 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 3 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 14, аминокислотной последовательности VLCDR2 под SEQ ID NO: 15 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 16 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен);

(ii) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 4, аминокислотной последовательности VHCDR2 под SEQ ID NO: 26 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 3 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 14, аминокислотной последовательности VLCDR2 под SEQ ID NO: 15 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 16 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен);

(iii) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 4, аминокислотной последовательности VHCDR2 под SEQ ID NO: 2 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 3 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 14, аминокислотной последовательности VLCDR2 под SEQ ID NO: 15 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 16 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); или

(iv) VH, содержащую одно, два или три из аминокислотной последовательности VHCDR1 под SEQ ID NO: 163, аминокислотной последовательности VHCDR2 под SEQ ID NO: 162 и аминокислотной последовательности VHCDR3 под SEQ ID NO: 3 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен); и VL, содержащую одно, два или три из аминокислотной последовательности VLCDR1 под SEQ ID NO: 14, аминокислотной последовательности VLCDR2 под SEQ ID NO: 15 и аминокислотной последовательности VLCDR3 под SEQ ID NO: 16 (или последовательности, характеризующейся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащей одну, две, три или более замен, вставок или делеций, например консервативных замен).

В некоторых вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 66, 31, 10 или 168 или аминокислотную последовательность, характеризующуюся по меньшей мере 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 66, 31, 10 или 168.

В некоторых вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 21 или аминокислотную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 21.

В некоторых вариантах осуществления молекула антитела к CD73 содержит тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 68, 33, 12, 115, 113 или 112 или аминокислотную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 68, 33, 12, 115, 113 или 112.

В некоторых вариантах осуществления молекула антитела к CD73 содержит легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 23 или аминокислотную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 23.

В некоторых вариантах осуществления молекула антитела к CD73 содержит:

(i) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 66 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 21 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(ii) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 31 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 21 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(iii) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 10 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 21 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней); или

(iv) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 168 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и вариабельную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 21 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней).

В некоторых вариантах осуществления молекула антитела к CD73 содержит:

(i) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 68 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 23 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(ii) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 115 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 23 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(iii) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 33 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 23 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(iv) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 113 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 23 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней);

(v) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 12 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 23 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней); или

(vi) тяжелую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 112 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней), и легкую цепь, содержащую аминокислотную последовательность под SEQ ID NO: 23 (или последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней).

В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH3-23 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK3-15 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH3-23 человека, и вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK3-15 человека.

В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH4-59 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-12 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH4-59 человека, и вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-12 человека.

В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH3-23 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-05 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH3-23 человека, и вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-05 человека.

В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH1-02 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-12 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH1-02 человека, и вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-12 человека.

В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH3-07 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK4-01 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH3-07 человека, и вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK4-01 человека.

В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH1-69 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK3-15 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH1-69 человека, и вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK3-15 человека.

В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH4-34 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-12 человека. В определенных вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VH4-34 человека, и вариабельную область легкой цепи, имеющую аминокислотную последовательность, полученную из последовательности зародышевого типа VK1-12 человека.

В определенных вариантах осуществления молекула антитела к CD73 представляет собой моноклональное антитело или антитело с одной специфичностью. В определенных вариантах осуществления молекула антитела к CD73 представляет собой биспецифическое или полиспецифическое антитело. Тяжелая и легкая цепи молекулы антитела к CD73 могут быть полноразмерными (например, антитело может содержать по меньшей мере одну или по меньшей мере две полные тяжелые цепи, и по меньшей мере одну или по меньшей мере две полные легкие цепи) или могут содержать антигенсвязывающий фрагмент (например, Fab, F(ab')2, Fv, одноцепочечный фрагмент Fv, однодоменное антитело, диатело (dAb), бивалентное или биспецифическое антитело или его фрагмент, его однодоменный вариант или верблюжье антитело).

В определенных вариантах осуществления молекула антитела к CD73 имеет константную область тяжелой цепи (Fc), выбранную, например, из константных областей тяжелой цепи IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD и IgE; в частности, выбранную, например, из константных областей тяжелой цепи IgG1, IgG2, IgG3 и IgG4, более конкретно, константной области тяжелой цепи IgG4. В некоторых вариантах осуществления константная область тяжелой цепи представляет такую из IgG4 человека. В некоторых вариантах осуществления молекула антитела к CD73 содержит константную область легкой цепи, выбранную из, например, константных областей легкой каппа- или лямбда-цепи. В некоторых вариантах осуществления константная область легкой цепи представляет собой такую каппа-цепи (например, каппа-цепи человека). В некоторых вариантах осуществления константная область изменена, например подвергнута мутации, для модификации свойств молекулы антитела к CD73 (например, повышения или снижения одного или нескольких из связывания с рецептором Fc, гликозилирования антител, числа цистеиновых остатков, функции эффекторных клеток или функции комплемента). В некоторых вариантах осуществления константная область тяжелой цепи IgG4, например IgG4 человека, является подвергнутой мутации в положении 228 в соответствии с нумерацией Eu (например, S на P), например, как показано в таблице 3. В определенных вариантах осуществления молекулы антител к CD73 предусматривают IgG4 человека, подвергнутый мутации в положении 228 в соответствии с нумерацией Eu (например, S на P), например, как показано в таблице 3; и константную область легкой каппа-цепи, например, как показано в таблице 3. В некоторых вариантах осуществления константная область тяжелой цепи IgG4, например IgG4 человека, является подвергнутой мутации в положении 228 (например, S на P) и в положении 235 (например, L на E) в соответствии с нумерацией Eu, например, как показано в таблице 3. В определенных вариантах осуществления молекулы антител к CD73 предусматривают IgG4 человека, подвергнутый мутации в положении 228 (например, S на P) и в положении 235 (например, L на E) в соответствии с нумерацией Eu, например, как показано в таблице 3; и константную область легкой каппа-цепи, например, как показано в таблице 3. В еще одном варианте осуществления константная область тяжелой цепи IgG1, например IgG1 человека, является подвергнутой мутации в одном или нескольких из положения 297 (например, N на A), положения 265 (например, D на A), положения 329 (например, P на A), положения 234 (например, L на A) или положения 235 (например, L на A), все в соответствии с нумерацией Eu, например, как показано в таблице 3. В определенных вариантах осуществления молекулы антител к CD73 содержат IgG1 человека, подвергнутый мутации в одном или нескольких из вышеупомянутых положений, например, как показано, в таблице 3; и константную область легкой каппа-цепи, например, как показано в таблице 3.

В некоторых вариантах осуществления молекула антитела к CD73 содержит константную область тяжелой цепи, выбранную из IgG1, IgG2, IgG3 и IgG4, и константную область легкой цепи, выбранную из константных областей легкой каппа- или лямбда-цепи. В некоторых вариантах осуществления молекула антитела к CD73 содержит константную область тяжелой цепи, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 92-103, 119 и 120, и константную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 104.

В одном аспекте настоящее изобретение относится к молекуле антитела, которая конкурирует с моноклональным антителом, например молекулой антитела, описанной в данном документе, за связывание с CD73 человека. Настоящее изобретение также относится к молекуле антитела, которая связывается с тем же (или по сути тем же) эпитопом, что и моноклональное антитело, например молекула антитела, описанная в данном документе, к CD73 человека, или перекрывающимся (или по сути перекрывающимся) с ним.

В одном варианте осуществления моноклональное антитело содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В определенных вариантах осуществления моноклональное антитело содержит:

(i) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и/или

(ii) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В определенных вариантах осуществления моноклональное антитело содержит:

(i) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(ii) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(iii) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(iv) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(v) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(vi) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном варианте осуществления моноклональное антитело содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В определенных вариантах осуществления моноклональное антитело содержит:

(i) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и/или

(ii) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В определенных вариантах осуществления моноклональное антитело содержит:

(i) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(ii) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(iii) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(iv) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте настоящее изобретение относится к молекуле нуклеиновой кислоты, которая содержит одну или обе нуклеотидные последовательности, которые кодируют вариабельные области тяжелой и легкой цепи, CDR, гипервариабельные петли, каркасные области молекул антитела к CD73, описанных в данном документе. В определенных вариантах осуществления нуклеотидная последовательность, которая кодирует молекулу антитела к CD73, является кодон-оптимизированной. Например, настоящее изобретение относится к первой и второй нуклеиновым кислотам, кодирующим вариабельные области соответственно тяжелой и легкой цепей молекулы антитела к CD73, выбранной, например, из любой из 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430 или 398, совместно представленных в таблице 1, или последовательности, по сути идентичной им. Например, нуклеиновая кислота может содержать нуклеотидную последовательность, такую, как изложено в таблице 1, или последовательность, по сути идентичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности, или которая отличается на не более чем 3, 6, 15, 30 или 45 нуклеотидов от последовательностей, показанных в таблице 1).

В одном аспекте раскрыты нуклеиновые кислоты, содержащие нуклеотидные последовательности, которые кодируют вариабельные области тяжелой и легкой цепи, и CDR молекул антитела к CD73, описанных в данном документе. Например, в настоящем изобретении предусмотрена первая и вторая нуклеиновые кислоты, кодирующие соответственно вариабельные области тяжелой и легкой цепей молекулы антитела к CD73 в соответствии с таблицей 1, или последовательности, по сути идентичные им. Например, нуклеиновая кислота может содержать нуклеотидную последовательность, кодирующую молекулу антитела к CD73 в соответствии с таблицей 1, или последовательность, по сути идентичную этой нуклеотидной последовательности (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности или которая отличается на не более чем 3, 6, 15, 30 или 45 нуклеотидов от вышеуказанной нуклеотидной последовательности).

В определенных вариантах осуществления нуклеиновая кислота может содержать нуклеотидную последовательность, кодирующую по меньшей мере одну, две или три CDR или гипервариабельные петли из вариабельной области тяжелой цепи, имеющей аминокислотную последовательность, изложенную в таблице 1, или последовательность, по сути гомологичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен).

В определенных вариантах осуществления нуклеиновая кислота может содержать нуклеотидную последовательность, кодирующую по меньшей мере одну, две или три CDR или гипервариабельные петли из вариабельной области легкой цепи, имеющей аминокислотную последовательность, изложенную в таблице 1, или последовательность, по сути гомологичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен).

В определенных вариантах осуществления нуклеиновая кислота может содержать нуклеотидную последовательность, кодирующую по меньшей мере одну, две, три, четыре, пять или шесть CDR, или гипервариабельные петли из вариабельных областей тяжелой и легкой цепей, имеющих аминокислотную последовательность, изложенную в таблице 1, или последовательность, по сути гомологичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен).

В определенных вариантах осуществления нуклеиновая кислота кодирует вариабельную область тяжелой цепи, где нуклеиновая кислота содержит нуклеотидную последовательность под SEQ ID NO: 45, 78, 85, 143, 152, 160, 67, 32, 11 или 169 или нуклеотидную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 45, 78, 85, 143, 152, 160, 67, 32, 11 или 169.

В определенных вариантах осуществления нуклеиновая кислота кодирует тяжелую цепь, где нуклеиновая кислота содержит нуклеотидную последовательность под SEQ ID NO: 47, 80, 87, 69, 34 или 13 или нуклеотидную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 47, 80, 87, 69, 34 или 13.

В определенных вариантах осуществления нуклеиновая кислота кодирует вариабельную область легкой цепи, где нуклеиновая кислота содержит нуклеотидную последовательность под SEQ ID NO: 56, 144, 22 или 170 или нуклеотидную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 56, 144, 22 или 170.

В определенных вариантах осуществления нуклеиновая кислота кодирует легкую цепь, где нуклеиновая кислота содержит нуклеотидную последовательность под SEQ ID NO: 58 или 24 или нуклеотидную последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с SEQ ID NO: 58 или 24.

В одном аспекте данное раскрытие относится к клеткам-хозяевам и векторам, содержащим нуклеиновые кислоты, описанные в данном документе. Нуклеиновые кислоты могут присутствовать в одном векторе или отдельных векторах, присутствующих в одной и той же клетке-хозяине или отдельной клетке-хозяине. В данном документе также предусмотрен способ получения молекулы антитела к C73, при этом способ включает культивирование клетки-хозяина, раскрытой в данном документе, в условиях, подходящих для экспрессии гена.

В одном аспекте в настоящем изобретении предусмотрен способ получения молекулы антитела, описанной в данном документе. Способ может включать: обеспечение антигена CD73 (например, антигена, содержащего по меньшей мере часть эпитопа CD73, например, N-концевой домен антигена CD73); получение молекулы антитела, которая связывается с антигеном CD73; и оценивание того, связывается ли молекула антитела с антигеном CD73, или оценивание эффективности молекулы антитела в отношении модулирования, например стимулирования или ингибирования, активности CD73. Способ может дополнительно включать введение молекулы антитела субъекту, например человеку или животному, отличному от человека.

В одном аспекте в настоящем изобретении предусмотрены композиции, например фармацевтические композиции, которые содержат фармацевтически приемлемый носитель, вспомогательное вещество или стабилизатор и по меньшей мере одну из молекул антитела к CD73, описанных в данном документе. В одном варианте осуществления композиция, например фармацевтическая композиция, содержит комбинацию молекулы антитела и одного или нескольких средств, например терапевтического средства или другой молекулы антитела, описанных в данном документе. В некоторых вариантах осуществления молекула антитела конъюгирована с меткой или терапевтическим средством. В некоторых вариантах осуществления композиции, например фармацевтические композиции, содержат комбинацию молекулы антитела и второго средства, например терапевтического средства или двух или более из вышеупомянутых молекул антитела, дополнительно описанных в данном документе.

Молекулы антитела к CD73, раскрытые в данном документе, могут ингибировать, уменьшать или нейтрализовать один или несколько видов активности CD73, например аденозинмонофосфата (AMP) в аденозин обеспечивать ингибирование или уменьшение ферментативной активности CD73; ингибирование уровня превращения или уменьшение его уровня; увеличение уровня пролиферации Т-клеток, стимулированных антителом к CD3/антителом к CD28, например, Т-клеток CD4+, в присутствии аденозинмонофосфата (AMP); ингибирование пролиферации регуляторных Т-клеток; увеличение уровней ответов эффекторных Т-клеток; и/или ингибирование миграции, инфильтрации или размножения супрессорных клеток миелоидного происхождения. Таким образом, такие молекулы антител можно применять для лечения или предупреждения нарушений, при которых необходимо усиление иммунного ответа у субъекта.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73 (например, каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105, например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), при этом, если молекула антитела содержит первый антигенсвязывающий домен и второй антигенсвязывающий домен, первый антигенсвязывающий домен связывается с первым мономером CD73 и второй антигенсвязывающий домен связывается со вторым мономером CD73, например, при исследовании с применением эксклюзионной хроматографии; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) каждая из молекул антитела во множестве содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, по меньшей мере 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, или 80% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов состоит из одной молекулы антитела и одного димера CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта композиция, содержащая несколько молекул антитела, которые связываются с димером CD73 человека, причем указанный димер состоит из первого мономера CD73 и второго мономера CD73, причем каждый мономер содержит аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например каждый мономер состоит из аминокислотной последовательности под SEQ ID NO: 171), где

(i) если каждая из нескольких молекул антитела содержит один и тот же первый антигенсвязывающий домен и один и тот же второй антигенсвязывающий домен, не более 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, или 70% молекул антитела в указанной композиции связываются с димером CD73 с образованием комплекса, где каждый из указанных комплексов содержит две или более молекулы антитела и два или более димеров CD73, например, при измерении с применением эксклюзионной хроматографии, и процентное значение получают путем определения количества молекул антитела в комплексе по отношению к общему количеству молекул антитела, связывающихся с CD73 (исключая несвязанные молекулы антитела), например, как описано в примере 2; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105; и

(ii) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172, остаткам 206-215 или остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 368-387 из SEQ ID NO: 105 в большей степени, чем по остаткам 158-172 из SEQ ID NO: 105, по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 или по остаткам 297-309 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 368-387 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105. В одном варианте осуществления связывание антитела обеспечивает уменьшение среднего уровня водородно-дейтериевого обмена по остаткам 158-172 из SEQ ID NO: 105 в большей степени, чем по остаткам 206-215 из SEQ ID NO: 105, по остаткам 368-387 из SEQ ID NO: 105 и по остаткам 297-309 из SEQ ID NO: 105.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела обеспечивает уменьшение уровня водородно-дейтериевого обмена в одной или нескольких областях белка, содержащего аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белка, состоящего из аминокислотной последовательности под SEQ ID NO: 171), при его связывании, при этом одна или несколько областей выбраны из группы, состоящей из остатков 158-172, остатков 206-215, остатков 368-387 и остатков 87-104 из SEQ ID NO: 105, при этом область, характеризующаяся наибольшим уменьшением среднего уровня водородно-дейтериевого обмена среди одной или нескольких областей, не представляет собой остатки 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему более чем, например, 0,02, 0,03, 0,04, 0,05 или 0,06 Да на остаток, по остаткам 368-387 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела при связывании с белком, содержащим аминокислотную последовательность из остатков 27-547 из SEQ ID NO: 105 (например, белком, состоящим из аминокислотной последовательности под SEQ ID NO: 171), приводит к снижению среднего уровня водородно-дейтериевого обмена, составляющему менее чем, например, 0,05, 0,04, 0,03 или 0,02 Да на остаток, по остаткам 206-215 из SEQ ID NO: 105, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением масс-спектрометрии водородно-дейтериевого обмена, например, как описано в примере 2, например масс-спектрометрии водородно-дейтериевого обмена, проводимой с обменом в течение 1 минуты при pH 7-8 (например, рН 7,5) и комнатной температуре; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела связывается с по меньшей мере одним, двумя, тремя или четырьмя остатками в пределах остатков 158-172 из SEQ ID NO: 105, и/или с по меньшей мере одним, двумя, тремя, четырьмя или пятью остатками в пределах остатков 206-215 из SEQ ID NO: 105; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 37).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2AMS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 88), где X1 представляет собой R, Y или S, и X2 представляет собой Y или N; аминокислотную последовательность X1IX2GX3GX4X5TYYADSVKG VHCDR2 (SEQ ID NO: 89), где X1 представляет собой A или S, X2 представляет собой S или T, X3 представляет собой S или T, X4 представляет собой M, G или S, и X5 представляет собой N, S, L или Y; и аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37); и

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQSVGSNLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 48); аминокислотную последовательность GASTRAT VLCDR2 (SEQ ID NO: 49); и аминокислотную последовательность QQHNAFPYT VLCDR3 (SEQ ID NO: 50).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50;

(e) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50; или

(f) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50.

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1; и

(ii) молекула антитела содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP определяющей комплементарность области 3 тяжелой цепи (VHCDR3) (SEQ ID NO: 3).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1; и

(ii) молекула антитела содержит:

(а) вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность X1X2YWS определяющей комплементарность области 1 тяжелой цепи (VHCDR1) (SEQ ID NO: 90), где X1 представляет собой R, G или S, и X2 представляет собой Y или R; аминокислотную последовательность YIYX1X2GSTX3YNPSLKS VHCDR2 (SEQ ID NO: 91), где X1 представляет собой G или S, X2 представляет собой R, S или T, и X3 представляет собой N или K; и аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3); и/или

(b) вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность RASQGISSWLA определяющей комплементарность области 1 легкой цепи (VLCDR1) (SEQ ID NO: 14); аминокислотную последовательность AASSLQS VLCDR2 (SEQ ID NO: 15); и аминокислотную последовательность QQGNSFPRT VLCDR3 (SEQ ID NO: 16).

В одном аспекте в данном документе раскрыта молекула антитела, которая связывается с CD73 человека, где

(i) молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1; и

(ii) молекула антитела содержит:

(a) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(b) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16;

(c) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16; или

(d) VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

Пути применения молекул антитела к CD73

Молекулы антител, раскрытые в данном документе, могут модулировать (например, усиливать, стимулировать, увеличивать, ингибировать, уменьшать или нейтрализовать) одну или несколько видов активности CD73. В некоторых вариантах осуществления молекула антитела вызывает одно или несколько из ингибирования или уменьшения ферментативной активности CD73; ингибирования превращения аденозинмонофосфата (AMP) в аденозин или уменьшение его уровня; и увеличения уровня пролиферации Т-клеток, стимулированных посредством антитела к CD3/антитела к CD28, например, Т-клеток CD4+, в присутствии аденозинмонофосфата (AMP).

В некоторых вариантах осуществления молекула антитела ингибирует или уменьшает ферментативную активность CD73 (например, растворимого CD73 человека или мембраносвязанного CD73 человека), например опосредованное CD73 человека превращение аденозинмонофосфата (AMP) в аденозин, что, например, измеряют с помощью способа, описанного в данном документе, например с помощью количественного определения фосфата по реакции с малахитовым зеленым (MG) или модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1.

В некоторых вариантах осуществления молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), например, как описано в примере 1. В одном варианте осуществления молекула антитела ингибирует ферментативную активность мембраносвязанного CD73 человека на по меньшей мере приблизительно 60%, 70%, 80%, или 90%, например, при исследовании молекулы антитела в виде молекулы бивалентного антитела с применением модифицированного анализа Cell Titer Glo (CTG), включающего следующие стадии:

(i) инкубирование титрованной дозы молекулы антитела (например, 1000 нг/мл) с 20000 клеток/мл линии клеток рака человека, экспрессирующих CD73 человека (например, линии клеток рака молочной железы человека MDA-MB-231 или линии клеток рака яичника человека SKOV3) в течение 240 минут при 37°C в присутствии 100 мкМ AMP;

(ii) измерение уровня исчезновения AMP с применением модифицированного анализа Cell Titer Glo (CTG), как описано в примере 1; и

(iii) вычисление процента ингибирования, опосредованного молекулой антитела, с применением контроля в нулевой момент времени в качестве 100% ингибирования и контроля отсутствия антитела в качестве 0% ингибирования.

В некоторых вариантах осуществления молекула антитела увеличивает уровень пролиферации Т-клеток, стимулированных антителом к CD3/антителом к CD28, например Т-клеток CD4+, в присутствии аденозинмонофосфата (AMP), что, например, измеряют с помощью описанного в данном документе способа, например, с помощью анализа пролиферации клеток CellTrace Violet (CTV), например анализа из примера 1.

В определенных аспектах предусмотрен способ модулирования (например, стимулирования или ингибирования) иммунного ответа у субъекта. Способ предусматривает введение субъекту молекулы антитела к CD73, раскрытой в данном документе (например, терапевтически эффективного количества молекулы антитела к CD73), отдельно или в комбинации с одним или несколькими средствами или процедурами (например, в комбинации с видами противоопухолевой терапии, например химиотерапией, лучевой терапией и/или другими иммуномодулирующими средствами) таким образом, чтобы обеспечить модулирование иммунного ответа у субъекта. В некоторых вариантах осуществления молекула антитела ингибирует, уменьшает или нейтрализует иммунный ответ у субъекта.

Субъект может представлять собой млекопитающее, например обезьяну, примата, предпочтительно высшего примата, например человека (например, пациента, имеющего нарушение, описанное в данном документе, или подверженного риску его возникновения). В некоторых вариантах осуществления субъект нуждается в усилении иммунного ответа, а в некоторых вариантах осуществления субъект нуждается в ингибировании иммунного ответа. В одном варианте осуществления субъект имеет нарушение или подвержен риску возникновения нарушения, описанного в данном документе, например рака, как описано в данном документе. В определенных вариантах осуществления субъект страдает иммунной недостаточностью или подвержен риску ее возникновения. Например, субъект подвергается или подвергся лечению с помощью химиотерапии и/или лучевой терапии.

В одном аспекте предусмотрен способ стимулирования иммунного ответа у субъекта. Способ предусматривает введение субъекту молекулы антитела к CD73, описанной в данном документе, например терапевтически эффективного количества молекулы антитела к CD73, отдельно или в комбинации с одним или несколькими средствами или процедурами.

В одном аспекте предусмотрен способ лечения (например, одно или несколько из уменьшения интенсивности, ингибирования или задержки прогрессирования) рака или опухоли у субъекта. Способ предусматривает введение субъекту молекулы антитела к CD73, описанной в данном документе, например терапевтически эффективного количества молекулы антитела к CD73, отдельно или в комбинации с одним или несколькими средствами или процедурами.

В некоторых вариантах осуществления молекулу антитела вводят в комбинации со вторым терапевтическим средством или процедурой. В некоторых вариантах осуществления второе терапевтическое средство или процедура выбраны из одного или нескольких из химиотерапии, таргетной противораковой терапии, онколитического лекарственного средства, цитотоксического средства, средства иммунотерапии, цитокина, хирургической процедуры, процедуры обработки облучением, активатора костимулирующей молекулы, ингибитора ингибиторной молекулы (например, ингибитора ингибитора контрольной точки), вакцины или средства клеточной терапии. В некоторых вариантах осуществления второе терапевтическое средство выбрано из одного или нескольких из 1) ингибитора протеинкиназы С (РКС); 2) ингибитора белка теплового шока 90 (HSP90); 3) ингибитора фосфоинозитид-3-киназы (PI3K) и/или мишени рапамицина (mTOR); 4) ингибитора цитохрома P450 (например, ингибитора CYP17 или ингибитора 17-альфа-гидроксилазы/C17-20-лиазы); 5) железохелатирующего средства; 6) ингибитора ароматазы; 7) ингибитора р53, например ингибитора взаимодействия р53/Mdm2; 8) индуктора апоптоза; 9) ингибитора ангиогенеза; 10) ингибитора альдостеронсинтазы; 11) ингибитора рецептора "smoothened" (SMO); 12) ингибитора рецептора пролактина (PRLR); 13) ингибитора передачи сигналов Wnt; 14) ингибитора CDK4/6; 15) ингибитора рецептора 2 фактора роста фибробластов (FGFR2)/рецептора 4 фактора роста фибробластов (FGFR4); 16) ингибитора макрофагального колониестимулирующего фактора (M-CSF); 17) ингибитора одного или нескольких из c-KIT, высвобождения гистамина, Flt3 (например, FLK2/STK1) или PKC; 18) ингибитора одного или нескольких из VEGFR-2 (например, FLK-1/KDR), PDGFR-бета, c-KIT или Raf-киназы C; 19) агониста соматостатина и/или ингибитора высвобождения гормона роста; 20) ингибитора киназы анапластической лимфомы (ALK); 21) ингибитора рецептора инсулиноподобного фактора роста 1 (IGF-1R); 22) ингибитора P-гликопротеина 1; 23) ингибитора рецептора фактора роста эндотелия сосудов (VEGFR); 24) ингибитора киназы BCR-ABL; 25) ингибитора FGFR; 26) ингибитора CYP11B2; 27) ингибитора HDM2, например ингибитора взаимодействия HDM2-p53; 28) ингибитора тирозинкиназы; 29) ингибитора c-MET; 30) ингибитора JAK; 31) ингибитора DAC; 32) ингибитора 11β-гидроксилазы; 33) ингибитора IAP; 34) ингибитора PIM-киназы; 35) ингибитора поркупина; 36) ингибитора BRAF, например BRAF V600E или BRAF дикого типа; 37) ингибитора HER3; 38) ингибитора MEK; или 39) ингибитора липидкиназы.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором PD-1. В некоторых вариантах осуществления ингибитор PD-1 выбран из группы, состоящей из PDR001, ниволумаба, пембролизумаба, пидилизумаба, MEDI0680, REGN2810, TSR-042, PF-06801591 и AMP-224. В некоторых вариантах осуществления ингибитор PD-1 представляет собой молекулу антитела к PD-1. В некоторых вариантах осуществления молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 250 мг до 350 мг, от приблизительно 350 мг до 450 мг или от приблизительно 450 мг до 550 мг, например в дозе приблизительно 300 мг или приблизительно 400 мг, например раз в три недели (Q3W) или раз в четыре недели (Q4W), например в дозе приблизительно 300 мг Q3W или в дозе приблизительно 400 мг Q4W. В одном варианте осуществления молекулу антитела к PD-1 вводят, например путем инфузии в течение периода времени 30 минут или периода времени не более 2 часов. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, от приблизительно 100 мг до 500 мг, от приблизительно 500 мг до 1000 мг, от приблизительно 1000 мг до 1500 мг, от приблизительно 1500 мг до 2000 мг, от приблизительно 2000 мг до 2500 мг, от приблизительно 2500 мг до 3000 мг, от приблизительно 3000 мг до 3500 мг или от приблизительно 3500 мг до 4000 мг, например в дозе приблизительно 6 мг, приблизительно 20 мг, приблизительно 60 мг, приблизительно 200 мг, приблизительно 600 мг, приблизительно 1200 мг, приблизительно 2400 мг, приблизительно 3000 мг или приблизительно 3600 мг, например раз в неделю (QW), раз в две недели (Q2W) или раз в четыре недели (Q4W), например Q2W. В одном варианте осуществления молекулу антитела к CD73 вводят, например путем инфузии, в течение периода времени 30 минут, периода времени 1 час или периода времени не более 2 часов. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3000 мг до 3500 мг, например 3000 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3500 мг до 4000 мг, например 3600 мг, Q2W, и молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором PD-L1. В некоторых вариантах осуществления ингибитор PD-L1 выбран из группы, состоящей из FAZ053, атезолизумаба, авелумаба, дурвалумаба и BMS-936559.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором CTLA-4. В некоторых вариантах осуществления ингибитор CTLA-4 представляет собой ипилимумаб или тремелимумаб.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором TIM-3. В некоторых вариантах осуществления ингибитор TIM-3 выбран из MGB453, TSR-022 или LY3321367.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором LAG-3. В некоторых вариантах осуществления ингибитор LAG-3 выбран из группы, состоящей из LAG525, BMS-986016, TSR-033, MK-4280 и REGN3767.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с агонистом GITR. В некоторых вариантах осуществления агонист GITR выбран из группы, состоящей из GWN323 (Novartis), BMS-986156 (BMS), MK-4166 или MK-1248 (Merck), TRX518 (Leap Therapeutics), INCAGN1876 (Incyte/Agenus), AMG 228 (Amgen) и INBRX-110 (Inhibrx).

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с молекулой полиспецифического антитела к CD3. В некоторых вариантах осуществления молекула полиспецифического антитела к CD3 представляет собой молекулу биспецифического антитела к CD3 x к CD123 (например, XENP14045) или молекулу биспецифического антитела к CD3 x к CD20 (например, XENP13676).

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с молекулой цитокина. В некоторых вариантах осуществления молекула цитокина представляет собой IL-15, образующий комплекс с растворимой формой альфа-рецептора IL-15 (IL-15Ra).

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с агонистом STING.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором макрофагального колониестимулирующего фактора (M-CSF), при этом необязательно ингибитор M-CSF представляет собой MCS110.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором CSF-1R, при этом необязательно ингибитор CSF-1R представляет собой BLZ945.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором индоламин-2,3-диоксигеназы (IDO) и/или триптофан-2,3-диоксигеназы (TDO).

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором TGF-β.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с антагонистом аденозинового рецептора A2AR. В некоторых вариантах антагонист аденозинового рецептора A2AR выбран из группы, состоящей из PBF509, CPI444, AZD4635, випадента, GBV-2034 и AB928. В некоторых вариантах осуществления антагонист аденозинового рецептора A2AR выбран из группы, состоящей из 5-бром-2,6-ди-(1H-пиразол-1-ил)пиримидин-4-амина; (S)-7-(5-метилфуран-2-ил)-3-((6-(((тетрагидрофуран-3-ил)окси)метил)пиридин-2-ил)метил)-3Н-[1,2,3]триазоло[4,5-d]пиримидин-5-амина; (R)-7-(5-метилфуран-2-ил)-3-((6-(((тетрагидрофуран-3-ил)окси)метил)пиридин-2-ил)метил)-3Н-[1,2,3]триазоло[4,5-d]пиримидин-5-амина или его рацемата; 7-(5-метилфуран-2-ил)-3-((6-(((тетрагидрофуран-3-ил)окси)метил)пиридин-2-ил)метил)-3Н-[1,2,3]триазоло[4,5-d]пиримидин-5-амина и 6-(2-хлор-6-метилпиридин-4-ил)-5-(4-фторфенил)-1,2,4-триазин-3-амина. В некоторых вариантах осуществления антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, от приблизительно 60 мг до 100 мг, от приблизительно 100 мг до 140 мг, от приблизительно 140 мг до 180 мг, от приблизительно 180 мг до 220 мг, от приблизительно 220 мг до 260 мг, от приблизительно 260 мг до 300 мг, от приблизительно 300 мг до 340 мг, от приблизительно 340 мг до 380 мг, от приблизительно 380 мг до 480 мг, от приблизительно 480 мг до 580 мг или от приблизительно 580 мг до 680 мг, например в дозе приблизительно 40 мг, приблизительно 80 мг, приблизительно 160 мг, приблизительно 320 мг, приблизительно 480 мг или приблизительно 620 мг, например один раз в сутки (QD), два раза в сутки (BID) или три раза в сутки (TID), например BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, от приблизительно 100 мг до 500 мг, от приблизительно 500 мг до 1000 мг, от приблизительно 1000 мг до 1500 мг, от приблизительно 1500 мг до 2000 мг, от приблизительно 2000 мг до 2500 мг, от приблизительно 2500 мг до 3000 мг, от приблизительно 3000 мг до 3500 мг или от приблизительно 3500 мг до 4000 мг, например в дозе приблизительно 6 мг, приблизительно 20 мг, приблизительно 60 мг, приблизительно 200 мг, приблизительно 600 мг, приблизительно 1200 мг, приблизительно 2400 мг, приблизительно 3000 мг или приблизительно 3600 мг, например раз в неделю (QW), раз в две недели (Q2W) или раз в четыре недели (Q4W), например Q2W. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например, 60 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например, 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например, 1200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 480 мг до 580 мг, например 480 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 580 мг до 680 мг, например 620 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3000 мг до 3500 мг, например 3000 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3000 мг до 3500 мг, например 3000 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 480 мг до 580 мг, например 480 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3000 мг до 3500 мг, например 3000 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 580 мг до 680 мг, например 620 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3500 мг до 4000 мг, например 3600 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3500 мг до 4000 мг, например 3600 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 480 мг до 580 мг, например 480 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3500 мг до 4000 мг, например 3600 мг, Q2W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 580 мг до 680 мг, например 620 мг, BID.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором PD-1 и антагонистом аденозинового рецептора A2AR. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, от приблизительно 100 мг до 500 мг, от приблизительно 500 мг до 1000 мг, от приблизительно 1000 мг до 1500 мг, от приблизительно 1500 мг до 2000 мг, от приблизительно 2000 мг до 2500 мг, от приблизительно 2500 мг до 3000 мг, от приблизительно 3000 мг до 3500 мг или от приблизительно 3500 мг до 4000 мг, например в дозе приблизительно 6 мг, приблизительно 20 мг, приблизительно 60 мг, приблизительно 200 мг, приблизительно 600 мг, приблизительно 1200 мг, приблизительно 2400 мг, приблизительно 3000 мг или приблизительно 3600 мг, например раз в неделю (QW), раз в две недели (Q2W) или раз в четыре недели (Q4W), например Q2W. В некоторых вариантах осуществления ингибитор PD-1 представляет собой молекулу антитела к PD-1. В некоторых вариантах осуществления молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 250 мг до 350 мг, от приблизительно 350 мг до 450 мг или от приблизительно 450 мг до 550 мг, например в дозе приблизительно 300 мг или приблизительно 400 мг, например раз в три недели (Q3W) или раз в четыре недели (Q4W), например в дозе приблизительно 300 мг Q3W или в дозе приблизительно 400 мг Q4W. В некоторых вариантах осуществления антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, от приблизительно 60 мг до 100 мг, от приблизительно 100 мг до 140 мг, от приблизительно 140 мг до 180 мг, приблизительно 180 мг до 220 мг, от приблизительно 220 мг до 260 мг, от приблизительно 260 мг до 300 мг, от приблизительно 300 мг до 340 мг, от приблизительно 340 мг до 380 мг, от приблизительно 380 мг до 480 мг, от приблизительно 480 мг до 580 мг или от приблизительно 580 мг до 680 мг, например в дозе приблизительно 40 мг, приблизительно 80 мг, приблизительно 160 мг, приблизительно 320 мг, приблизительно 480 мг или приблизительно 620 мг, например один раз в сутки (QD), два раза в сутки (BID) или три раза в сутки (TID), например BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 20 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, например 60 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 100 мг до 500 мг, например 200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например, 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например, 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 500 мг до 1000 мг, например 600 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 1000 мг до 1500 мг, например 1200 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 20 мг до 60 мг, например 40 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 60 мг до 100 мг, например 80 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 140 мг до 180 мг, например 160 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 480 мг до 580 мг, например 480 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 2000 мг до 2500 мг, например 2400 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 580 мг до 680 мг, например 620 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3000 мг до 3500 мг, например 3000 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3000 мг до 3500 мг, например 3000 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 480 мг до 580 мг, например 480 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3000 мг до 3500 мг, например 3000 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 580 мг до 680 мг, например 620 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3500 мг до 4000 мг, например 3600 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 300 мг до 340 мг, например 320 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3500 мг до 4000 мг, например 3600 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 480 мг до 580 мг, например 480 мг, BID. В некоторых вариантах осуществления молекулу антитела к CD73 вводят, например внутривенно, в дозе от приблизительно 3500 мг до 4000 мг, например 3600 мг, Q2W, молекулу антитела к PD-1 вводят, например внутривенно, в дозе от приблизительно 350 мг до 450 мг, например 400 мг, Q4W, и антагонист аденозинового рецептора A2AR вводят, например перорально, в дозе от приблизительно 580 мг до 680 мг, например 620 мг, BID.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с ингибитором PD-L1 и антагонистом аденозинового рецептора A2AR.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с средством терапии на основе Т-клеток с химерным антигенным рецептором (CAR). В некоторых вариантах осуществления средство терапии на основе Т-клеток с CAR представляет собой CTL019.

В некоторых вариантах осуществления молекулу антитела к CD73 вводят в комбинации с одним или несколькими средствами, описанными в таблице 18, например, одним или несколькими из 1) ингибитора протеинкиназы С (РКС); 2) ингибитора белка теплового шока 90 (HSP90); 3) ингибитора фосфоинозитид-3-киназы (PI3K) и/или мишени рапамицина (mTOR); 4) ингибитора цитохрома P450 (например, ингибитора CYP17 или ингибитора 17-альфа-гидроксилазы/C17-20-лиазы); 5) железохелатирующего средства; 6) ингибитора ароматазы; 7) ингибитора р53, например ингибитора взаимодействия р53/Mdm2; 8) индуктора апоптоза; 9) ингибитора ангиогенеза; 10) ингибитора альдостеронсинтазы; 11) ингибитора рецептора "smoothened" (SMO); 12) ингибитора рецептора пролактина (PRLR); 13) ингибитора передачи сигналов Wnt; 14) ингибитора CDK4/6; 15) ингибитора рецептора 2 фактора роста фибробластов (FGFR2)/рецептора 4 фактора роста фибробластов (FGFR4); 16) ингибитора макрофагального колониестимулирующего фактора (M-CSF); 17) ингибитора одного или нескольких из c-KIT, высвобождения гистамина, Flt3 (например, FLK2/STK1) или PKC; 18) ингибитора одного или нескольких из VEGFR-2 (например, FLK-1/KDR), PDGFR-бета, c-KIT или Raf-киназы C; 19) агониста соматостатина и/или ингибитора высвобождения гормона роста; 20) ингибитора киназы анапластической лимфомы (ALK); 21) ингибитора рецептора инсулиноподобного фактора роста 1 (IGF-1R); 22) ингибитора P-гликопротеина 1; 23) ингибитора рецептора фактора роста эндотелия сосудов (VEGFR); 24) ингибитора киназы BCR-ABL; 25) ингибитора FGFR; 26) ингибитора CYP11B2; 27) ингибитора HDM2, например ингибитора взаимодействия HDM2-p53; 28) ингибитора тирозинкиназы; 29) ингибитора c-MET; 30) ингибитора JAK; 31) ингибитора DAC; 32) ингибитора 11β-гидроксилазы; 33) ингибитора IAP; 34) ингибитора PIM-киназы; 35) ингибитора поркупина; 36) ингибитора BRAF, например BRAF V600E или BRAF дикого типа; 37) ингибитора HER3; 38) ингибитора MEK; или 39) ингибитора липидкиназы, описанных в данном документе и в таблице 18.

В определенных вариантах осуществления рак, подвергаемый лечению посредством молекулы антитела к CD73 отдельно или в комбинации со вторым терапевтическим средством или процедурой, включает без ограничения солидную опухоль, гематологический рак (например, лейкоз, лимфому, миелому, например множественную миелому) и метастатическое поражение. В некоторых вариантах осуществления рак выбран из рака легкого (например, немелкоклеточного рака легкого), рака поджелудочной железы (например, аденокарциномы протоков поджелудочной железы), рака молочной железы (например, трижды негативного рака молочной железы), меланомы, рака головы и шеи (например, плоскоклеточного рака головы и шеи), колоректального рака (например, колоректального рака с микросателлитной стабильностью (MSS)), рака яичника или рака почки (например, почечно-клеточной карциномы). В определенных вариантах осуществления молекула антитела к CD73, используемая отдельно или в комбинации со вторым терапевтическим средством или процедурой, контролирует рост опухоли, уменьшает уровень метастазирования и/или улучшает выживаемость.

В определенных вариантах осуществления молекулу антитела вводят в дозе от приблизительно 100 мг до 1600 мг, от приблизительно 100 мг до 1400 мг, от приблизительно 100 мг до 1200 мг, от приблизительно 100 мг до 1000 мг, от приблизительно 100 мг до 800 мг, от приблизительно 100 мг до 600 мг, от приблизительно 100 мг до 400 мг, от приблизительно 100 мг до 200 мг или приблизительно 100 мг, приблизительно 180 мг или приблизительно 200 мг, например раз в две недели. В одном варианте осуществления молекулу антитела вводят в дозе по меньшей мере приблизительно 180 мг раз в две недели.

В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе от приблизительно 5 мг до 100 мг, от приблизительно 100 мг до 500 мг, от приблизительно 500 мг до 1000 мг, от приблизительно 1000 мг до 1500 мг, от приблизительно 1500 мг до 2000 мг, от приблизительно 2000 мг до 2500 мг, от приблизительно 2500 мг до 3000 мг, от приблизительно 3000 мг до 3500 мг или от приблизительно 3500 мг до 4000 мг, например раз в неделю (QW), раз в две недели (Q2W) или раз в четыре недели (Q4W). В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 6 мг, приблизительно 20 мг, приблизительно 60 мг, приблизительно 200 мг, приблизительно 600 мг, приблизительно 1200 мг, приблизительно 2400 мг, приблизительно 3000 мг или приблизительно 3600 мг, например QW, Q2W или Q4W. В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 60 мг Q2W. В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 200 мг Q2W. В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 600 мг Q2W. В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 1200 мг Q2W. В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 2400 мг Q2W. В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 3000 мг Q2W. В определенных вариантах осуществления молекулу антитела вводят, например внутривенно, в дозе приблизительно 3600 мг Q2W.

Кроме того, в настоящем изобретении предусмотрены способы усиления иммунного ответа на антиген у субъекта, предусматривающие введение субъекту (i) антигена; и (ii) молекулы антитела к CD73, раскрытой в данном документе, таким образом, что иммунный ответ на антиген у субъекта усиливается. Антигеном может быть, например, опухолевый антиген, вирусный антиген, бактериальный антиген или антиген из патогена.

Молекулу антитела к CD73 можно вводить субъекту системно (например, перорально, парентерально, подкожно, внутривенно, ректально, внутримышечно, внутрибрюшинно, интраназально, трансдермально или посредством ингаляции или внутриполостной установки) или локально. В одном варианте осуществления молекулу антитела к CD73 вводят внутривенно.

Молекулу антитела к CD73 можно применять отдельно в неконъюгированной форме, или она может быть связана с веществом, например цитотоксическим средством или фрагментом (например, терапевтическим лекарственным средством; соединением, излучающим радиацию; молекулами растительного, грибкового или бактериального происхождения или биологическим белком (например, белковым токсином) или частицей (например, рекомбинантной вирусной частицей, например посредством белка оболочки вируса). Например, антитело к CD73 может быть связано с радиоактивным изотопом, таким как α-, β- или γ-излучатель, или β- и γ-излучатель.

Дозировки и терапевтические схемы приема молекулы антитела к CD73 могут быть определены специалистом в данной области техники.

В другом аспекте предусмотрен способ обнаружения CD73 в биологическом образце или у субъекта. В одном варианте осуществления способ предусматривает (i) приведение образца или субъекта (и необязательно эталонного образца или субъекта) в контакт с молекулой антитела по любому из пп. 1-57 в условиях, которые обеспечивают взаимодействие молекулы антитела и CD73, и (ii) обнаружение образования комплекса между молекулой антитела и образцом или субъектом (и необязательно эталонным образцом или субъектом).

Молекулы антител, описанные в данном документе, являются предпочтительными для применения в способах, описанных в данном документе, хотя можно применять другие антитела к CD73 вместо или в комбинации с молекулой антитела к CD73 по настоящему изобретению.

КРАТКОЕ ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ

На фиг. 1 представлен график, отображающий уровень связывания антител к CD73 или антитела изотипического контроля с Т-клетками CD8+, измеренный с помощью проточной цитометрии. Значения MFI нанесены на график в виде зависимости от концентрации антител. Исследуемые антитела представляют собой антитела к CD73 350, 356, 358, 373, 374, 377 и 379, а также антитело изотипического контроля, все экспрессируемые в формате.B.

На фиг. 2А и 2В представлены графики, показывающие результаты количественного определения неорганического фосфата по реакции с малахитовым зеленым, в котором исследуют способность антитела к CD73 ингибировать опосредованное CD73 превращение аденозинмонофосфата (AMP) в аденозин. Скорость высвобождения неорганического фосфата (Pi) нанесена на график в виде зависимости от исследуемых концентраций AMP. На фиг. 2A рекомбинантный CD73 человека инкубировали с AMP, представляющим собой субстрат, только с буфером ("Km hCD73") или в присутствии антитела изотипического контроля IgG1 ("ISO.C"). На фиг. 2B, рекомбинантный CD73 инкубировали с AMP только с буфером ("Km hCD73") или в присутствии антитела к CD73 350.C в указанных концентрациях ("1 мкг/мл 350.C", "0,3 мкг/мл 350.С" или "0,1 мкг/мл 350.С").

На фиг. 3A, 3B и 3C представлены графики, показывающие результаты количественного определения фосфата по реакции с малахитовым зеленым (MG), в котором определяют способность антитела к CD73 ингибировать ферментативную активность рекомбинантного растворимого CD73 человека или макака-крабоеда. % INH образования фосфата наносят на график в виде зависимости от концентраций антител к CD73 для исследований с применением рекомбинантного CD73 человека (фиг. 3A и 3B) или CD73 макака-крабоеда (фиг. 3C). Исследуемые антитела представляют собой антитела к CD73 350, 356, 373 и 374, экспрессируемые в формате.A или.B.

На фиг. 4 представлен график, показывающий результаты модифицированного анализа Cell Titer Glo (CTG), в котором исследуют активность ингибирования ферментов антител к CD73 в отношении CD73, выделенного из линии клеток рака молочной железы MDA-MB-231. % INH нанесен на график в виде зависимости от значений диапазона концентраций антитела к CD73. Исследуемые антитела представляют собой антитела к CD73 350 и 373, экспрессируемые либо в формате.A, либо.B, антитело изотипического контроля, представляющее собой IgG4 S228P ("ISO.A"), и антитело изотипического контроля, представляющее собой IgG4 S228P/L235E- ("ISO.B").

На фиг. 5 представлен график, показывающий результаты модифицированного анализа Cell Titer Glo (CTG), в котором исследуют способность антител к CD73 ингибировать ферментативную активность CD73 в сыворотке от пациента с раком поджелудочной железы. % INH превращения AMP нанесено на график в виде зависимости от концентраций антитела к CD73. Исследуемые антитела к CD73 представляют собой антитела 350, 356, 358, 373, 374, 377 и 379, все экспрессируемые в формате.B.

На фиг.6 представлен график, показывающий уровень ингибирования CD73, экспрессируемого на поверхности линии клеток рака молочной железы MDA-MB-231, измеренное с применением количественного определения фосфата по реакции с малахитовым зеленым. % INH превращения AMH нанесен на график в виде зависимости по диапазону концентраций антитела к CD73. Исследуемые антитела к CD73 представляют собой антитела 350, 356, 358, 373, 374, 377 и 379, все в формате.B.

Фиг. 7А, 7В, 7С и 7D представляют собой гистограммы, на которых показаны результаты модифицированного анализа Cell Titer Glo (CTG), в котором исследуют способность антител к CD73 ингибировать ферментативную активность CD73, экспрессируемого на поверхности линии клеток рака молочной железы человека MDA-MB-231 (фиг. 7A и 7C) или линии клеток рака молочной железы мыши 4T1 (фиг. 7B и 7D). По оси Y показан процент ингибирования относительно контроля без антител (полное превращение) и контроля в нулевой момент времени (без превращения). Для каждого антитела столбики слева направо представляют дозы 10, 3, 1 и 0,3 мкг/мл. Исследуемые антитела представляют собой антитела 918, 350, 356 и 358 линии 1 (фиг. 7A и 7B) и антитела 930, 373, 374, 376, 377, и 379 линии 3 (фиг. 7C и 7D).

Фиг. 8A и 8B представляют собой графики, на которых показана активность ингибирования фермента антител к CD73 в отношении поверхностного CD73, экспрессируемого на линии клеток рака молочной железы человека MDA-MB-231 или на линии клеток рака яичника человека SKOV3, измеренная с помощью модифицированного анализа Cell Titer Glo (CTG). % INH нанесен на график в виде зависимости от значений диапазона концентраций антитела к CD73. Исследуемые антитела к CD73 представляют собой антитела 350 и 373, экспрессируемые в формате.A или .B.

Фиг. 9А и 9В представляют собой графики, аналогичные таковым на фиг. 8A и 8B. Исследуемые антитела представляют собой антитела к CD73 350, 356, 373 и 374 в формате.A или .B.

Фиг. 10 представляет собой график, на котором показан уровень ингибирования CD73 человека, сверхэкспрессируемого на клетках HEK 293, антителами к CD73, измеренный с помощью модифицированного анализа Cell Titer Glo (CTG). % INH превращения AMH нанесен на график в виде зависимости от значений диапазона концентраций антитела к CD73. Исследуемые антитела представляют собой антитела к CD73 350, 356, 373 и 374 в формате.A или .B.

Фиг. 11A и 11B представляют собой графики, на которых показан уровень ингибирования CD73, экспрессируемого на первичных PBMC человека, выделенных от двух отдельных доноров, посредством антител к CD73, измеренный с помощью модифицированного анализа Cell Titer Glo (CTG). % INH нанесен на график в виде зависимости от значений диапазона концентраций антитела к CD73. Исследуемые антитела к CD73 представляют собой антитела 350, 356 и 358, все в формате.B.

Фиг. 12А и 12В представляют собой графики, на которых показан уровень пролиферации Т-клеток CD4+, стимулированных антителом к CD3/28, в присутствии AMP и антитела к CD73. Индекс пролиферации, мера деления Т-клеток, нанесен на график в виде зависимости от значений диапазона концентраций антител. На фиг. 12А показаны результаты исследования, в котором исследуют антитела к CD73 350, 356, 358, 374, 377 и 379, все в формате.B. На фиг. 12B показаны результаты исследования с применением антител 350 и 372, экспрессируемые в формате.A или .B.

Фиг. 13 представляет собой гистограмму, на которой показаны результаты исследования ксенотрансплантата, в котором исследуют способность антитела к CD73 ингибировать ферментативную активность CD73 in vivo. По оси Y показаны уровни аденозина и инозина в сыворотке крови мышей с иммунной недостаточностью, которым имплантировали линию клеток рака молочной железы с высоким уровнем экспрессии CD73 (MDA-MB-231), измеренные с помощью масс-спектрометрии. Антитела к CD73 350, 356, 373 и 374, экспрессируемые в формате.A или .B, вводили внутрибрюшинно в дозе 20 или 200 мкг/мышь. Контрольное антитело, представляющее собой поликлональный IgG человека, вводили в дозе 200 мкг/мышь.

Фиг. 14 представляет собой график, на котором показано сравнение профилей защиты 373.A и 373.B, измеренных с помощью масс-спектрометрии водородно-дейтериевого обмена с фрагментацией (HDx-MS). На фиг. 14 показаны результаты для обмена в течение 1 минуты при рН 7,5 и комнатной температуре.

Фиг. 15 представляет собой график, на котором показано сравнение профилей защиты 350.A2 и 350.B, измеренных с помощью масс-спектрометрии водородно-дейтериевого обмена с фрагментацией (HDx-MS). На фиг. 15 показаны результаты для обмена в течение 1 минуты при рН 7,5 и комнатной температуре.

Фиг. 16A представляет собой графическое изображение, показывающее конформационное изменение CD73 между закрытой/активной (база данных структуры белков (PDB) 4H2I) и открытой/неактивной конформацией (PDB 4H2F). Фиг. 16B представляет собой графическое изображение, показывающее открытую/открытую конформацию димера CD73, сконструированного из двух единиц PDB 4H2F после выравнивания С-концевых доменов с PDB 4H1S.

Фиг. 17A и 17B представляют собой графики, на которых показаны SEC-профили комплексов CD73-373.A и CD73-373.B, соответственно.

Фиг. 18A и 18B представляют собой графики, на которых показаны SEC-профили комплексов CD73-350.A2 и CD73-350.B, соответственно.

Фиг. 19 представляет собой график, на котором показаны значения относительного процентного содержания видов CD73/mAb, рассчитанные с применением способа интегрирования.

Фиг. 20 представляет собой схематическое графическое изображение, показывающее модель олигомеризации для объединения интерпретаций HDx и SEC.

Фиг. 21A и 21B представляют собой графики, на которых показан уровень экспрессии CD73 в подмножествах стромальных клеток, проанализированных с помощью проточной цитометрии в опухолях 4T1 от мышей, обработанных пан-антителом к TGFβ или hIgG2 изотипического контроля. На фиг. 21А экспрессия CD73 отображена в виде интенсивности флуоресценции по сравнению с образцами, окрашенными с помощью соответствующих изотипических контролей. Показан один репрезентативный образец. На фиг. 21B показана количественная оценка уровня экспрессии CD73, измеренного в виде средней интенсивности флуоресценции. Каждый символ представляет образец. P-значения указаны там, где они значимы. CAF=фибробласты, ассоциированные с раком.

Фиг. 22A, 22B и 22C представляют собой графики, на которых показаны результаты анализа, в котором оценивали влияние антитела к CD73 на рекомбинацию в В-клетках, обуславливающую переключение класса иммуноглобулинов. Интактные (CD19+CD27-IgM+IgD+) B-клетки CD73+ и CD73- выделяли из периферической крови здоровых доноров, метили с помощью CFSE и стимулировали in vitro с помощью CpG 2006, антитела к CD40, IL-2, IL-21 и транферрина. Клетки культивировали в присутствии антитела к CD73 350.B или антитела изотипического контроля (IgG4) в трех разных концентрациях: 1, 10 и 100 нг/мл. На фиг. 22А измеряли секрецию IgM в 7-дневном супернатанте клеточной культуры с применением анализа ELISA. На фиг. 22B, уровень пролиферации В-клеток измеряли на день 7, и количества поделившихся клеток, подсчитанные после осуществления электронного гейтирования разбавленной популяции CFSE, нанесены на график для трех различных исследуемых концентраций. На фиг. 22C клетки, секретирующие IgG (IgG SC) подсчитывали с помощью анализа ELISPOT в тот же момент времени. Данные собрали из двух независимых экспериментов.

Фиг. 23 представляет собой панель графиков, на которых показаны объемы отдельных опухолей для указанных групп. Мышей с изотипическим контролем умерщвляли на день 25. В группе, обработанной антителом к PD-1, мыши получали 300 мкг/мышь для всех доз. В группе, обработанной с помощью 350.В, мыши получали 600 мкг/мышь для первой дозы, а затем 400 мкг/мышь для четырех оставшихся доз. Те же схемы дозирования применялись для комбинированной группы. Всех мышей обрабатывали в дни 2, 5, 9, 12 и 17.

Фиг. 24A представляет собой пару графиков, на которых показано обнаружение биотинилированного 373.A на образцах крови от двух доноров, предварительно обработанных с помощью немеченых 373.A. FIG. 24B представляет собой график, на котором показано процентное значение занятости мишени на T-клетках CD8+ антителом 373.A.

Фиг. 25A и 25B представляет собой панель графиков, на которых показано, что пролиферация T-клеток CD4+ и CD8+ подавлялась с помощью AMP во время TCR-опосредованной активации, и это подавление можно было отменить с помощью антитела 373.A.

На фиг. 26A и 26B показаны остатки CD73 (жирный, курсив и подчеркнуто одной линией), которые взаимодействуют с тяжелой цепью Fab 350.A2 посредством прямых энтальпийных взаимодействий (Y110, L132, K136, S155, L157 и K162, пронумерованные в соответствии с SEQ ID NO: 105) (фиг. 26A) или вандерваальсовых и гидрофобных взаимодействий (остатки 136-138 и 155-170, пронумерованные в соответствии с SEQ ID NO: 105) (фиг. 26B), измеренных в примере 8. На фиг. 26C и 26D показаны остатки тяжелой цепи Fab 350.A2 (жирный, курсив и подчеркнуто одной линией), которые взаимодействуют с CD73 посредством прямых энтальпийных взаимодействий (R31, R54, E95, E98 и S99, пронумерованные в соответствии с Kabat, или R31, R54, E98, E101 и S102, пронумерованные в соответствии с их линейными положениями в SEQ ID NO: 331) (фиг. 26C) или вандерваальсовых и гидрофобных взаимодействий (остатки 30, 31, 33, 50, 52, 56, 97, 98, 100, и 100a, пронумерованной в соответствии с нумерацией по Kabat, или остатки 30, 31, 33, 50, 52, 56, 100, 101, 103, и 104, пронумерованные в соответствии с их линейными положениями в SEQ ID NO: 331) (фиг. 26D), измеренных в примере 8. На фиг. 26E и 26F показаны остатки CD73 (жирный, курсив и подчеркнуто одной линией), которые взаимодействуют с легкой цепью Fab 350.A2 посредством прямых энтальпийных взаимодействий (T209, пронумерованный в соответствии с SEQ ID NO: 105) (фиг. 26E) или вандерваальсовых и гидрофобных взаимодействий (остатки 209 и 210, пронумерованные в соответствии с SEQ ID NO: 105) (фиг. 26F), измеренных в примере 8. На фиг. 26G и 26H показаны остатки легкой цепи Fab 350.A2 (жирный, курсив и подчеркнуто одной линией), которые взаимодействуют с CD73 посредством прямых энтальпийных взаимодействий (W32, пронумерованная в соответствии с нумерацией по Kabat их линейными положениями в SEQ ID NO: 23) (фиг. 26G) или вандерваальсовых и гидрофобных взаимодействий (остатки 30 и 32, пронумерованные в соответствии с нумерацией по Kabat или их линейными положениями в SEQ ID NO: 23) (фиг. 26H), измеренных в примере 8. Сигнальный пептид подчеркнут двойной линией на фиг. 26A, 26B, 26E и 26F.

Фиг. 27А и 27В представляют собой графики, на которых показано отличие между уровнями мечения, наблюдаемыми для комплексов CD73/mAb и отдельно CD73 после импульса мечения 30 с.

Фиг. 28А и 28В представляют собой графики, на которых показано отличие между уровнями мечения, наблюдаемыми для комплексов CD73/mAb и отдельно CD73 после импульса мечения 300 с.

КРАТКОЕ ОПИСАНИЕ ТАБЛИЦ

В таблице 1 представлены аминокислотные и нуклеотидные последовательности для иллюстративных антител к CD73.

В таблице 2 представлены консенсусные последовательности CDR для иллюстративных антител к CD73.

В таблице 3 представлены аминокислотные последовательности тяжелых цепей IgG человека и легкой каппа-цепи человека.

В таблице 4 представлены иллюстративные последовательности CD73.

В таблицах 5 и 6 представлены аминокислотные и/или нуклеотидные последовательности иллюстративных молекул антитела к PD-1.

В таблицах 7 и 8 представлены аминокислотные и/или нуклеотидные последовательности иллюстративных молекул антитела к PD-L1.

В таблицах 9 и 10 представлены аминокислотные и/или нуклеотидные последовательности иллюстративных молекул антитела к LAG-3.

В таблицах 11 и 12 представлены аминокислотные и/или нуклеотидные последовательности иллюстративных молекул антитела к TIM-3.

В таблицах 13 и 14 представлены аминокислотные и/или нуклеотидные последовательности иллюстративных молекул антитела к GITR.

В таблице 15 представлены аминокислотные последовательности иллюстративных молекул биспецифического антитела к CD3.

В таблицах 16 и 17 представлены аминокислотные последовательности иллюстративных комплексов IL15/IL-15Ra.

Таблица 18 представляет собой краткое описание выбранных терапевтических средств, которые можно вводить в комбинации с молекулами антитела к CD73, описанными в данном документе. В таблице 18 слева направо представлено следующее: обозначение соединения второго терапевтического средства, структура соединения и публикация патента(-ов), в котором(-ых) раскрыто указанное соединение.

В таблице 19 представлены обозначения для двух линий антител к CD73.

В таблице 20 представлены значения аффинности связывания для антител к CD73.

В таблице 21 представлены значения аффинности связывания для Fab антител к CD73.

В таблице 22 представлены предварительные уровни доз для 373.A.

В таблице 23 представлены предварительные уровни доз для 373.A в комбинации с PBF509.

В таблице 24 представлены предварительные уровни доз для 373.A в комбинации с BAP049-клон-E.

В таблице 25 представлены предварительные уровни доз PBF509 в комбинации с 373.A и BAP049-клон-E.

В таблице 26 представлены соответствующие последовательности зародышевого типа антител к CD73.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Используемый в данном документе термин "CD73" относится к "кластеру дифференцировки 73", также известному как 5'-нуклеотидаза (5'-NT) или экто-5'-нуклеотидаза. Термин "CD73" включает мутанты, фрагменты, варианты, изоформы и гомологи полноразмерного CD73 дикого типа. В одном варианте осуществления белок CD73 кодируется геном NT5E. Иллюстративные последовательности CD73 доступны в базе данных Uniprot под номерами доступа Q6NZX3 и P21589. Иллюстративные аминокислотные последовательности незрелого CD73 представлены под SEQ ID NO: 105-107. "Мономер CD73" относится к полипептиду, содержащему внеклеточный домен CD73. В одном варианте осуществления мономер CD73 представляет собой полноразмерный CD73. "Димер CD73" относится к двум полипептидам (например, двум нековалентно связанным полипептидам), состоящим из двух мономеров CD73 (например, двух идентичных мономеров CD73), взаимодействующих друг с другом с образованием стабильного димера, например димера, образованного посредством белок-белковых взаимодействий между C-концевыми доменами мономеров CD73. В одном варианте осуществления димер CD73 представляет собой встречающийся в природе димер CD73.

Без ограничения теорией, CD73 человека содержит два домена. Консервативный N-концевой домен (соответствующий приблизительно остаткам 29-310 из SEQ ID NO: 105) и консервативный С-концевой домен (соответствующий приблизительно остаткам 343-513 из SEQ ID NO: 105), которые связаны одиночной α-спиралью (соответствующей приблизительно остаткам 318-336 из SEQ ID NO: 105). Активный сайт обнаруживается в основном в закрытой конформации и образуется между C- и N-концевыми доменами. Что касается ферментативного катализа, движение N-концевого домена на ~100° относительно С-концевого домена может обеспечить связывание и высвобождение субстрата, что происходит в открытой (каталитически неактивной) конформации. CD73 человека образует димер посредством белок-белковых взаимодействий между С-концевыми доменами. Площадь утопленной поверхности, а также молекулярные взаимодействия на границе раздела димеров значительно различаются между активной и неактивной конформациями фермента. См., например, Knapp K, et al., Structure 20:2161-73 (2012), включенную в данный документ посредством ссылки во всей своей полноте.

Соответственно, в настоящем изобретении предусмотрены, по меньшей мере помимо всего прочего, молекулы антител, которые связываются с CD73 с высокой аффинностью и специфичностью. В одном варианте осуществления в данном документе раскрыты антитела человека, которые связываются с CD73. В одном варианте осуществления в данном документе раскрыты молекулы антител, которые способны ингибировать или уменьшать ферментативную активность CD73, например CD73 человека, например растворимого CD73 человека или мембраносвязанного CD73 человека. В одном варианте осуществления в данном документе раскрыты молекулы антител, которые способны ингибировать опосредованное CD73 превращение аденозинмонофосфата (AMP) в аденозин или уменьшать его уровень. Дополнительные аспекты настоящего изобретения включают молекулы нуклеиновой кислоты, кодирующие молекулы антител, векторы экспрессии, клетки-хозяева и способы получения молекул антитела. Также предусмотрены иммуноконъюгаты, молекулы поли- или биспецифических антител и фармацевтические композиции, содержащие молекулы антител. Молекулы антитела к CD73, раскрытые в данном документе, можно применять для лечения, предупреждения и/или диагностики раковых или злокачественных нарушений, например солидных опухолей и опухолей жидких тканей, например рака легких (например, немелкоклеточного рака легких), рака поджелудочной железы (например, аденокарциномы протоков поджелудочной железы), рака молочной железы (например, трижды негативного рака молочной железы), меланомы, рака головы и шеи (например, плоскоклеточного рака головы и шеи), колоректального рака (например, колоректального рака с микросателлитной стабильностью (MSS)), рака яичника или рака почки (например, почечно-клеточной карциномы). Молекулы антитела к CD73, раскрытые в данном документе, можно применять для лечения, предупреждения и/или диагностики инфекционного заболевания. Таким образом, в данном документе раскрыты способы обнаружения CD73, а также способы лечения различных нарушений, в том числе рака и инфекционных заболеваний, с применением молекул антитела к CD73.

Дополнительные термины определены ниже и по всему тексту данной заявки.

Используемые в данном документе формы единственного числа относятся к одному или более чем одному (например, по меньшей мере одному) грамматическому объекту формы. Используемый в данном документе термин "множество" означает два или более.

Термин "или" используется в данном документе для обозначения термина "и/или" и используется взаимозаменяемо с ним, если контекст явно не указывает на иное.

Термины "приблизительно" и "примерно" будут обычно означать приемлемую степень погрешности для измеряемого количества с учетом природы или точности измерений. Иллюстративные значения степени погрешности находятся в пределах 20 процентов (%), как правило, в пределах 10%, и в большинстве случаев в пределах 5% от заданного значения или диапазона значений.

Композиции и способы, раскрытые в данном документе, охватывают полипептиды и нуклеиновые кислоты, имеющие указанные последовательности или последовательности, по сути идентичные им или сходные с ними, например последовательности, характеризующиеся по меньшей мере приблизительно 85%, 90% или 95% идентичностью с указанной последовательностью. В контексте аминокислотной последовательности термин "по сути идентичный" используется в данном документе для обозначения первой аминокислотной последовательности, которая содержит достаточное или минимальное количество аминокислотных остатков, которые являются i) идентичными выровненным аминокислотным остаткам во второй аминокислотной последовательности или ii) их консервативными заменами, так что первая и вторая аминокислотные последовательности могут иметь один и тот же структурный домен и/или одну и ту же функциональную активность. Например, аминокислотные последовательности, которые содержат один и тот же структурный домен, характеризуются по меньшей мере приблизительно 85%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичностью с эталонной последовательностью, например последовательностью, предусмотренной в данном документе.

В контексте нуклеотидной последовательности термин "по сути идентичный" используется в данном документе для обозначения последовательности первой нуклеиновой кислоты, которая содержит достаточное или минимальное количество нуклеотидов, которые идентичны выровненным нуклеотидам в последовательности второй нуклеиновой кислоты, так что первая и вторая нуклеотидные последовательности кодируют полипептид, имеющий одну и ту же функциональную активность, или кодируют домен полипептида с одной и той же структурой или полипептид с одной и той же функциональной активностью. Например, нуклеотидные последовательности характеризуются по меньшей мере приблизительно 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентичностью с эталонной последовательностью, например последовательностью, предусмотренной в данном документе.

Термин "функциональный вариант" относится к полипептидам, которые имеют аминокислотную последовательность, по сути идентичную встречающейся в природе последовательности, или кодируются по сути идентичной нуклеотидной последовательностью и способны проявлять один или несколько видов активности встречающейся в природе последовательности.

Расчеты гомологии или идентичности последовательностей между последовательностями (термины используются в данном документе взаимозаменяемо) выполняют следующим образом.

Чтобы определить процентную идентичность двух аминокислотных последовательностей или двух последовательностей нуклеиновых кислот, последовательности выравнивают в целях оптимального сравнения (например, для оптимального выравнивания можно вводить гэпы в одну или обе из первой и второй аминокислотной последовательности или последовательности нуклеиновых кислот, и негомологичные последовательности могут не учитываться в целях сравнения). В предпочтительном варианте осуществления длина эталонной последовательности, выровненной в целях сравнения, составляет по меньшей мере 30%, например по меньшей мере 40%, 50%, 60%, например по меньшей мере 70%, 80%, 90%, 100% длины эталонной последовательности. Затем сравнивают аминокислотные остатки или нуклеотиды в соответствующих аминокислотных положениях или нуклеотидных положениях. Если положение в первой последовательности занято тем же аминокислотным остатком или нуклеотидом, что и соответствующее положение во второй последовательности, тогда молекулы являются идентичными по данному положению.

Процентная идентичность двух последовательностей зависит от числа идентичных положений, общих для последовательностей, при этом учитывается число гэпов и длина каждого гэпа, которые необходимо ввести для оптимального выравнивания двух последовательностей.

Сравнение последовательностей и определение процентной идентичности двух последовательностей можно осуществлять с применением математического алгоритма. В некоторых вариантах осуществления процентную идентичность двух аминокислотных последовательностей определяют с помощью алгоритма Нидлмана-Вунша ((1970) J. Mol. Biol. 48:444-453), который был включен в программу GAP в составе пакета программного обеспечения GCG (доступного на http://www.gcg.com), с применением либо матрицы Blossom 62, либо матрицы PAM250, и штрафа за открытие гэпа, составляющего 16, 14, 12, 10, 8, 6 или 4, и штрафа за продление гэпа, составляющего 1, 2, 3, 4, 5 или 6. В определенных вариантах осуществления процентную идентичность между двумя нуклеотидными последовательностями определяют с применением программы GAP в составе пакета программного обеспечения GCG (доступного на http://www.gcg.com) с применением матрицы NWSgapdna.CMP и штрафа за открытие гэпа, составляющего 40, 50, 60, 70 или 80, и штрафа за продление гэпа, составляющего 1, 2, 3, 4, 5 или 6. Одним подходящим набором параметров (и тем, который следует применять, если не указано иное) является оценочная матрица Blossum 62 со штрафом за открытие гэпа 12, штрафом за продление гэпа 4 и штрафом за сдвиг рамки гэпа 5.

Процентную идентичность двух аминокислотных или нуклеотидных последовательностей можно определить с помощью алгоритма E. Meyers и W. Miller ((1989) CABIOS, 4:11-17), который был включен в программу ALIGN (версия 2.0), с применением таблицы весов замен остатков PAM120, штрафа за продление гэпа 12 и штрафа за открытие гэпа 4.

Последовательности нуклеиновой кислоты и белка, описанные в данном документе, можно применять в качестве "запрашиваемой последовательности" для проведения поиска в общедоступных базах данных, например, для идентификации других представителей семейства или родственных последовательностей. Такие поиски можно выполнять с применением программ NBLAST и XBLAST (версия 2.0) Altschul, et al. (1990) J. Mol. Biol. 215:403-10. Поиски нуклеотидов в BLAST можно выполнять с помощью программы NBLAST, оценка=100, длина слова=12, чтобы получить нуклеотидные последовательности, гомологичные молекулам нуклеиновой кислоты, описанным в данном документе. Поиски белка в BLAST можно выполнять с помощью программы XBLAST, оценка=50, длина слова=3, чтобы получить аминокислотные последовательности, гомологичные молекулам белка, описанным в данном документе. Для получения выравниваний с гэпами в целях сравнения можно использовать Gapped BLAST, как описано в Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402. При использовании программ BLAST и Gapped BLAST можно применять параметры по умолчанию из соответствующих программ (например, XBLAST и NBLAST). См. http://www.ncbi.nlm.nih.gov.

Используемый в данном документе термин "гибридизируется в условиях низкой жесткости, умеренной жесткости, высокой жесткости или очень высокой жесткости" описывает условия гибридизации и отмывки. Руководство по проведению реакций гибридизации можно найти в Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, которое включено в данный документ посредством ссылки. В этой ссылке описаны способы с применением водной среды и неводной среды, и можно применять любой из них. Конкретные условия гибридизации, упоминаемые в данном документе, являются следующими: 1) условия гибридизации низкой жесткости - в 6X хлориде натрия/цитрате натрия (SSC) при приблизительно 45°C, затем две промывки в 0,2X SSC, 0,1% SDS при по меньшей мере 50°C (температура промывок может быть повышена до 55°C для условий низкой жесткости); 2) условия гибридизации умеренной жесткости - в 6X SSC при приблизительно 45°C, затем одна или несколько промывок в 0,2X SSC, 0,1% SDS при 60°C; 3) условия гибридизации высокой жесткости - в 6X SSC при приблизительно 45°C, затем одна или несколько промывок в 0,2X SSC, 0,1% SDS при 65°C; и предпочтительно 4) условия гибридизации очень высокой жесткости представляют собой 0,5 М фосфат натрия, 7% SDS при 65°C, затем одна или несколько промывок при 0,2X SSC, 1% SDS при 65°C. Условия очень высокой жесткости (4) являются подходящими условиями и такими, которые следует использовать, если не указано иное.

Следует понимать, что молекулы по настоящему изобретению могут иметь дополнительные консервативные или несущественные аминокислотные замены, которые не оказывают существенного влияния на их функции.

Термин "аминокислота" предназначен для охвата всех молекул, как природных, так и синтетических, которые содержат как функциональную аминогруппу, так и кислотную функциональную группу, и могут быть включены в полимер из встречающихся в природе аминокислот. Типичные аминокислоты включают встречающиеся в природе аминокислоты; их аналоги, производные и родственные соединения; аналоги аминокислот, имеющие вариантные боковые цепи; и все стереоизомеры любого из вышеперечисленного. Используемый в данном документе термин "аминокислота" включает как D-, так и L-оптические изомеры и пептидомиметики.

"Консервативная аминокислотная замена" представляет собой замену, при которой аминокислотный остаток замещается аминокислотным остатком, имеющим сходную боковую цепь. Семейства аминокислотных остатков, имеющих сходные боковые цепи, были определены в уровне техники. Эти семейства включают аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислыми боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин).

Термины "полипептид", "пептид" и "белок" (если одноцепочечный) используются в данном документе взаимозаменяемо для обозначения полимеров из аминокислот любой длины. Полимер может быть линейным или разветвленным, он может содержать модифицированные аминокислоты, и он может прерываться молекулами, отличными от аминокислот. Термины также охватывают полимер из аминокислот, который был модифицирован; например, посредством образования дисульфидной связи, гликозилирования, липидизации, ацетилирования, фосфорилирования или любой другой манипуляции, такой как конъюгирование с метящим компонентом. Полипептид может быть выделен из природных источников, может быть получен с помощью методик на основе рекомбинации из эукариотического или прокариотического хозяина или может быть продуктом процедур синтеза.

Термины "нуклеиновая кислота", "последовательность нуклеиновой кислоты", "нуклеотидная последовательность" или "полинуклеотидная последовательность" и "полинуклеотид" используются взаимозаменяемо. Они относятся к полимерной форме нуклеотидов любой длины, либо дезоксирибонуклеотидов, либо рибонуклеотидов, либо их аналогов. Полинуклеотид может быть либо одноцепочечным, либо двухцепочечным, и если он одноцепочечный, то может представлять собой кодирующую цепь или некодирующую (антисмысловую) цепь. Полинуклеотид может содержать модифицированные нуклеотиды, такие как метилированные нуклеотиды и аналоги нуклеотидов. Последовательность нуклеотидов может быть прервана компонентами, не являющимися нуклеотидами. Полинуклеотид может быть дополнительно модифицирован после полимеризации, например, путем конъюгирования с метящим компонентом. Нуклеиновая кислота может представлять собой рекомбинантный полинуклеотид или полинуклеотид геномного, cDNA, полусинтетического или синтетического происхождения, который либо не встречается в природе, либо связан с другим полинуклеотидом в неприродном расположении.

Используемый в данном документе термин "выделенный" относится к материалу, который удален из своей исходной или нативной окружающей среды (например, природной окружающей среды, если он встречается в природе). Например, встречающийся в природе полинуклеотид или полипептид, присутствующий в живом животном, не является выделенным, но тот же полинуклеотид или полипептид, выделенный посредством вмешательства человека из некоторых или из всех совместно существующих материалов в природной системе, является выделенным. Такие полинуклеотиды могут быть частью вектора, и/или такие полинуклеотиды или полипептиды могут быть частью композиции и все еще являться выделенными, поскольку такой вектор или композиция не являются частью окружающей среды, в которой они встречаются в природе.

Термин "химерный антигенный рецептор" или, в качестве альтернативы "CAR" относится к набору полипептидов, как правило, двух в простейших вариантах осуществления, которые, находясь в иммунной эффекторной клетке, наделяют клетку специфичностью в отношении клетки-мишени, как правило, раковой клетки, и способностью образования внутриклеточного сигнала. В некоторых вариантах осуществления CAR содержит по меньшей мере внеклеточный антигенсвязывающий домен, трансмембранный домен и цитоплазматический сигнальный домен (также называемый в данном документе "внутриклеточным сигнальным доменом"), содержащий функциональный сигнальный домен, полученный из стимулирующей молекулы и/или костимулирующей молекулы, определенных в данном документе ниже. В некоторых аспектах полипептиды из набора являются смежными друг с другом. В некоторых вариантах осуществления набор полипептидов включает димеризационный переключатель, который при наличии димеризующей молекулы может связывать полипептиды друг с другом, например, может связывать антигенсвязывающий домен с внутриклеточным сигнальным доменом. В одном аспекте стимулирующая молекула представляет собой дзета-цепь, ассоциированную с Т-клеточным рецепторным комплексом. В одном аспекте цитоплазматический сигнальный домен дополнительно содержит один или несколько функциональных сигнальных доменов, полученных из по меньшей мере одной костимулирующей молекулы, определенной ниже. В одном аспекте костимулирующая молекула выбрана из костимулирующих молекул, описанных в данном документе, например, 4-1BB (т. е. CD137), CD27 и/или CD28. В одном аспекте CAR предусматривает химерный слитый белок, содержащий внеклеточный антигенсвязывающий домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR предусматривает химерный слитый белок, содержащий внеклеточный антигенсвязывающий домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий функциональный сигнальный домен, полученный из костимулирующей молекулы, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR предусматривает химерный слитый белок, содержащий внеклеточный антигенсвязывающий домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий два функциональных сигнальных домена, полученных из одной или нескольких костимулирующих молекул, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR предусматривает химерный слитый белок, содержащий внеклеточный антигенсвязывающий домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий по меньшей мере два функциональных сигнальных домена, полученных из одной или нескольких костимулирующих молекул, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR содержит необязательную лидерную последовательность на амино-конце (N-конце) слитого белка CAR. В одном аспекте CAR дополнительно содержит лидерную последовательность на N-конце внеклеточного антигенсвязывающего домена, при этом лидерная последовательность необязательно отщепляется от антигенсвязывающего домена (например, scFv) в ходе клеточного процессинга и локализации CAR в клеточной мембране.

Термин "сигнальный домен" относится к функциональной части белка, которая действует путем передачи информации внутри клетки для регуляции клеточной активности посредством определенных сигнальных путей, образуя вторичные мессенджеры или функционируя в качестве эффекторов путем ответа на такие мессенджеры.

Используемый в данном документе термин "внутриклеточный сигнальный домен" относится к внутриклеточной части молекулы. Внутриклеточный сигнальный домен генерирует сигнал, который способствует иммунной эффекторной функции клетки, содержащей CAR, например, CART-клетки. Примеры иммунной эффекторной функции, например, у CART-клетки, включают цитолитическую активность и хелперную активность, в том числе секрецию цитокинов.

В варианте осуществления внутриклеточный сигнальный домен может предусматривать первичный внутриклеточный сигнальный домен. Иллюстративные первичные внутриклеточные сигнальные домены включают в себя домены, полученные из молекул, отвечающих за первичную стимуляцию или антигензависимую стимуляцию. В варианте осуществления внутриклеточный сигнальный домен может предусматривать костимулирующий внутриклеточный домен. Иллюстративные костимулирующие внутриклеточные сигнальные домены включают в себя домены, полученные из молекул, отвечающих за передачу костимулирующих сигналов или антигеннезависимую стимуляцию. Например, в случае CART первичный внутриклеточный сигнальный домен может предусматривать цитоплазматическую последовательность Т-клеточного рецептора, и костимулирующий внутриклеточный сигнальный домен может предусматривать цитоплазматическую последовательность корецептора или костимулирующей молекулы.

Первичный внутриклеточный сигнальный домен может содержать сигнальный мотив, который известен как иммунорецепторный тирозиновый активирующий мотив или ITAM. Примеры первичных цитоплазматических сигнальных последовательностей, содержащих ITAM, включают без ограничения последовательности, полученные из CD3-дзета, общей гамма-цепи FcR (FCER1G), Fc-гамма RIIa, FcR-бета (Fc-эпсилон R1b), CD3-гамма, CD3-дельта, CD3-эпсилон, CD79a, CD79b, DAP10 и DAP12.

Термин "дзета" или в качестве альтернативы "дзета-цепь", "CD3-дзета" или "TCR-дзета" определяют как белок, представленный под № доступа в GenBank BAG36664.1, или эквивалентные остатки из вида, отличного от человека, например, мыши, грызуна, нечеловекообразной обезьяны, человекообразной обезьяны и т. п., и "стимулирующий домен дзета" или в качестве альтернативы "стимулирующий домен CD3-дзета" или "стимулирующий домен TCR-дзета" определяют как аминокислотные остатки цитоплазматического домена дзета-цепи или его функциональных производных, которые являются достаточными для функциональной передачи исходного сигнала, необходимого для активации Т-клеток. В одном аспекте цитоплазматический домен дзета содержит остатки 52-164 под № доступа GenBank BAG36664.1 или эквивалентные остатки из вида, отличного от человека, например, мыши, грызуна, нечеловекообразной обезьяны, человекообразной обезьяны и т. п., которые являются его функциональными ортологами.

Термин "костимулирующая молекула" относится к когнатному партнеру по связыванию на Т-клетке, который связывается с костимулирующим лигандом, опосредуя тем самым костимулируемый ответ Т-клетки, такой как без ограничения пролиферация. Костимулирующие молекулы представляют собой молекулы клеточной поверхности, отличные от антигенных рецепторов или их лигандов, которые способствуют эффективному иммунному ответу. Костимулирующие молекулы включают без ограничения молекулу MHC I класса, BTLA и лиганд Toll-подобного рецептора, а также OX40, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137). Дополнительные примеры таких костимулирующих молекул включают CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD160, CD19, CD4, CD8-альфа, CD8-бета, IL2R-бета, IL2R-гамма, IL7R-альфа, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a и лиганд, который связывается с CD83.

Костимулирующий внутриклеточный сигнальный домен может представлять собой внутриклеточную часть костимулирующей молекулы. Костимулирующая молекула может быть представлена следующими семействами белков: белки семейства TNF-рецепторов, иммуноглобулиноподобные белки, цитокиновые рецепторы, интегрины, сигнальные молекулы активации лимфоцитов (белки SLAM) и активирующие рецепторы NK-клеток. Примеры таких молекул включают CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, ICAM-1, антиген-1, ассоциированный с функцией лимфоцитов (LFA-1), CD2, CDS, CD7, CD287, LIGHT, NKG2C, NKG2D, SLAMF7, NKp80, NKp30, NKp44, NKp46, CD160, B7-H3 и лиганд, который связывается с CD83, и т. п.

Внутриклеточный сигнальный домен может содержать всю внутриклеточную часть или весь нативный внутриклеточный сигнальный домен молекулы, из которой он получен, или их функциональный фрагмент или производное.

Термин "4-1BB" относится к представителю суперсемейства TNFR с аминокислотной последовательностью, представленной под № доступа в GenBank AAA62478.2, или эквивалентным остаткам из вида, отличного от человека, например мыши, грызуна, нечеловекообразной обезьяны, человекообразной обезьяны и т. п.; и "костимулирующий домен 4-1BB" определяют как аминокислотные остатки 214-255 под № доступа в GenBank AAA62478.2 или эквивалентные остатки из вида, отличного от человека, например мыши, грызуна, нечеловекообразной обезьяны, человекообразной обезьяны и т. п.

Используемый в данном документе термин "иммунная эффекторная клетка" относится к клетке, которая участвует в иммунном ответе, например, способствуя иммунному эффекторному ответу. Примеры иммунных эффекторных клеток включают Т-клетки, например, альфа/бета-Т-клетки и гамма/дельта-Т-клетки, В-клетки, естественные клетки-киллеры (NK), естественные T-клетки-киллеры (NKT), тучные клетки и фагоциты миелоидного происхождения.

Используемый в данном документе термин "иммунная эффекторная функция" или "иммунный эффекторный ответ" относится к функции или ответу, например, иммунной эффекторной клетки, которые усиливают иммунную атаку на клетку-мишень или способствуют ей. Например, иммунная эффекторная функция или ответ относятся к свойству T- или NK-клетки, которое способствует уничтожению или ингибированию роста или пролиферации клетки-мишени. В случае с Т-клеткой первичная стимуляция и костимуляция являются примерами иммунной эффекторной функции или ответа.

Термины "ассоциированный с раком антиген" или "опухолевый антиген" взаимозаменяемо относятся к молекуле (как правило, белку, углеводу или липиду), которая экспрессируется на поверхности раковой клетки либо полностью, либо в виде фрагмента (например, молекула MHC/пептид), и которая является применимой для предпочтительного нацеливания фармакологического средства на раковую клетку. В некоторых вариантах осуществления опухолевый антиген представляет собой маркер, экспрессируемый как нормальными клетками, так и раковыми клетками, например, маркер линии дифференцировки, например, CD19 на В-клетках. В некоторых вариантах осуществления опухолевый антиген представляет собой молекулу клеточной поверхности, которая сверхэкспрессируется в раковой клетке по сравнению с нормальной клеткой, например, характеризуется 1-кратной сверхэкспрессией, 2-кратной сверхэкспрессией, 3-кратной или большей сверхэкспрессией по сравнению с нормальной клеткой. В некоторых вариантах осуществления опухолевый антиген представляет собой молекулу клеточной поверхности, которая синтезируется в раковой клетке ненадлежащим образом, например молекулу, которая содержит делеции, добавления или мутации по сравнению с молекулой, экспрессируемой на нормальной клетке. В некоторых вариантах осуществления опухолевый антиген будет экспрессироваться исключительно на клеточной поверхности раковой клетки, полностью или в виде фрагмента (например, молекула MHC/пептид), и не будет синтезироваться или экспрессироваться на поверхности нормальной клетки. В некоторых вариантах осуществления CAR по настоящему изобретению включают CAR, содержащие антигенсвязывающий домен (например, антитело или фрагмент антитела), который связывается с пептидом, презентируемым молекулой MHC. Обычно пептиды, полученные из эндогенных белков, заполняют карманы молекул главного комплекса гистосовместимости (MHC) I класса и распознаются T-клеточными рецепторами (TCR) на T-лимфоцитах CD8+. Комплексы молекул MHC I класса конститутивно экспрессируются всеми ядерными клетками. При раке комплексы вирусоспецифический и/или опухолеспецифический пептид/молекула MHC представляют собой уникальный класс мишеней клеточной поверхности для иммунотерапии. Были описаны TCR-подобные антитела, нацеливающиеся на пептиды, полученные из вирусных или опухолевых антигенов, связанные с лейкоцитарным антигеном человека (HLA)-A1 или HLA-A2 (см., например, Sastry et al., J Virol. 2011 85(5):1935-1942; Sergeeva et al., Blood, 2011 117(16):4262-4272; Verma et al., J Immunol 2010 184(4):2156-2165; Willemsen et al., Gene Ther 2001 8(21):1601-1608; Dao et al., Sci Transl Med 2013 5(176):176ra33; Tassev et al., Cancer Gene Ther 2012 19(2):84-100). Например, TCR-подобное антитело можно идентифицировать при скрининге библиотеки, такой как фаг-дисплейная библиотека scFv человека.

Ниже дополнительно подробно описаны различные аспекты в отношении композиций и способов, представленных в данном документе. Дополнительные определения изложены по всему тексту настоящего описания.

Молекулы антител

В одном варианте осуществления молекула антитела связывается с CD73 млекопитающего, например человека. Например, молекула антитела связывается с эпитопом, например линейным или конформационным эпитопом, например, описанным в данном документе эпитопом, на CD73.

Используемый в данном документе термин "молекула антитела" относится к белку, например, к цепи иммуноглобулина или ее фрагменту, содержащему по меньшей мере одну последовательность вариабельного домена иммуноглобулина. Термин "молекула антитела" предусматривает, например, моноклональное антитело (в том числе полноразмерное антитело, которое содержит Fc-область иммуноглобулина). В одном варианте осуществления молекула антитела предусматривает полноразмерное антитело или полноразмерную цепь иммуноглобулина. В одном варианте осуществления молекула антитела предусматривает антигенсвязывающий или функциональный фрагмент полноразмерного антитела или полноразмерной цепи иммуноглобулина.

Как используется в данном документе, молекула антитела "связывается" с антигеном, таким образом, как такое связывание понимается специалистом в данной области. В одном варианте осуществления антитело связывается с антигеном с константой диссоциации (KD), составляющей приблизительно 1 × 10-3 М или менее, 1 × 10-4 М или менее или 1 × 10-5 М или менее.

В одном варианте осуществления молекула антитела представляет собой молекулу моноспецифического антитела и связывает один эпитоп, например молекулу моноспецифического антитела, содержащую несколько последовательностей вариабельного домена иммуноглобулина, каждая из которых связывает один и тот же эпитоп.

В одном варианте осуществления молекула антитела представляет собой молекулу полиспецифического антитела, например, она содержит несколько последовательностей вариабельного домена иммуноглобулина, где первая из нескольких последовательностей вариабельного домена иммуноглобулина характеризуется специфичностью связывания с первым эпитопом, а вторая из нескольких последовательностей вариабельного домена иммуноглобулина характеризуется специфичностью связывания со вторым эпитопом. В варианте осуществления первый и второй эпитопы находятся на одном и том же антигене, например на одном и том же белке (или субъединице мультимерного белка). В варианте осуществления первый и второй эпитопы перекрываются или по сути перекрываются. В варианте осуществления первый и второй эпитопы не перекрываются или по сути не перекрываются. В варианте осуществления первый и второй эпитопы находятся на разных антигенах, например на разных белках (или на разных субъединицах мультимерного белка). В одном варианте осуществления молекула полиспецифического антитела содержит третий, четвертый или пятый вариабельные домены иммуноглобулина. В одном варианте осуществления молекула полиспецифического антитела представляет собой молекулу биспецифического антитела, молекулу триспецифического антитела или молекулу тетраспецифического антитела,

В варианте осуществления молекула полиспецифического антитела представляет собой молекулу биспецифического антитела. Биспецифическое антитело характеризуется специфичностью в отношении не более двух антигенов. Молекула биспецифического антитела характеризуется первой последовательностью вариабельного домена иммуноглобулина, которая характеризуется специфичностью связывания с первым эпитопом, и второй последовательностью вариабельного домена иммуноглобулина, которая характеризуется специфичностью связывания со вторым эпитопом. В варианте осуществления первый и второй эпитопы находятся на одном и том же антигене, например на одном и том же белке (или субъединице мультимерного белка). В варианте осуществления первый и второй эпитопы перекрываются или по сути перекрываются. В варианте осуществления первый и второй эпитопы не перекрываются или по сути не перекрываются. В варианте осуществления первый и второй эпитопы находятся на разных антигенах, например на разных белках (или на разных субъединицах мультимерного белка). В варианте осуществления молекула биспецифического антитела содержит последовательность вариабельного домена тяжелой цепи и последовательность вариабельного домена легкой цепи, которые характеризуются специфичностью связывания с первым эпитопом, и последовательность вариабельного домена тяжелой цепи и последовательность вариабельного домена легкой цепи, которые характеризуются специфичностью связывания со вторым эпитопом. В варианте осуществления молекула биспецифического антитела содержит полуантитело, характеризующееся специфичностью связывания с первым эпитопом, и полуантитело, характеризующееся специфичностью связывания со вторым эпитопом. В варианте осуществления молекула биспецифического антитела содержит полуантитело или его фрагмент, характеризующиеся специфичностью связывания с первым эпитопом, и полуантитело или его фрагмент, характеризующиеся специфичностью связывания со вторым эпитопом. В варианте осуществления молекула биспецифического антитела содержит scFv или его фрагмент, характеризующиеся специфичностью связывания с первым эпитопом, и scFv или его фрагмент, характеризующиеся специфичностью связывания со вторым эпитопом.

В одном варианте осуществления молекула антитела предусматривает диатело и одноцепочечную молекулу, а также антигенсвязывающий фрагмент антитела (например, Fab, F(ab')2 и Fv). Например, молекула антитела может содержать последовательность вариабельного домена тяжелой (H) цепи (сокращенно в данном документе VH) и последовательность вариабельного домена легкой (L) цепи (сокращенно в данном документе VL). В одном варианте осуществления молекула антитела содержит тяжелую цепь и легкую цепь или состоит из них (в данном документе называется полуантитело). В другом примере молекула антитела содержит две последовательности вариабельных доменов тяжелой (H) цепи и две последовательности вариабельных доменов легкой (L) цепи, образуя, таким образом, два антигенсвязывающих участка, такие как Fab, Fab', F(ab')2, Fc, Fd, Fd', Fv, одноцепочечные антитела (например, scFv), антитела с одним вариабельным доменом, диатела (Dab) (бивалентные и биспецифические) и химерные (например, гуманизированные) антитела, которые могут быть получены путем модификации целых антител или таковых, синтезированных de novo с использованием технологий рекомбинантной ДНК. Эти функциональные фрагменты антител сохраняют способность избирательно связываться с их соответствующим антигеном или рецептором. Антитела и фрагменты антител могут быть из любого класса антител, в том числе без ограничения IgG, IgA, IgM, IgD и IgE, и из любого подкласса (например, IgG1, IgG2, IgG3 и IgG4) антител. Препарат молекул антитела может быть моноклональным или поликлональным. Молекула антитела может также представлять собой человеческое, гуманизированное, CDR-привитое или полученное in vitro антитело. Антитело может иметь константную область тяжелой цепи, выбранную, например, из IgG1, IgG2, IgG3 или IgG4. Антитело также может иметь легкую цепь, выбранную, например, из каппа или лямбда. Термин "иммуноглобулин" (Ig) в данном документе используется взаимозаменяемо с термином "антитело".

Примеры антигенсвязывающих фрагментов молекулы антитела включают: (i) фрагмент Fab, моновалентный фрагмент, состоящий из доменов VL, VH, CL и CH1; (ii) фрагмент F(ab')2, бивалентный фрагмент, содержащий два фрагмента Fab, связанных дисульфидным мостиком в шарнирной области; (iii) фрагмент Fd, состоящий из доменов VH и CH1; (iv) фрагмент Fv, состоящий из доменов VL и VH одного плеча антитела, (v) фрагмент диатела (dAb), который состоит из домена VH; (vi) верблюжий или камелизованный вариабельный домен; (vii) одноцепочечный Fv (scFv), см., например, Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883); (viii) однодоменное антитело. Такие фрагменты антител можно получать с помощью любого подходящего способа, в том числе традиционных методик, известных специалистам в данной области, и фрагменты можно подвергать скринингу на пригодность таким же образом, как и интактные антитела.

Термин "антитело" включает интактные молекулы, а также их функциональные фрагменты. Константные области антител могут быть изменены, например подвергнуты мутации, для модификации свойств антитела (например, для повышения или снижения одного или нескольких из уровня связывания с рецептором Fc, уровня гликозилирования антител, числа цистеиновых остатков, функции эффекторных клеток или функции комплемента).

Антитела, раскрытые в данном документе, также могут представлять собой однодоменные антитела. Однодоменные антитела могут включать антитела, определяющие комплементарность области которых являются частью однодоменного полипептида. Примеры включают без ограничения антитела на основе тяжелых цепей, антитела, в природных условиях лишенные легких цепей, однодоменные антитела, полученные из традиционных 4-цепочечных антител, сконструированные антитела и однодоменные каркасные структуры, отличные от полученных из антител. Однодоменные антитела могут представлять собой любые антитела, известные из уровня техники, или любые однодоменные антитела, которые будут известны в будущем. Однодоменные антитела могут быть получены из любых видов, в том числе без ограничения из мыши, человека, верблюда, ламы, рыбы, акулы, козы, кролика и быка. Согласно другому аспекту однодоменное антитело представляет собой встречающееся в природе однодоменное антитело, известное как антитело на основе тяжелых цепей, лишенное легких цепей. Такие однодоменные антитела раскрыты в WO 9404678, например. В целях ясности этот вариабельный домен, полученный из антитела на основе тяжелых цепей, в природных условиях лишенного легкой цепи, именуется в данном документе как VHH или нанотело, чтобы отличать его от традиционного VH четырехцепочечных иммуноглобулинов. Такую молекулу VHH можно получить из антител видов Camelidae, например из верблюда, ламы, дромадера, альпаки и гуанако. Другие виды, помимо Camelidae, могут продуцировать антитела на основе тяжелых цепей, в природных условиях лишенные легкой цепи; такие VHH входят в объем настоящего изобретения.

Области VH и VL можно подразделить на области гипервариабельности, называемые "определяющими комплементарность областями" (CDR), которые чередуются с областями, являющимися более консервативными, называемыми "каркасными областями" (FR или FW).

Размеры каркасной области и CDR были точно определены с помощью ряда способов (см. Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Depar™ent of Health and Human Services, NIH Publication No. 91-3242; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; и определения AbM, используемого в программном обеспечении Oxford Molecular's AbM для моделирования антител. См. в целом, например, Protein Sequence and Structure Analysis of Antibody Variable Domains. В: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg).

Термины "определяющая комплементарность область" и "CDR", используемые в данном документе, относятся к последовательностям аминокислот в вариабельных областях антитела, которые придают антигенную специфичность и аффинность связывания. В некоторых вариантах осуществления, в каждой вариабельной области тяжелой цепи присутствуют три CDR (HCDR1, HCDR2 и HCDR3), и в каждой вариабельной области легкой цепи присутствуют три CDR (LCDR1, LCDR2 и LCDR3).

Точные границы аминокислотной последовательности данного CDR могут быть определены с использованием любой из хорошо известных схем, в том числе описанных в Kabat et al. (1991), "Sequences of Proteins of Immunological Interest," 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (схема нумерации в соответствии с "Kabat"), Al-Lazikani et al., (1997) JMB 273,927-948 (схема нумерации в соответствии с "Chothia"). Как используется в данном документе, CDR, определенные в соответствии со схемой нумерации "Chothia", также иногда называют "гипервариабельными петлями".

Например, согласно Kabat аминокислотные остатки CDR в вариабельном домене тяжелой цепи (VH) нумеруются 31-35 (HCDR1), 50-65 (HCDR2) и 95-102 (HCDR3); а аминокислотные остатки CDR в вариабельном домене легкой цепи (VL) нумеруются 24-34 (LCDR1), 50-56 (LCDR2) и 89-97 (LCDR3). Согласно Chothia аминокислоты CDR в VH нумеруются 26-32 (HCDR1), 52-56 (HCDR2) и 95-102 (HCDR3); а аминокислотные остатки в VL нумеруются 26-32 (LCDR1), 50-52 (LCDR2) и 91-96 (LCDR3). Объединяя определения CDR согласно Kabat и согласно Chothia, CDR состоят из аминокислотных остатков 26-35 (HCDR1), 50-65 (HCDR2) и 95-102 (HCDR3) в человеческом VH и аминокислотных остатков 24-34 (LCDR1), 50-56 (LCDR2) и 89-97 (LCDR3) в человеческом VL.

Согласно всем определениям, каждый из VH и VL, как правило, содержит три CDR и четыре FR, расположенные от аминоконца к карбоксиконцу в следующем порядке: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.

Как правило, если конкретно не указано иное, молекулы антитела к CD73 могут содержать любую комбинацию одной или нескольких CDR по Kabat, CDR по Chothia, комбинацию CDR по Kabat и Chothia, CDR согласно IMGT и/или альтернативному определению, например, описанному в таблице 1.

Используемый в данном документе термин "последовательность вариабельного домена иммуноглобулина" относится к аминокислотной последовательности, которая может образовывать структуру вариабельного домена иммуноглобулина. Например, последовательность может содержать всю аминокислотную последовательность встречающегося в природе вариабельного домена или ее часть. Например, последовательность может содержать одну, две или более N- или С-концевых аминокислот, или не содержать их или может содержать другие изменения, которые совместимы с образованием белковой структуры.

Термин "антигенсвязывающий участок" относится к части молекулы антитела, которая содержит детерминанты, которые образуют участок взаимодействия, который связывается с полипептидом CD73 или его эпитопом. Что касается белков (или белковых миметиков), антигенсвязывающий участок обычно содержит одну или несколько петель (из по меньшей мере, например, четырех аминокислот или аминокислотных миметиков), которые образуют участок взаимодействия, связывающийся с полипептидом CD73. Обычно антигенсвязывающий участок молекулы антитела содержит по меньшей мере одну или две CDR и/или гипервариабельные петли или, более обычно, по меньшей мере три, четыре, пять или шесть CDR и/или гипервариабельных петель.

Используемый в данном документе термин "нумерация Eu" относится к соглашению о нумерации Eu для константных областей антитела, как описано в Edelman, G.M. et al., Proc. Natl. Acad. USA, 63, 78-85 (1969) и Kabat et al., в "Sequences of Proteins of Immunological Interest", U.S. Dept. Health and Human Services, 5th edition, 1991.

Термины "конкурировать" или "перекрестно конкурировать" используются в данном документе взаимозаменяемо для обозначения способности молекулы антитела препятствовать связыванию молекулы антитела к CD73, например молекулы антитела к CD73, представленной в данном документе, с мишенью, например CD73 человека. Препятствование связыванию может быть прямым или косвенным (например, посредством аллостерической модуляции молекулы антитела или мишени). Степень, в которой молекула антитела способна препятствовать связыванию другой молекулы антитела с мишенью, и, следовательно, можно ли сказать, что она конкурирует, может быть определена с использованием анализа конкурентного связывания, например анализа методом проточной цитометрии, анализа ELISA или BIACORE. В некоторых вариантах осуществления анализ конкурентного связывания представляет собой количественный конкурентный анализ. В некоторых вариантах осуществления первая молекула антитела к CD73 конкурирует за связывание с мишенью со второй молекулой антитела к CD73, если связывание первой молекулы антитела с мишенью снижается на 10% или более, например на 20% или более, 30% или более, 40% или более, 50% или более, 55% или более, 60% или более, 65% или более, 70% или более, 75% или более, 80% или более, 85% или более, 90% или более, 95% или более, 98% или более, 99% или более в конкурентном анализе связывания (например, конкурентном анализе, описанном в данном документе).

Используемый в данном документе термин "эпитоп" относится к фрагментам антигена (например, CD73 человека), которые специфически взаимодействуют с молекулой антитела. Такие фрагменты, также называемые в данном документе эпитопными детерминантами, обычно содержат или являются частью таких элементов, как боковые цепи аминокислот или боковые цепи сахаров. Эпитопная детерминанта может быть определена способами, известными из уровня техники или раскрытыми в данном документе, например, с помощью кристаллографии или анализе водородно-дейтериевого обмена. По меньшей мере один или несколько фрагментов в молекуле антитела, которые специфически взаимодействуют с эпитопной детерминантой, обычно находятся в CDR. Как правило, эпитоп имеет специфические трехмерные характеристики структуры. Как правило, эпитоп имеет специфические характеристики заряда. Некоторые эпитопы являются линейными эпитопами, тогда как другие являются конформационными эпитопами.

В одном варианте осуществления эпитопная детерминанта представляет собой фрагмент на антигене, например такой как боковая цепь аминокислоты или боковая цепь сахара или их часть, который, когда молекула антигена и антитела совместно кристаллизуются, находится в пределах предварительно определенного расстояния, например в пределах 5 ангстрем, от фрагмента молекулы антитела, упоминаемого в данном документе как "кристаллографическая эпитопная детерминанта". Кристаллографические эпитопные детерминанты эпитопа все вместе называют "кристаллографическим эпитопом".

Первая молекула антитела связывается с тем же эпитопом, что и вторая молекула антитела (например, молекула эталонного антитела, например молекула антитела, раскрытая в данном документе), если первое антитело взаимодействует с теми же эпитопными детерминантами на антигене, что и второе антитело или эталонное антитело, например, если взаимодействие измеряют одинаковым образом как для антитела, так и для второго или эталонного антитела. Эпитопы, которые перекрываются, имеют по меньшей мере одну общую эпитопную детерминанту. Первая молекула антитела связывает с эпитопом, который перекрывается с эпитопом второй молекулы антитела (например, молекулой эталонного антитела, например антителом, раскрытым в данном документе), если обе молекулы антител взаимодействуют с одной и той же эпитопной детерминантой. Первая и вторая молекула антитела (например, молекула эталонного антитела, например молекула антитела, раскрытая в данном документе) связывают по сути перекрывающиеся эпитопы, если по меньшей мере половина эпитопных детерминант второго или эталонного антитела обнаружены как эпитопные детерминанты в эпитопе первого антитела. Первая и вторая молекула антитела (например, молекула эталонного антитела, например молекула антитела, раскрытая в данном документе) связывают по сути один и тот же эпитоп, если первая молекула антитела связывает по меньшей мере половину коровых эпитопных детерминант эпитопа второго или эталонного антитела, где коровые эпитопные детерминанты определяют, например, с помощью кристаллографии или водородно-дейтериевого обмена.

Как используется в данном документе, молекула антитела "уменьшает уровень водородно-дейтериевого обмена" во фрагменте антигена, если водородно-дейтериевый обмен во фрагменте антигена в присутствии молекулы антитела становится ниже, чем водородно-дейтериевый обмен во фрагменте антигена в отсутствие молекулы антитела, что измеряют при помощи анализа водородно-дейтериевого обмена.

Как используется в данном документе, уменьшение "среднего уровня водородно-дейтериевого обмена" определяется по уровню нормализованного водородно-дейтериевого обмена (Да на остаток) во фрагменте антигена в отсутствие антитела минус уровень нормализованного водородно-дейтериевого обмена (Да на остаток) во фрагменте антигена в присутствии антитела.

Используемые в данном документе термины "моноклональное антитело" или "композиция на основе моноклональных антител" относятся к препарату из молекул антитела одного молекулярного состава. Композиция на основе моноклонального антитела проявляет одну специфичность и аффинность связывания в отношении конкретного эпитопа. Моноклональное антитело может быть получено с помощью технологии гибридом или с помощью способов, в которых не используется технология гибридом (например, способов на основе рекомбинации).

"Эффективный в отношении человека" белок представляет собой белок, который не вызывает ответа с образованием нейтрализующего антитела, например ответа с образованием антитела человека к антигену мыши (НАМА). HAMA может создавать проблемы при ряде обстоятельств, например, если молекулу антитела вводят повторно, например при лечении хронического или рецидивирующего заболевания. Ответ с образованием HAMA может сделать повторное введение антител потенциально неэффективным из-за увеличения уровня выведения антител из сыворотки крови (см., например, Saleh et al., Cancer Immunol. Immunother., 32:180-190 (1990)), и ввиду потенциальных аллергических реакций (см.,например, LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).

Молекула антитела может представлять собой поликлональное или моноклональное антитело. В других вариантах осуществления антитело может быть получено с помощью рекомбинации, например его можно получить с помощью дрожжевого дисплея, фагового дисплея или с помощью комбинаторных способов. В качестве альтернативы, такие антитела могут отбирать из синтетических систем презентации антител на основе дрожжей, таких как описанные, например, в Y. Xu et al, Addressing polyspecificity of antibodies selected from an in vitro yeast presentation system: a FACS-based, high-throughput selection and analytical tool. PEDS 26.10, 663-70 (2013); WO2009036379; WO2010105256; и WO2012009568, включенных в данный документ посредством ссылок во всей их полноте.

В одном варианте осуществления антитело представляет собой полностью человеческое антитело (например, антитело, полученное с помощью дрожжевого дисплея, антитело, полученное с помощью фагового дисплея, или антитело, полученное от мыши, которое сконструировали с помощью генной инженерии с получением антитела из последовательности человеческого иммуноглобулина) или антитело, не являющееся человеческим, например антитело грызуна (мыши или крысы), козы, примата (например, обезьяны) или верблюда. Способы получения антител грызунов известны из уровня техники.

Человеческие моноклональные антитела могут быть преимущественно получены с применением трансгенных мышей, несущих гены человеческого иммуноглобулина, а не мышиной системы. Спленоциты от таких трансгенных мышей, иммунизированных представляющим интерес антигеном, используются для получения гибридом, которые секретируют mAb человека со специфическими значениями аффинности в отношении эпитопов из белка человека (см., например, Wood et al. международную заявку WO 91/00906, Kucherlapati et al. публикацию согласно PCT WO 91/10741; Lonberg et al. международную заявку WO 92/03918; Kay et al. международную заявку 92/03917; Lonberg, N. et al. 1994 Nature 368:856-859; Green, L.L. et al. 1994 Nature Genet. 7:13-21; Morrison, S.L. et al. 1994 Proc. Natl. Acad. Sci. USA 81:6851-6855; Bruggeman et al. 1993 Year Immunol 7:33-40; Tuaillon et al. 1993 PNAS 90:3720-3724; Bruggeman et al. 1991 Eur J Immunol 21:1323-1326).

Антитело может представлять собой антитело, в котором вариабельная область или ее часть, например CDR, вырабатываются в организме, отличном от человеческого, например крысы или мыши. Химерные антитела, антитела с привитыми CDR и гуманизированные антитела включены в объем настоящего изобретения. Антитела, вырабатываемые в организме, отличном от человеческого, например в организме крысы или мыши, и которые затем подвергают модификации, например, в вариабельном каркасе или константной области, для снижения антигенности у человека, входят в объем настоящего изобретения.

Антитела могут быть получены с помощью любых подходящих методик на основе рекомбинации ДНК, известных из уровня техники (см. Robinson et al., публикацию международной заявки на патент PCT/US86/02269; Akira, et al., заявку на европейский патент 184187; Taniguchi, M., заявку на европейский патент 171496; Morrison et al., заявку на европейский патент 173494; Neuberger et al., международную заявку WO 86/01533; Cabilly et al. патент США № 4816567; Cabilly et al., заявку на европейский патент 125023; Better et al. (1988 Science 240:1041-1043); Liu et al. (1987) PNAS 84:3439-3443; Liu et al., 1987, J. Immunol. 139:3521-3526; Sun et al. (1987) PNAS 84:214-218; Nishimura et al., 1987, Canc. Res. 47:999-1005; Wood et al. (1985) Nature 314:446-449; и Shaw et al., 1988, J. Natl Cancer Inst. 80:1553-1559).

В гуманизированном антителе или антителе с привитыми CDR по меньшей мере одну или две, но как правило, все три реципиентные CDR (из тяжелых и легких цепей иммуноглобулина) замещают донорной CDR. Антитело может быть замещено по меньшей мере частью CDR, не принадлежащей человеку, или только некоторые из CDR могут быть замещены CDR, не принадлежащими человеку. Необходимо только заменить количество CDR, необходимых для связывания гуманизированного антитела к CD73. В некоторых вариантах осуществления донор представляет собой антитело грызуна, например антитело крысы или мыши, а реципиент представляет собой каркасную область человека или консенсусную каркасную область человека. Как правило, иммуноглобулин, из которого получают CDR, называют "донорным", а иммуноглобулин, из которого получают каркас, называют "акцепторным". В одном варианте осуществления донорный иммуноглобулин представляет собой отличный от человеческого иммуноглобулин (например, иммуноглобулин грызуна). Акцепторная каркасная область представляет собой встречающуюся в природе (например, человеческую) каркасную область или консенсусную каркасную область или последовательность, на приблизительно 85% или больше, например на 90%, 95%, 99% или больше, идентичную им.

Используемый в данном документе термин "консенсусная последовательность" относится к последовательности, образованной из наиболее часто встречающихся аминокислот (или нуклеотидов) в семействе родственных последовательностей (см., например, Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). В семействе белков каждое положение в консенсусной последовательности занято аминокислотой, наиболее часто встречающейся в этом положении в пределах семейства. Если две аминокислоты встречаются одинаково часто, любая из них может быть включена в консенсусную последовательность. "Консенсусный каркас" относится к каркасной области в консенсусной последовательности иммуноглобулина.

Антитело может быть гуманизировано с помощью способов, известных из уровня техники (см. например, Morrison, S. L., 1985, Science 229:1202-1207, Oi et al., 1986, BioTechniques 4:214, и Queen et al. патент США № 5585089, патент США № 5693761 и патент США № 5693762, содержание каждого из которых включено в данный документ посредством ссылки).

Гуманизированные или антитела с привитыми CDR антитела можно получать с помощью CDR-прививки или CDR-замены, где одна, две или все CDR иммуноглобулиновой цепи могут быть заменены. См., например, патент США № 5225539; Jones et al. 1986 Nature 321:552-525; Verhoeyan et al. 1988 Science 239:1534; Beidler et al. 1988 J. Immunol. 141:4053-4060; Winter патент США № 5225539, содержание каждого из которых специально включено в данный документ посредством ссылки

Также в объем настоящего изобретения включены гуманизированные антитела, в которых определенные аминокислоты были замещены, удалены или добавлены. Критерии выбора аминокислот от донора описаны в патенте США № 5585089, например, разделы 12-16 патента США № 5585089, например разделы 12-16 патента США № 5585089, содержание которых включено в настоящее описание посредством ссылки. Другие методики гуманизации антител описаны в Padlan et al. EP 519596 A1, опубликованном 23 декабря 1992 г.

Молекула антитела может представлять собой одноцепочечное антитело. Одноцепочечное антитело (scFV) может быть сконструированным (см., например, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; и Reiter, Y. (1996) Clin Cancer Res 2:245-52). Одноцепочечное антитело может быть димеризовано или мультимеризовано с получением поливалентных антител, характеризующихся специфичностью в отношении разных эпитопов одного и того же белка-мишени.

В еще других вариантах осуществления молекула антитела содержит константную область тяжелой цепи, выбранную, например, из константных областей тяжелой цепи IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD и IgE; в частности, выбранную, например, из (например, человеческих) константных областей тяжелой цепи IgG1, IgG2, IgG3 и IgG4. В другом варианте осуществления молекула антитела содержит константную область легкой цепи, выбранную, например, из (например, человеческой) константных областей легкой каппа-цепи или лямбда-цепи. Константная область может быть изменена, например, подвергнута мутации, для модификации свойств антитела (например, для повышения или снижения одного или нескольких из уровня связывания с рецептором Fc, уровня гликозилирования антител, числа цистеиновых остатков, функции эффекторных клеток и/или функции комплемента). В некоторых вариантах осуществления антитело обладает эффекторной функцией и может связывать комплемент. В других вариантах осуществления антитело не рекрутирует эффекторные клетки и не связывает комплемент. В определенных вариантах осуществления антитело обладает пониженной способностью связываться с рецептором Fc или не имеет ее. Например, оно может представлять собой изотип или подтип, фрагмент или другой мутант, который не поддерживает связывание с рецептором Fc, например, оно содержит область связывания с рецептором Fc, подвергнутую мутагенезу, или эта область удалена.

Способы изменения константной области антитела известны из уровня техники. Антитела с измененной функцией, например измененной аффиностью в отношении эффекторного лиганда, такого как FcR на клетке или компоненте С1 комплемента, можно получать путем замены по меньшей мере одного аминокислотного остатка в константной части антитела другим остатком (см. например, EP 388151 A1, патент США № 5624821 и патент США № 5648260, содержание каждого из которых включено в данный документ посредством ссылки). Также рассматривают аминокислотные мутации, которые стабилизируют структуру антитела, такие как S228P (нумерация Eu) в IgG4 человека. Могут быть описаны аналогичные виды изменений, которые, в случае их применения в отношении иммуноглобулина мыши или других видов, уменьшают или устраняют эти функции.

Молекула антитела может быть дериватизированой или связанной с другой функциональной молекулой (например, другим пептидом или белком). Используемый в данном документе термин "дериватизированная" молекула антитела представляет собой молекулу, которая была модифицирована. Способы дериватизации включают без ограничения добавление флуоресцентного фрагмента, радионуклеотида, токсина, фермента или аффинного лиганда, такого как биотин. Соответственно, предполагается, что молекулы антител по настоящему изобретению включают дериватизированные и иным образом модифицированные формы антител, описанные в данном документе, в том числе молекулы иммуноадгезии. Например, молекула антитела может быть функционально связана (посредством химического соединения, генетического слияния, нековалентной ассоциации или иным образом) с одним или несколькими другими молекулярными объектами, такими как другое антитело (например, биспецифическое антитело или диатело), средство, обеспечивающее обнаружение, цитотоксическое средство, фармацевтическое средство и/или белок или пептид, которые могут опосредовать ассоциацию антитела или части антитела с другой молекулой (такой как коровая область стрептавидина или полигистидиновая метка).

Молекулу дериватизированного антитела одного типа получают путем сшивания двух или более антител (одного и того же типа или разных типов, например, для создания биспецифических антител). Подходящие сшивающие средства включают средства, которые являются гетеробифункциональными и при этом содержат две группы, реагирующие отдельно, разделенные подходящим спейсером (например, м-малеимидобензоил-N-гидроксисукцинимидным эфиром), или гомобифункциональными (например, дисукцинимидилсуберат). Такие линкеры доступны от Pierce Chemical Company, Рокфорд, Иллинойс.

Применимые средства, обеспечивающие обнаружение, с помощью которых можно дериватизировать (или пометить) молекулу антитела по настоящему изобретению, включают флуоресцентные соединения, различные ферменты, простетические группы, люминесцентные материалы, биолюминесцентные материалы, атомы металлов, излучающие флуоресценцию, например европий (Eu) и другие антаниды, и радиоактивные материалы (описанные ниже). Типичные флуоресцентные средства, обеспечивающие обнаружение, включают флуоресцеин, изотиоцианат флуоресцеина, родамин, 5-диметиламин-1-нафталинсульфонилхлорид, фикоэритрин и т. п. Антитело также может быть дериватизировано с помощью ферментов, обеспечивающих обнаружение, таких как щелочная фосфатаза, пероксидаза хрена, β-галактозидаза, ацетилхолинэстераза, глюкозооксидаза и т. п. Если антитело дериватизировано с помощью фермента, обеспечивающего обнаружение, его обнаруживают путем добавления дополнительных реагентов, которые используются ферментом с получением детектируемого продукта реакции. Например, при присутствии средства, обеспечивающего обнаружение, представляющего собой пероксидазу хрена, добавление перекиси водорода и диаминобензидина приводит к получению окрашенного продукта реакции, который можно обнаружить. Молекула антитела также может быть дериватизирована с помощью простетической группы (например, стрептавидин/биотин и авидин/биотин). Например, антитело может быть дериватизировано с помощью биотина и обнаруживаться путем непрямого измерения уровня связывания авидина или стрептавидина. Примеры подходящих флуоресцентных материалов включают умбеллиферон, флуоресцеин, изотиоцианат флуоресцеина, родамин, дихлортриазиниламин флуоресцеина, дансилхлорид или фикоэритрин; пример люминесцентного материала включает люминол; и примеры биолюминесцентных материалов включают люциферазу, люциферин и экворин.

Меченую молекулу антитела можно применять, например, для диагностики и/или эксперимента в ряде случаев, в том числе (i) для выделения заранее определенного антигена с помощью стандартных методик, таких как аффинная хроматография или иммунопреципитация; (ii) для обнаружения заранее определенного антигена (например, в клеточном лизате или клеточном супернатанте) для оценки количества и характера экспрессии белка; (iii) для контроля уровней белка в ткани в качестве части процедуры клинического исследования, например, для определения эффективности данного режима лечения.

Молекула антитела может быть конъюгирована с другим молекулярным объектом, как правило меткой или терапевтическим (например, иммуномодулирующим, иммуностимуляторным, цитотоксическим или цитостатическим) средством или фрагментом. Радиоактивные изотопы можно применять в диагностических или терапевтических применениях. Радиоактивные изотопы, которые могут быть присоединены к антителам к CD73, включают без ограничения α-, β- или γ-излучатели или β- и γ-излучатели. Такие радиоактивные изотопы включают без ограничения йод (131I или 125I), иттрий (90Y), лютеций ( 177Lu), актинидий (225Ac), празеодим, астатин ( 211At), рений (186Re), висмут (212Bi или 213Bi), индий (111In), технеций (99mTc), фосфор (32P), родий (188Rh), сера (35S), углерод (14C), тритий (3H), хром (51Cr), хлор (36Cl), кобальт (57Co или 58Co), железо ( 59Fe), селен (75Se) или галлий (67Ga). Радиоизотопы, применяемые в качестве терапевтических средств, включают иттрий (90Y), лютеций (177Lu), актиний (225Ac), празеодим, астатин (211At), рений (186Re), висмут (212Bi или 213Bi) и родий (188Rh). Радиоизотопы, применяемые в качестве меток, например, для применения в диагностике, включают йод (131I или 125I), индий (111In), технеций (99mTc), фосфор (32P), углерод (14C) и тритий (3 H) или один или несколько изотопов для терапевтического применения, перечисленных выше.

Настоящее изобретение относится к молекулам антител с радиоактивной меткой и способам их мечения. В одном варианте осуществления раскрыт способ мечения молекулы антитела. Способ предусматривает приведение молекулы антитела в контакт с хелатирующим средством с получением таким образом конъюгированного антитела. Конъюгированное антитело метят радиоактивной меткой с помощью радиоизотопа, например 111индия, 90иттрия и 177лютеция, с получением таким образом меченой молекулы антитела.

Как обсуждалось выше, молекула антитела может быть конъюгирована с терапевтическим средством. Терапевтически активные радиоизотопы уже упоминались. Примеры других терапевтических средств включают таксол, цитохалазин B, грамицидин D, бромид этидия, эметин, митомицин, этопозид, тенопозид, винкристин, винбластин, колхицин, доксорубицин, даунорубицин, дигидроксиантрациндион, митоксантрон, митрамицин, актиномицин D, 1-дегидротестостерон, глюкокортикоиды, прокаин, тетракаин, лидокаин, пропранолол, пуромицин, майтанзиноиды, например майтанзинол (см. патент США № 5208020), CC-1065 (см. патенты США №№ 5475092, 5585499, 5846545), и их аналоги или гомологи. Терапевтические средства включают без ограничения антиметаболиты (например, метотрексат, 6-меркаптопурин, 6-тиогуанин, цитарабин, 5-фторурацил декарбазин), алкилирующие средства (например, мехлорэтамин, тиотэпа, хлорамбуцил, CC-1065, мелфалан, кармустин (BSNU) и ломустин (CCNU), циклофосфамид, бусульфан, дибромоманнитол, стрептозотоцин, митомицин C и цис-дихлордиамин платины (II) (DDP), цисплатин), антрациклины (например, даунорубицин (ранее дауномицин) и доксорубицин), антибиотики (например, дактиномицин (ранее актиномицин), блеомицин, митрамицин и антрамицин (AMC)) и антимитотические средства (например, винкристин, винбластин, таксол и майтансиноиды).

В одном аспекте настоящее изобретение относится к способу получения молекулы, связывающей мишень, которая связывается с рецептором CD73. Например, молекула, связывающая мишень, представляет собой молекулу антитела. Способ предусматривает: предоставление белка-мишени, который содержит по меньшей мере часть белка, не являющегося человеческим, причем эта часть гомологична (идентична на по меньшей мере 70, 75, 80, 85, 87, 90, 92, 94, 95, 96, 97, 98, или 99%) соответствующей части белка-мишени человека, но отличается на по меньшей мере одну аминокислоту (например, по меньшей мере одну, две, три, четыре, пять, шесть, семь, восемь или девять аминокислот); получение молекулы антитела, которая связывается с антигеном; и оценку эффективности связывающего средства в отношении модулирования активности белка-мишени. Способ может дополнительно предусматривать введение связывающего средства (например, молекулы антитела) или его производного (например, молекулы гуманизированного антитела) субъекту, представляющему собой человека.

В определенных вариантах осуществления молекула антитела представляет собой молекулу полиспецифического (например, биспецифического или триспецифического) антитела. Протоколы для создания молекул биспецифического или гетеродимерного антител известны из уровня техники, включая без ограничения, например, подход "выступ во впадину", как описано, например, в US 5731168; спаривание Fc с использованием направленного электростатического взаимодействия, как описано, например, в WO 09/089004, WO 06/106905 и WO 2010/129304; образование гетеродимеров путем конструирования доменов с обменом нитей (SEED), как описано, например, в WO 07/110205; обмен Fab-фрагментами, как описано, например, в WO 08/119353, WO 2011/131746 и WO 2013/060867; двойные конъюгаты антител, например, получаемые путем сшивания антител с созданием биспецифической структуры с помощью гетеробифункционального реагента, содержащего реакционноспособную аминогруппу и реакционноспособную сульфгидрильную группу, как описано, например, в US 4433059; детерминанты биспецифических антител, создаваемые путем рекомбинации полуантител (пары тяжелая-легкая цепь или Fab) из разных антител посредством цикла восстановления и окисления дисульфидных связей между двумя тяжелыми цепями, как описано, например, в US 4444878; трифункциональные антитела, например, три Fab'-фрагмента, сшитые с помощью реакционноспособных сульфгидрильных групп, как описано, например, в US5273743; биосинтетические связывающие белки, например, пары scFv, сшитых на С-концевых хвостах, предпочтительно посредством химической сшивки посредством дисульфидных связей или реакционноспособных аминогрупп, как описано, например, в US5534254; бифункциональные антитела, например, Fab-фрагменты с различной специфичностью связывания, димеризованные с помощью лейциновых "застежек" (например, c-fos и c-jun), заменивших константный домен, как описано, например, в US5582996; биспецифические и олигоспецифические моно- и олиговалентные рецепторы, например, VH-CH1-области двух антител (два Fab-фрагмента), связанные полипептидным спейсером между CH1-областью одного антитела и VH-областью другого антитела, обычно с ассоциированными легкими цепями, как описано, например, в US5591828; биспецифические конъюгаты ДНК-антитело, например, получаемые путем сшивки антител или Fab-фрагментов двухнитевым фрагментом ДНК, как описано, например, в US5635602; биспецифические слитые белки, например, экспрессионную конструкцию, содержащую два scFv с гидрофильным спиральным пептидным линкером между ними и полной константной областью, как описано, например, в US5637481; поливалентные и полиспецифические связывающие белки, например, димер полипептидов, имеющий первый домен со связывающей областью вариабельной области тяжелой цепи Ig и второй домен со связывающей областью вариабельной области легкой цепи Ig, как правило, называемые диателами (также охватываются структуры более высокого порядка для создания биспецифических, триспецифических или тетраспецифических молекул, как описано, например, в US5837242; конструкции миниантител со связанными VL- и VH-цепями, дополнительно соединенными пептидными спейсерами с шарнирной областью антитела и СН3-областью, которые могут быть димеризованы с образованием биспецифических/поливалентных молекул, как описано, например, в US5837821; VH- и VL-домены, связанные коротким пептидным линкером (например, из 5 или 10 аминокислот) или вовсе не имеющие линкера, в любой ориентации, которые могут образовывать димеры с образованием биспецифических диател; тримеры и тетрамеры, как описано, например, в US5844094; нить из VH-доменов (или VL-доменов у представителей семейства), соединенных пептидными связями со сшиваемыми группами на С-конце, дополнительно ассоциированных с VL-доменами с образованием последовательно соединенных Fv (или scFv), как описано, например, в US5864019; и одноцепочечные связывающие полипептиды как с VH-, так и с VL-доменами, связанными пептидным линкером, объединенные в поливалентные структуры посредством нековалентной или химической сшивки с образованием, например, гомобивалентных, гетеробивалентных, тривалентных и тетравалентных структур с использованием формата как типа scFv, так и типа диатела, как описано, например, в US5869620. Дополнительные иллюстративные полиспецифические и биспецифические молекулы и способы их получения находятся, например, в US5910573, US5932448, US5959083, US5989830, US6005079, US6239259, US6294353, US6333396, US6476198, US6511663, US6670453, US6743896, US6809185, US6833441, US7129330, US7183076, US7521056, US7527787, US7534866, US7612181, US2002004587A1, US2002076406A1, US2002103345A1, US2003207346A1, US2003211078A1, US2004219643A1, US2004220388A1, US2004242847A1, US2005003403A1, US2005004352A1, US2005069552A1, US2005079170A1, US2005100543A1, US2005136049A1, US2005136051A1, US2005163782A1, US2005266425A1, US2006083747A1, US2006120960A1, US2006204493A1, US2006263367A1, US2007004909A1, US2007087381A1, US2007128150A1, US2007141049A1, US2007154901A1, US2007274985A1, US2008050370A1, US2008069820A1, US2008152645A1, US2008171855A1, US2008241884A1, US2008254512A1, US2008260738A1, US2009130106A1, US2009148905A1, US2009155275A1, US2009162359A1, US2009162360A1, US2009175851A1, US2009175867A1, US2009232811A1, US2009234105A1, US2009263392A1, US2009274649A1, EP346087A2, WO0006605A2, WO02072635A2, WO04081051A1, WO06020258A2, WO2007044887A2, WO2007095338A2, WO2007137760A2, WO2008119353A1, WO2009021754A2, WO2009068630A1, WO9103493A1, WO9323537A1, WO9409131A1, WO9412625A2, WO9509917A1, WO9637621A2, WO9964460A1. Содержание вышеупомянутых заявок включено в данный документ посредством ссылки во всей своей полноте.

В других вариантах осуществления молекула антитела к CD73 (например, молекула моноспецифического, биспецифического или полиспецифического антитела) ковалентно связана, например слита, с другим партнером, например с белком, например одним, двумя или более цитокинами, например в виде слитой молекулы, например слитого белка.

"Слитый белок" и "слитый полипептид" относятся к полипептиду, имеющему по меньшей мере две части, ковалентно связанные друг с другом, где каждая из частей представляет собой полипептид, характеризующийся отличными свойствами. Свойство может представлять собой биологическое свойство, такое как активность in vitro или in vivo. Свойство также может представлять собой простое химическое или физическое свойство, такое как связывание с молекулой-мишенью, катализ реакции и т. д. Такие две части могут быть связаны непосредственно одной пептидной связью или с помощью пептидного линкера, но находятся в одной рамке считывания.

В настоящем изобретении предусмотрена выделенная молекула нуклеиновой кислоты, кодирующая любую из вышеупомянутых молекул антитела, векторы и их клетки-хозяева. Молекула нуклеиновой кислоты включает без ограничения РНК, геномную ДНК и кДНК.

Иллюстративные молекулы антител к CD73

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну антигенсвязывающую область, например вариабельную область или ее антигенсвязывающий фрагмент, из антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанных в таблице 1; или кодируемого нуклеотидной последовательностью из таблицы 1; или последовательностью по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две, три или четыре вариабельные области из антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанных в таблице 1; или кодируемого нуклеотидной последовательностью из таблицы 1; или последовательностью по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну или две вариабельные области тяжелой цепи из антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанных в таблице 1; или кодируемого нуклеотидной последовательностью из таблицы 1; или последовательностью по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну или две вариабельные области легкой цепи из антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанных в таблице 1; или кодируемого нуклеотидной последовательностью из таблицы 1; или последовательностью по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей.

В одном варианте осуществления молекула антитела к CD73 содержит константную область тяжелой цепи IgG4, например IgG4 человека. В другом варианте осуществления IgG4 человека содержит замену (например, замену Ser на Pro) в положении 228 по нумерации Eu. В еще одном варианте осуществления молекула антитела к CD73 содержит константную область тяжелой цепи IgG1, например IgG1 человека. В одном варианте осуществления IgG1 человека содержит замену (например, замену Asn на Ala) в положении 297 по нумерации Eu. В одном варианте осуществления IgG1 человека содержит замену (например, замену Asp на Ala) в положении 265 по нумерации Eu, замену (например, замену Pro на Ala) в положении 329 по нумерации Eu или и то, и другое. В одном варианте осуществления IgG1 человека содержит замену (например, замену Leu на Ala) в положении 234 по нумерации Eu, замену (например, замену Leu на Ala) в положении 235 по нумерации Eu или и то, и другое. В одном варианте осуществления константная область тяжелой цепи содержит аминокислотную последовательность, изложенную в таблице 3, или последовательность, по сути идентичную (например, характеризующуюся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) ей.

В еще одном варианте осуществления молекула антитела к CD73 содержит константную область легкой каппа-цепи, например константную область легкой каппа-цепи человека. В одном варианте осуществления константная область легкой цепи содержит аминокислотную последовательность, изложенную в таблице 3, или последовательность, по сути идентичную (например, характеризующуюся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) ей.

В другом варианте осуществления молекула антитела к CD73 содержит константную область тяжелой цепи IgG4, например IgG4 человека, и константную область легкой каппа-цепи, например константную область легкой каппа-цепи человека, например константную область тяжелой и легкой цепей, содержащую аминокислотную последовательность, изложенную в таблице 3, или последовательность, по сути идентичную (например, характеризующуюся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) ей. В еще другом варианте осуществления молекула антитела к CD73 содержит константную область тяжелой цепи IgG1, например IgG1 человека, и константную область легкой каппа-цепи, например константную область легкой каппа-цепи человека, например константную область тяжелой и легкой цепей, содержащую аминокислотную последовательность, изложенную в таблице 3, или последовательность, по сути идентичную (например, характеризующуюся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) ей. В одном варианте осуществления IgG1 человека содержит замену в положении 297 в соответствии с нумерацией Eu (например, замену Asn на Ala). В одном варианте осуществления IgG1 человека содержит замену в положении 265 в соответствии с нумерацией Eu, замену в положении 329 в соответствии с нумерацией Eu или обе (например, замену Asp на Ala в положении 265 и/или замену Pro на Ala в положении 329). В одном варианте осуществления IgG1 человека содержит замену в положении 234 в соответствии с нумерацией Eu, замену в положении 235 в соответствии с нумерацией Eu или обе (например, замену Leu на Ala в положении 234 и/или замену Leu на Ala в положении 235).

В другом варианте осуществления молекула антитела к CD73 содержит вариабельную область и константную область тяжелой цепи, вариабельную область и константную область легкой цепи, или и то, и другое, содержащие аминокислотную последовательность из 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанных в таблице 1; или кодируемых нуклеотидной последовательностью из таблицы 1; или последовательностью по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три определяющие комплементарность области (CDR) из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанных в таблице 1, или кодируемого нуклеотидной последовательностью из таблицы 1; или последовательностью по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три определяющие комплементарность области (CDR) из вариабельной области тяжелой цепи, содержащей аминокислотную последовательность, показанную в таблице 1, или кодируемую нуклеотидной последовательностью из таблицы 1. В одном варианте осуществления одна или несколько CDR (или в совокупности все CDR) имеют одно, два, три, четыре, пять или больше изменений, например аминокислотных замен, вставок или делеций по сравнению с аминокислотной последовательностью, показанной в таблице 1, или кодируемой нуклеотидной последовательностью, показанной в таблице 1. В определенных вариантах осуществления молекула антитела к CD73 содержит замену в CDR тяжелой цепи, например одну или несколько замен в CDR1, CDR2 и/или CDR3 тяжелой цепи.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три определяющие комплементарность области (CDR) из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1, или кодируемого нуклеотидной последовательностью из таблицы 1; или последовательностью по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR (или в совокупности все CDR) из вариабельной области легкой цепи, содержащей аминокислотную последовательность, показанную в таблице 1 или кодируемую нуклеотидной последовательностью, показанной в таблице 1. В некоторых вариантах осуществления одна или несколько CDR (или в совокупности все CDR) имеют одно, два, три, четыре, пять, шесть или больше изменений, например аминокислотных замен, вставок или делеций по сравнению с CDR, показанными в таблице 1, или кодируемыми нуклеотидной последовательностью, показанной в таблице 1. В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR (или в совокупности все CDR) из вариабельной области легкой цепи, содержащей аминокислотную последовательность, показанную в таблице 1 или кодируемую нуклеотидной последовательностью, показанной в таблице 1. В некоторых вариантах осуществления одна или несколько CDR (или в совокупности все CDR) имеют одно, два, три, четыре, пять, шесть или больше изменений, например аминокислотных замен, вставок или делеций по сравнению с CDR, показанными в таблице 1, или кодируемыми нуклеотидной последовательностью, показанной в таблице 1.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две, три, четыре, пять или шесть CDR (или в совокупности все CDR) из вариабельной области тяжелой и легкой цепи, содержащей аминокислотную последовательность, показанную в таблице 1 или кодируемую нуклеотидной последовательностью, показанной в таблице 1. В некоторых вариантах осуществления одна или несколько CDR (или в совокупности все CDR) имеют одно, два, три, четыре, пять, шесть или больше изменений, например аминокислотных замен, вставок или делеций по сравнению с CDR, показанными в таблице 1, или кодируемыми нуклеотидной последовательностью, показанной в таблице 1.

В определенных вариантах осуществления молекула антитела к CD73 содержит все шесть CDR из антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1, или кодируемого нуклеотидной последовательностью из таблицы 1, или близкородственные CDR, например CDR, которые являются идентичными или которые имеют по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен). В определенных вариантах осуществления молекула антитела к CD73 может содержать любую CDR, описанную в данном документе. В определенных вариантах осуществления молекула антитела к CD73 содержит замену в CDR тяжелой цепи, например одну или несколько замен в CDR1, CDR2 и/или CDR3 тяжелой цепи.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR в соответствии с Kabat et al. (например, по меньшей мере одну, две или три CDR в соответствии с нумерацией по Kabat, изложенных в таблице 1) из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1 или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя CDR в соответствии с Kabat et al., показанными в таблице 1.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR в соответствии с Kabat et al. (например, по меньшей мере одну, две или три CDR в соответствии с нумерацией по Kabat, изложенных в таблице 1) из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя CDR в соответствии с Kabat et al., показанными в таблице 1.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две, три, четыре, пять или шесть CDR в соответствии с Kabat et al. (например, по меньшей мере одну, две, три, четыре, пять или шесть CDR в соответствии с нумерацией по Kabat, изложенных в таблице 1) из вариабельных областей тяжелой и легкой цепей антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1 или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя, тремя, четырьмя, пятью или шестью CDR в соответствии с Kabat et al, показанными в таблице 1.

В некоторых вариантах осуществления молекула антитела к CD73 содержит все шесть CDR в соответствии с Kabat et al. (например, все шесть CDR в соответствии с нумерацией по Kabat, изложенных в таблице 1) из вариабельных областей тяжелой и легкой цепей антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1 или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению со всеми шестью CDR в соответствии с Kabat et al., показанными в таблице 1. В одном варианте осуществления молекула антитела к CD73 может содержать любую CDR, описанную в данном документе.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по Chothia (например, по меньшей мере одну, две или три гипервариабельные петли в соответствии с нумерацией по Chothia, изложенные в таблице 1) из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1, или кодируемого нуклеотидной последовательностью из таблицы 1; или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73; или которые имеют по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя гипервариабельными петлями по Chothia et al., показанными в таблице 1.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по Chothia (например, по меньшей мере одну, две или три гипервариабельные петли в соответствии с нумерацией по Chothia, изложенные в таблице 1) из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1, или кодируемого нуклеотидной последовательностью из таблицы 1; или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73; или которые имеют по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя гипервариабельными петлями по Chothia et al., показанными в таблице 1.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных петель (например, по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных петель в соответствии с нумерацией по Chothia, изложенные в таблице 1) из вариабельных областей тяжелой и легкой цепей антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398 или описанного в таблице 1, или кодируемого нуклеотидной последовательностью из таблицы 1; или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73; или которые имеют по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя, тремя, четырьмя, пятью или шестью гипервариабельными петлями по Chothia et al., показанными в таблице 1.

В некоторых вариантах осуществления молекула антитела к CD73 содержит все шесть гипервариабельных петель (например, все шесть гипервариабельных петель в соответствии с нумерацией по Chothia, изложенные в таблице 1) антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398;, или близкородственные гипервариабельные петли, например гипервариабельные петли, которые являются идентичными или которые имеют по меньше мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен); или которые имеют по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению со всеми шестью гипервариабельными петлями по Chothia et al., показанными в таблице 1. В одном варианте осуществления молекула антитела к CD73 может содержать любую гипервариабельную петлю, описанную в данном документе.

В еще одном варианте осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли, которые имеют те же канонические структуры, что и соответствующая гипервариабельная петля антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398,, например те же канонические структуры, что и по меньшей мере петля 1 и/или петля 2 вариабельных доменов тяжелой и/или легкой цепей антитела, описанного в данном документе. См., например, Chothia et al., (1992) J. Mol. Biol. 227:799-817; Tomlinson et al., (1992) J. Mol. Biol. 227:776-798 в отношении описаний канонических структур гипервариабельных петель. Эти структуры можно определить путем рассмотрения таблиц, описанных в данных ссылках.

В определенных вариантах осуществления молекула антитела к CD73 содержит комбинацию CDR или гипервариабельных петель, определенных в соответствии с Kabat et al. и Chothia et al.

В одном варианте осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR или гипервариабельные петли из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398,, в соответствии с нумерацией по Kabat и Chothia (например, по меньшей мере одну, две или три CDR или гипервариабельные петли в соответствии с нумерацией по Kabat и Chothia, изложенные в таблице 1); или кодируемые нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя CDR или гипервариабельными петлями по Kabat и/или Chothia, показанными в таблице 1.

В другом варианте осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR или гипервариабельные петли из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398, в соответствии с нумерацией по Kabat и Chothia (например, по меньшей мере одну, две или три CDR или гипервариабельные петли в соответствии с нумерацией по Kabat и Chothia, изложенные в таблице 1); или кодируемые нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя CDR или гипервариабельными петлями по Kabat и/или Chothia, показанными в таблице 1.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR по нумерации IMGT (например, по меньшей мере одну, две или три CDR по нумерации IMGT, изложенные в таблице 1) из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1 или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя CDR по нумерации IMGT, показанными в таблице 1.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три CDR по нумерации IMGT (например, по меньшей мере одну, две или три CDR по нумерации IMGT, изложенные в таблице 1) из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя или тремя CDR по нумерации IMGT, показанными в таблице 1.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две, три, четыре, пять или шесть CDR по нумерации IMGT (например, по меньшей мере одну, две, три, четыре, пять или шесть CDR по нумерации IMGT, изложенные в таблице 1) из вариабельных областей тяжелой и легкой цепей антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1 или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению с одной, двумя, тремя, четырьмя, пятью или шестью CDR по нумерации IMGT, показанными в таблице 1.

В некоторых вариантах осуществления молекула антитела к CD73 содержит все шесть CDR по нумерации IMGT (например, все шесть CDR по нумерации IMGT, изложенные в таблице 1) из вариабельных областей тяжелой и легкой цепей антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1; или кодируемого нуклеотидной последовательностью, показанной в таблице 1; или или последовательностью, по сути идентичной (например, характеризующейся по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности) любой из вышеупомянутых последовательностей; или которая имеет по меньшей мере одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, делеций или вставок, например консервативных замен) по сравнению со всеми шестью CDR по нумерации IMGT, показанными в таблице 1. В одном варианте осуществления молекула антитела к CD73 может содержать любую CDR, описанную в данном документе.

Молекула антитела к CD73 может содержать любую комбинацию CDR или гипервариабельных петель в соответствии с нумерацией по Kabat и Chothia.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по нумерации Chothia из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по нумерации Chothia из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по Kabat из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по Kabat из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по IMGT из вариабельной области тяжелой цепи антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73.

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли по IMGT из вариабельной области легкой цепи антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две, три, четыре, пять или шесть гипервариабельных петель из вариабельных областей тяжелой и легкой цепей антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из этих гипервариабельных петель, которые взаимодействуют с CD73.

В определенных вариантах осуществления молекула антитела к CD73 содержит все шесть гипервариабельных петель из вариабельных областей тяжелой и легкой цепей антитела, описанного в данном документе, например антитела из таблицы 1, или по меньшей мере аминокислоты из тех гипервариабельных петель, которые взаимодействуют с CD73, или близкородственных гипервариабельных петель, например гипервариабельных петель, которые являются идентичными или имеют, по меньшей мере, одно изменение аминокислоты, но не более двух, трех или четырех изменений (например, замен, например консервативных замен, делеций или вставок).

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три гипервариабельные петли, которые имеют те же канонические структуры, что и соответствующая гипервариабельная петля антитела, описанного в данном документе, например антитела из таблицы 1, например те же канонические структуры, что и по меньшей мере петля 1 и/или петля 2 вариабельных доменов тяжелой и/или легкой цепей антитела, описанного в данном документе. См., например, Chothia et al., (1992) J. Mol. Biol. 227:799-817; Tomlinson et al., (1992) J. Mol. Biol. 227:776-798 в отношении описаний канонических структур гипервариабельных петель. Эти структуры можно определить путем рассмотрения таблиц, описанных в данных литературных источниках. В варианте осуществления, например варианте осуществления, предусматривающем вариабельную область, CDR (например, CDR по Chothia, Kabat или IMGT) или другую последовательность, упоминаемую в данном документе, например в таблице 1, молекула антитела представляет собой молекулу моноспецифического антитела, молекулу биспецифического антитела или представляет собой молекулу антитела, которая содержит антигенсвязывающий фрагмент антитела, например полуантитело или антигенсвязывающий фрагмент полуантитела.

В некоторых вариантах осуществления вариабельный домен тяжелой или легкой цепей, или оба, молекулы антитела к CD73 содержат аминокислотную последовательность, которая является по сути идентичной аминокислотной последовательности, раскрытой в данном документе, например характеризуется по меньшей мере приблизительно 80%, 85%, 90%, 92%, 95%, 97%, 98%, или 99% идентичностью последовательности с вариабельной областью антитела, раскрытого в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398; или описанного в таблице 1, или кодируемого нуклеотидной последовательностью, описанной в таблице 1; или которая отличается по меньшей мере 1 или 5 остатками, но менее чем 40, 30, 20 или 10 остатками, от вариабельной области антитела, описанного в данном документе.

В определенных вариантах осуществления вариабельный домен тяжелой или легкой цепей или оба из молекулы антитела к CD73 содержат аминокислотную последовательность, кодируемую последовательностью нуклеиновой кислоты, описанной в данном документе, или нуклеиновой кислотой, которая гибридизируется с последовательностью нуклеиновой кислоты, описанной в данном документе (например, последовательностью нуклеиновой кислоты, показанной в таблице 1), или последовательностью, комплементарной ей, например, в условиях низкой жесткости, средней жесткости или высокой жесткости или других условиях гибридизации, описанных в данном документе.

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две, три или четыре антигенсвязывающие области, например вариабельные области, имеющие аминокислотную последовательность, изложенную в таблице 1, или последовательность, по сути идентичную ей (например последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней, или которая отличается на не более чем 1, 2, 5, 10 или 15 аминокислотных остатков от последовательностей, показанных в таблице 1). В определенных вариантах осуществления молекула антитела к CD73 содержит домен VH и/или VL, кодируемый нуклеиновой кислотой, имеющей нуклеотидную последовательность, которая кодирует антитело из таблицы 1, или последовательность, по сути идентичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней, или которая отличается на не более чем 3, 6, 15, 30 или 45 нуклеотидов от последовательностей, показанных в таблице 1).

В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три (например, все) CDR из вариабельной области тяжелой цепи, имеющей аминокислотную последовательность, изложенную в таблице 1, или последовательность, по сути гомологичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен). В некоторых вариантах осуществления молекула антитела к CD73 содержит меньшей мере одну, две или три (например, все) CDR из вариабельной области легкой цепи, имеющей аминокислотную последовательность, изложенную в таблице 1, или последовательность, по сути гомологичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен). В определенных вариантах осуществления молекула антитела к CD73 содержит меньшей мере одну, две, три, четыре, пять или шесть (например, все) CDR из вариабельных областей тяжелой и легкой цепей, имеющих аминокислотную последовательность, изложенную в таблице 1, или последовательность, по сути гомологичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен).

В некоторых вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три (например, все) CDR и/или гипервариабельные петли из вариабельной области тяжелой цепи, имеющей аминокислотную последовательность антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398,, в общем представленных в таблице 1, или последовательность, по сути идентичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99% идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен). В определенных вариантах осуществления молекула антитела к CD73 содержит по меньшей мере одну, две или три (например, все) CDR и/или гипервариабельные петли из вариабельной области легкой цепи, имеющей аминокислотную последовательность антитела, описанного в данном документе, например антитела, выбранного из антитела 918, 350, 356, 358, 930, 373, 374, 376, 377, 379, 363, 366, 407, 893, 939, 430, или 398,, совместно представленных в таблице 1, или последовательность, по сути идентичную ей (например, последовательность, характеризующуюся по меньшей мере приблизительно 85%, 90%, 95%, или 99%идентичностью последовательности с ней и/или содержащую одну, две, три или более замен, вставок или делеций, например консервативных замен). В некоторых вариантах осуществления молекула антитела к CD73 содержит все шесть CDR и/или гипервариабельных петель, описанных в данном документе, например, описанных в таблице 1.

В некоторых вариантах осуществления молекула антитела содержит вариабельную область, которая является идентичной по последовательности, или которая отличается на 1, 2, 3 или 4 аминокислоты от вариабельной области, описанной в данном документе (например, FR-области, раскрытой в данном документе).

В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность GGLYGSGSYLSDFDL VHCDR3 (SEQ ID NO: 37). В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность ESQESPYNNWFDP VHCDR3 (SEQ ID NO: 3).

В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 88, аминокислотную последовательность VHCDR2 под SEQ ID NO: 89 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50, каждая из которых раскрыта в таблице 2. В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 90, аминокислотную последовательность VHCDR2 под SEQ ID NO: 91 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16, каждая из которых раскрыта в таблице 2.

В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 122, аминокислотную последовательность VHCDR2 под SEQ ID NO: 123 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 51, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 53, каждая из которых раскрыта в таблице 2. В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 124, аминокислотную последовательность VHCDR2 под SEQ ID NO: 125 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 17, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 19, каждая из которых раскрыта в таблице 2.

В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 126, аминокислотную последовательность VHCDR2 под SEQ ID NO: 89 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50, каждая из которых раскрыта в таблице 2. В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 127, аминокислотную последовательность VHCDR2 под SEQ ID NO: 91 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16, каждая из которых раскрыта в таблице 2.

В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 128, аминокислотную последовательность VHCDR2 под SEQ ID NO: 129 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 54, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50, каждая из которых раскрыта в таблице 2. В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 130, аминокислотную последовательность VHCDR2 под SEQ ID NO: 131 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 20, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16, каждая из которых раскрыта в таблице 2.

В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 189, аминокислотную последовательность VHCDR2 под SEQ ID NO: 89 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50, каждая из которых раскрыта в таблице 2. В одном варианте осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи (VH), содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 196, аминокислотную последовательность VHCDR2 под SEQ ID NO: 91 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и вариабельную область легкой цепи (VL), содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16, каждая из которых раскрыта в таблице 2.

В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 72, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 38, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 137, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 61, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 4, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 163, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 39, аминокислотную последовательность VHCDR2 под SEQ ID NO: 40 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 51, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 53. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 73, аминокислотную последовательность VHCDR2 под SEQ ID NO: 74 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 51, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 53. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 82, аминокислотную последовательность VHCDR2 под SEQ ID NO: 74 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 51, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 53. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 138, аминокислотную последовательность VHCDR2 под SEQ ID NO: 139 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 51, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 53. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 147, аминокислотную последовательность VHCDR2 под SEQ ID NO: 148 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 51, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 53. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 155, аминокислотную последовательность VHCDR2 под SEQ ID NO: 156 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 51, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 53. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 62, аминокислотную последовательность VHCDR2 под SEQ ID NO: 63 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 17, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 19. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 27, аминокислотную последовательность VHCDR2 под SEQ ID NO: 28 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 17, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 19. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 5, аминокислотную последовательность VHCDR2 под SEQ ID NO: 6 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 17, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 19. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 164, аминокислотную последовательность VHCDR2 под SEQ ID NO: 165 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 17, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 19.

В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 35, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 70, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 81, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 135, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 145, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 153, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 37; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 59, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 25, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 1, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 161, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 3; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 41, аминокислотную последовательность VHCDR2 под SEQ ID NO: 42 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 54, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 75, аминокислотную последовательность VHCDR2 под SEQ ID NO: 76 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 54, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 83, аминокислотную последовательность VHCDR2 под SEQ ID NO: 76 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 54, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 140, аминокислотную последовательность VHCDR2 под SEQ ID NO: 141 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 54, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 149, аминокислотную последовательность VHCDR2 под SEQ ID NO: 150 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 54, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 157, аминокислотную последовательность VHCDR2 под SEQ ID NO: 158 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 54, аминокислотную последовательность VLCDR2 под SEQ ID NO: 52 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 64, аминокислотную последовательность VHCDR2 под SEQ ID NO: 65 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 20, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 29, аминокислотную последовательность VHCDR2 под SEQ ID NO: 30 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 20, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 7, аминокислотную последовательность VHCDR2 под SEQ ID NO: 8 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 20, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 166, аминокислотную последовательность VHCDR2 под SEQ ID NO: 167 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 20, аминокислотную последовательность VLCDR2 под SEQ ID NO: 18 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 190, аминокислотную последовательность VHCDR2 под SEQ ID NO: 36 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 191, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 192, аминокислотную последовательность VHCDR2 под SEQ ID NO: 71 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 193, аминокислотную последовательность VHCDR2 под SEQ ID NO: 136 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 194, аминокислотную последовательность VHCDR2 под SEQ ID NO: 146 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 195, аминокислотную последовательность VHCDR2 под SEQ ID NO: 154 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 43; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 48, аминокислотную последовательность VLCDR2 под SEQ ID NO: 49 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 50. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 197, аминокислотную последовательность VHCDR2 под SEQ ID NO: 60 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 198, аминокислотную последовательность VHCDR2 под SEQ ID NO: 26 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 199, аминокислотную последовательность VHCDR2 под SEQ ID NO: 2 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16. В одном варианте осуществления молекула антитела к CD73 содержит VH, содержащую аминокислотную последовательность VHCDR1 под SEQ ID NO: 200, аминокислотную последовательность VHCDR2 под SEQ ID NO: 162 и аминокислотную последовательность VHCDR3 под SEQ ID NO: 9; и VL, содержащую аминокислотную последовательность VLCDR1 под SEQ ID NO: 14, аминокислотную последовательность VLCDR2 под SEQ ID NO: 15 и аминокислотную последовательность VLCDR3 под SEQ ID NO: 16.

В других вариантах осуществления вышеупомянутые антитела содержат вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с любой из SEQ ID NO: 44, 77, 84, 142, 151 или 159. В других вариантах осуществления вышеупомянутые антитела содержат вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с любой из SEQ ID NO: 66, 31, 10 или 168.

В других вариантах осуществления вышеупомянутые антитела содержат вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с любой из SEQ ID NO: 55 или 21.

В других вариантах осуществления вышеупомянутые антитела содержат тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с любой из SEQ ID NO: 46, 79, 86, 114, 116 или 117. В других вариантах осуществления вышеупомянутые антитела содержат тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с любой из SEQ ID NO: 68, 33, 12, 115, 113 или 112.

В других вариантах осуществления вышеупомянутые антитела содержат легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с любой из SEQ ID NO: 57 или 23.

В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 44; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 55. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 77; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 55. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 84; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 55. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 142; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 55. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 151; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 55. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 159; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 55. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 66; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 21. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 31; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 21. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 10; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 21. В других вариантах осуществления молекула антитела содержит вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 168; и вариабельную область легкой цепи, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 21.

В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 46; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 57. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 79; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 57. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 86; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 57. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 114; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 57. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 116; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 57. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 117; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 57. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 68; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 23. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 33; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 23. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 12; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 23. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 115; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 23. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 113; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 23. В других вариантах осуществления молекула антитела содержит тяжелую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 112; и легкую цепь, содержащую аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с SEQ ID NO: 23.

В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 81, 201, 37, 205, 206 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 38, 201, 37, 205, 206 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 82, 202, 37, 208, 209 и 228 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 83, 203, 43, 229, 209 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 192, 201, 43, 205, 206 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VH и VL, содержащие аминокислотные последовательности под SEQ ID NO: 204 и 230 соответственно (или аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с ними).

В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 81, 231, 37, 205, 206 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 38, 231, 37, 205, 206 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 82, 232, 37, 208, 209 и 228 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 83, 233, 43, 229, 209 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 192, 231, 43, 205, 206 и 207 соответственно. В других вариантах осуществления молекула антитела содержит VH и VL, содержащие аминокислотные последовательности под SEQ ID NO: 234 и 230 соответственно (или аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с ними).

В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 235, 236, 237, 246, 15 и 247 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 238, 236, 237, 246, 15 и 247 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 239, 240, 237, 248, 18 и 249 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 241, 242, 243, 250, 18 и 247 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 244, 236, 243, 246, 15 и 247 соответственно. В других вариантах осуществления молекула антитела содержит VH и VL, содержащие аминокислотные последовательности под SEQ ID NO: 245 и 251 соответственно (или аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с ними).

В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 252, 253, 254, 262, 263 и 264 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 255, 253, 254, 262, 263 и 264 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 155, 256, 254, 265, 266 и 267 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 257, 258, 259, 268, 266 и 264 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 260, 253, 259, 262, 263 и 264 соответственно. В других вариантах осуществления молекула антитела содержит VH и VL, содержащие аминокислотные последовательности под SEQ ID NO: 261 и 269 соответственно (или аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с ними).

В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 287, 288, 289, 298, 49 и 299 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 290, 288, 289, 298, 49 и 299 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 291, 292, 289, 300, 52 и 301 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 293, 294, 295, 302, 52 и 299 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 296, 288, 295, 298, 49 и 299 соответственно. В других вариантах осуществления молекула антитела содержит VH и VL, содержащие аминокислотные последовательности под SEQ ID NO: 297 и 303 соответственно (или аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с ними).

В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 304, 305, 306, 14, 15 и 314 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 61, 305, 306, 14, 15 и 314 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 307, 308, 306, 17, 18 и 315 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 309, 310, 311, 20, 18 и 314 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 312, 305, 311, 14, 15 и 314 соответственно. В других вариантах осуществления молекула антитела содержит VH и VL, содержащие аминокислотные последовательности под SEQ ID NO: 313 и 316 соответственно (или аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с ними).

В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 317, 318, 319, 14, 15 и 328 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 320, 318, 319, 14, 15 и 328 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 321, 322, 319, 17, 18 и 329 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 323, 324, 325, 20, 18 и 328 соответственно. В других вариантах осуществления молекула антитела содержит VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2 и VLCDR3, содержащие аминокислотные последовательности под SEQ ID NO: 326, 318, 325, 14, 15 и 328 соответственно. В других вариантах осуществления молекула антитела содержит VH и VL, содержащие аминокислотные последовательности под SEQ ID NO: 327 и 330 соответственно (или аминокислотную последовательность, характеризующуюся по меньшей мере 85% (например, по меньшей мере 90%, 95%, 97%, 98%, 99%, или 100%) идентичностью последовательности с ними).

В других вариантах осуществления вышеупомянутые молекулы антител выбраны из полноразмерного антитела, биспецифического антитела, Fab, F(ab')2, Fv или одноцепочечного фрагмента Fv (scFv).

В других вариантах осуществления вышеупомянутые молекулы антител содержат константную область тяжелой цепи, выбранную из IgG1, IgG2, IgG3 и IgG4.

В других вариантах осуществления вышеупомянутые молекулы антител содержат константную область легкой цепи, выбранную из константных областей легкой каппа-или лямбда-цепи.

В некоторых вариантах осуществления молекула антитела к CD73 содержит вариабельную область тяжелой цепи, вариабельную область легкой цепи, константную область тяжелой цепи и/или константную область легкой цепи, раскрытые в таблице 1. В некоторых вариантах осуществления молекула антитела к CD73 содержит константную область тяжелой цепи и/или константную область легкой цепи, раскрытые в таблице 3. В некоторых вариантах осуществления молекула антитела к CD73 содержит константную область тяжелой цепи, содержащую аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 92-103, 119 и 120. В некоторых вариантах осуществления молекула антитела к CD73 содержит константную область легкой цепи, содержащую аминокислотную последовательность под SEQ ID NO: 104.

Иллюстративные последовательности антител к CD73 описаны в таблицах 1 и 2 ниже.

Таблица 1. Аминокислотные и нуклеотидные последовательности для иллюстративных антител к CD73.

358
SEQ ID NO: 1 (объединенная) HCDR1 GGSISGRYWS
SEQ ID NO: 2 (объединенная) HCDR2 YIYGTGSTNYNPSLKS
SEQ ID NO: 3 (объединенная) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 4 (Kabat) HCDR1 GRYWS
SEQ ID NO: 2 (Kabat) HCDR2 YIYGTGSTNYNPSLKS
SEQ ID NO: 3 (Kabat) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 5 (Chothia) HCDR1 GGSISGR
SEQ ID NO: 6 (Chothia) HCDR2 YGTGS
SEQ ID NO: 3 (Chothia) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 7 (IMGT) HCDR1 GGSISGRY
SEQ ID NO: 8 (IMGT) HCDR2 IYGTGST
SEQ ID NO: 9 (IMGT) HCDR3 ARESQESPYNNWFDP
SEQ ID NO: 199 (альтернативная) HCDR1 GSISGRYWS
SEQ ID NO: 2 (альтернативная) HCDR2 YIYGTGSTNYNPSLKS
SEQ ID NO: 9 (альтернативная) HCDR3 ARESQESPYNNWFDP
SEQ ID NO: 10 VH QVQLQESGPGLVKPSETLSLTCTVSGGSISGRYWSWIRQPPGKGLEWIGYIYGTGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSS
SEQ ID NO: 11 ДНК, кодирующая VH CAAGTGCAGCTGCAGGAATCTGGCCCTGGCCTGGTCAAGCCCTCCGAGACACTGTCCCTGACCTGCACCGTGTCCGGCGGCTCCATCTCCGGCCGGTACTGGTCTTGGATCCGGCAGCCTCCCGGCAAGGGCCTGGAATGGATCGGCTACATCTACGGCACCGGCTCCACCAACTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCCGTGACCGCCGCTGACACCGCCGTGTACTACTGCGCCAGAGAGTCCCAGGAATCCCCTTACAACAATTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
SEQ ID NO: 12 Тяжелая цепь 358.A QVQLQESGPGLVKPSETLSLTCTVSGGSISGRYWSWIRQPPGKGLEWIGYIYGTGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует.
SEQ ID NO: 13 ДНК, кодирующая тяжелую цепь 358.A CAAGTGCAGCTGCAGGAATCTGGCCCTGGCCTGGTCAAGCCCTCCGAGACACTGTCCCTGACCTGCACCGTGTCCGGCGGCTCCATCTCCGGCCGGTACTGGTCTTGGATCCGGCAGCCTCCCGGCAAGGGCCTGGAATGGATCGGCTACATCTACGGCACCGGCTCCACCAACTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCCGTGACCGCCGCTGACACCGCCGTGTACTACTGCGCCAGAGAGTCCCAGGAATCCCCTTACAACAATTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCTTCCACCAAGGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCAGCGTCGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAAGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTCCTTGCCCTGCCCCTGAGTTCCTGGGCGGACCTTCCGTGTTCCTGTTCCCTCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCTGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAAGTCCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAAGTGTCCAACAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCCCAAGTGTACACCCTGCCTCCCAGCCAGGAAGAGATGACCAAGAATCAAGTGTCCCTGACTTGTCTGGTCAAGGGCTTCTACCCCTCCGATATCGCCGTGGAGTGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCTCGGCTGACCGTGGACAAGTCCCGGTGGCAGGAAGGCAACGTCTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCTCTGGGCX1X2X3,
где X1 представляет собой A, X2 представляет собой A, и X3 представляет собой G; или X1 отсутствует, X2 отсутствует и X3 отсутствует.
SEQ ID NO: 112 Тяжелая цепь 358.B QVQLQESGPGLVKPSETLSLTCTVSGGSISGRYWSWIRQPPGKGLEWIGYIYGTGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 14 (объединенная) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (объединенная) LCDR2 AASSLQS
SEQ ID NO: 16 (объединенная) LCDR3 QQGNSFPRT
SEQ ID NO: 14 (Kabat) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (Kabat) LCDR2 AASSLQS
SEQ ID NO: 16 (Kabat) LCDR3 QQGNSFPRT
SEQ ID NO: 17 (Chothia) LCDR1 SQGISSW
SEQ ID NO: 18 (Chothia) LCDR2 AAS
SEQ ID NO: 19 (Chothia) LCDR3 GNSFPR
SEQ ID NO: 20 (IMGT) LCDR1 QGISSW
SEQ ID NO: 18 (IMGT) LCDR2 AAS
SEQ ID NO: 16 (IMGT) LCDR3 QQGNSFPRT
SEQ ID NO: 14 (альтернативная) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (альтернативная) LCDR2 AASSLQS
SEQ ID NO: 16 (альтернативная) LCDR3 QQGNSFPRT
SEQ ID NO: 21 VL DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGNSFPRTFGGGTKVEIK
SEQ ID NO: 22 ДНК, кодирующая VL GACATCCAGATGACCCAGAGCCCCTCCTCCGTGTCCGCCTCCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCTCCCAGGGCATCTCCAGCTGGCTGGCCTGGTATCAGCAGAAGCCCGGCAAGGCCCCTAAGCTGCTGATCTACGCCGCCTCCAGCCTGCAGTCCGGCGTGCCCTCCAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCAACTCCTTCCCTCGGACCTTCGGCGGAGGCACCAAAGTGGAAATCAAG
SEQ ID NO: 23 Легкая цепь DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGNSFPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO: 24 ДНК, кодирующая легкую цепь GACATCCAGATGACCCAGAGCCCCTCCTCCGTGTCCGCCTCCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCTCCCAGGGCATCTCCAGCTGGCTGGCCTGGTATCAGCAGAAGCCCGGCAAGGCCCCTAAGCTGCTGATCTACGCCGCCTCCAGCCTGCAGTCCGGCGTGCCCTCCAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCAACTCCTTCCCTCGGACCTTCGGCGGAGGCACCAAAGTGGAAATCAAGCGTACGGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTGCCTGCTGAACAACTTCTACCCTCGCGAGGCCAAAGTGCAGTGGAAAGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC
356
SEQ ID NO: 25 (объединенная) HCDR1 GGSIEGRYWS
SEQ ID NO: 26 (объединенная) HCDR2 YIYGSGSTKYNPSLKS
SEQ ID NO: 3 (объединенная) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 4 (Kabat) HCDR1 GRYWS
SEQ ID NO: 26 (Kabat) HCDR2 YIYGSGSTKYNPSLKS
SEQ ID NO: 3 (Kabat) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 27 (Chothia) HCDR1 GGSIEGR
SEQ ID NO: 28 (Chothia) HCDR2 YGSGS
SEQ ID NO: 3 (Chothia) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 29 (IMGT) HCDR1 GGSIEGRY
SEQ ID NO: 30 (IMGT) HCDR2 IYGSGST
SEQ ID NO: 9 (IMGT) HCDR3 ARESQESPYNNWFDP
SEQ ID NO: 198 (альтернативная) HCDR1 GSIEGRYWS
SEQ ID NO: 26 (альтернативная) HCDR2 YIYGSGSTKYNPSLKS
SEQ ID NO: 9 (альтернативная) HCDR3 ARESQESPYNNWFDP
SEQ ID NO: 31 VH QVQLQESGPGLVKPSETLSLTCTVSGGSIEGRYWSWIRQPPGKGLEWIGYIYGSGSTKYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSS
SEQ ID NO: 32 ДНК, кодирующая VH CAAGTGCAGCTGCAGGAATCTGGCCCTGGCCTGGTCAAGCCCTCCGAGACACTGTCCCTGACCTGCACCGTGTCCGGCGGCTCTATCGAGGGCCGGTACTGGTCCTGGATCCGGCAGCCTCCTGGCAAGGGCCTGGAATGGATCGGCTACATCTACGGCTCCGGCTCCACCAAGTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCCGTGACCGCCGCTGACACCGCCGTGTACTACTGCGCCAGAGAGTCCCAGGAATCCCCTTACAACAATTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
SEQ ID NO: 33 Тяжелая цепь 356.A QVQLQESGPGLVKPSETLSLTCTVSGGSIEGRYWSWIRQPPGKGLEWIGYIYGSGSTKYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 34 ДНК, кодирующая тяжелую цепь 356.A CAAGTGCAGCTGCAGGAATCTGGCCCTGGCCTGGTCAAGCCCTCCGAGACACTGTCCCTGACCTGCACCGTGTCCGGCGGCTCTATCGAGGGCCGGTACTGGTCCTGGATCCGGCAGCCTCCTGGCAAGGGCCTGGAATGGATCGGCTACATCTACGGCTCCGGCTCCACCAAGTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCCGTGACCGCCGCTGACACCGCCGTGTACTACTGCGCCAGAGAGTCCCAGGAATCCCCTTACAACAATTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCCTCCACCAAGGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCAGCGTCGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAAGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTCCTTGCCCTGCCCCTGAGTTCCTGGGCGGACCTTCCGTGTTCCTGTTCCCTCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCTGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAAGTCCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAAGTGTCCAACAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCCCAAGTGTACACCCTGCCTCCCAGCCAGGAAGAGATGACCAAGAATCAAGTGTCCCTGACTTGTCTGGTCAAGGGCTTCTACCCCTCCGATATCGCCGTGGAGTGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCTCGGCTGACCGTGGACAAGTCCCGGTGGCAGGAAGGCAACGTCTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCTCTGGGC X1X2X3,
где X1 представляет собой A, X2 представляет собой A, и X3 представляет собой G; или X1 отсутствует, X2 отсутствует и X3 отсутствует.
SEQ ID NO: 113 Тяжелая цепь 356.B QVQLQESGPGLVKPSETLSLTCTVSGGSIEGRYWSWIRQPPGKGLEWIGYIYGSGSTKYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 14 (объединенная) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (объединенная) LCDR2 AASSLQS
SEQ ID NO: 16 (объединенная) LCDR3 QQGNSFPRT
SEQ ID NO: 14 (Kabat) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (Kabat) LCDR2 AASSLQS
SEQ ID NO: 16 (Kabat) LCDR3 QQGNSFPRT
SEQ ID NO: 17 (Chothia) LCDR1 SQGISSW
SEQ ID NO: 18 (Chothia) LCDR2 AAS
SEQ ID NO: 19 (Chothia) LCDR3 GNSFPR
SEQ ID NO: 20 (IMGT) LCDR1 QGISSW
SEQ ID NO: 18 (IMGT) LCDR2 AAS
SEQ ID NO: 16 (IMGT) LCDR3 QQGNSFPRT
SEQ ID NO: 14 (альтернативная) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (альтернативная) LCDR2 AASSLQS
SEQ ID NO: 16 (альтернативная) LCDR3 QQGNSFPRT
SEQ ID NO: 21 VL DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGNSFPRTFGGGTKVEIK
SEQ ID NO: 22 ДНК, кодирующая VL GACATCCAGATGACCCAGAGCCCCTCCTCCGTGTCCGCCTCCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCTCCCAGGGCATCTCCAGCTGGCTGGCCTGGTATCAGCAGAAGCCCGGCAAGGCCCCTAAGCTGCTGATCTACGCCGCCTCCAGCCTGCAGTCCGGCGTGCCCTCCAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCAACTCCTTCCCTCGGACCTTCGGCGGAGGCACCAAAGTGGAAATCAAG
SEQ ID NO: 23 Легкая цепь DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGNSFPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO: 24 ДНК, кодирующая легкую цепь GACATCCAGATGACCCAGAGCCCCTCCTCCGTGTCCGCCTCCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCTCCCAGGGCATCTCCAGCTGGCTGGCCTGGTATCAGCAGAAGCCCGGCAAGGCCCCTAAGCTGCTGATCTACGCCGCCTCCAGCCTGCAGTCCGGCGTGCCCTCCAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCAACTCCTTCCCTCGGACCTTCGGCGGAGGCACCAAAGTGGAAATCAAGCGTACGGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTGCCTGCTGAACAACTTCTACCCTCGCGAGGCCAAAGTGCAGTGGAAAGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC
373
SEQ ID NO: 35 (объединенная) HCDR1 GFTFHRYAMS
SEQ ID NO: 36 (объединенная) HCDR2 AISGSGMNTYYADSVKG
SEQ ID NO: 37 (объединенная) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 38 (Kabat) HCDR1 RYAMS
SEQ ID NO: 36 (Kabat) HCDR2 AISGSGMNTYYADSVKG
SEQ ID NO: 37 (Kabat) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 39 (Chothia) HCDR1 GFTFHRY
SEQ ID NO: 40 (Chothia) HCDR2 SGSGMN
SEQ ID NO: 37 (Chothia) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 41 (IMGT) HCDR1 GFTFHRYA
SEQ ID NO: 42 (IMGT) HCDR2 ISGSGMNT
SEQ ID NO: 43 (IMGT) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 190 (альтернативная) HCDR1 FTFHRYAMS
SEQ ID NO: 36 (альтернативная) HCDR2 AISGSGMNTYYADSVKG
SEQ ID NO: 43 (альтернативная) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 44 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFHRYAMSWVRQAPGKGLEWVSAISGSGMNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSS
SEQ ID NO: 45 ДНК, кодирующая VH GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCCTGGCGGCTCCCTGAGACTGTCTTGCGCCGCCTCCGGCTTCACCTTCCACAGATACGCCATGTCCTGGGTCCGACAGGCCCCTGGCAAGGGCCTGGAGTGGGTGTCCGCCATCTCCGGCTCCGGCATGAACACCTACTACGCCGACTCCGTGAAGGGCCGGTTCACCATCTCCCGGGACAACTCCAAGAACACCCTGTACCTGCAGATGAACTCCCTGCGGGCCGAGGACACCGCCGTGTACTACTGTGCCAGAGGCGGCCTGTACGGCTCCGGCTCCTACCTGTCCGACTTCGACCTGTGGGGCAGAGGCACCCTGGTCACCGTGTCCTCC
SEQ ID NO: 46 Тяжелая цепь 373.A EVQLLESGGGLVQPGGSLRLSCAASGFTFHRYAMSWVRQAPGKGLEWVSAISGSGMNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 47 ДНК, кодирующая тяжелую цепь 373.A GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCCTGGCGGCTCCCTGAGACTGTCTTGCGCCGCCTCCGGCTTCACCTTCCACAGATACGCCATGTCCTGGGTCCGACAGGCCCCTGGCAAGGGCCTGGAGTGGGTGTCCGCCATCTCCGGCTCCGGCATGAACACCTACTACGCCGACTCCGTGAAGGGCCGGTTCACCATCTCCCGGGACAACTCCAAGAACACCCTGTACCTGCAGATGAACTCCCTGCGGGCCGAGGACACCGCCGTGTACTACTGTGCCAGAGGCGGCCTGTACGGCTCCGGCTCCTACCTGTCCGACTTCGACCTGTGGGGCAGAGGCACCCTGGTCACCGTGTCCTCCGCCTCCACAAAGGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCAGCGTCGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAAGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTCCTTGCCCTGCCCCTGAGTTCCTGGGCGGACCTTCCGTGTTCCTGTTCCCTCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCTGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAAGTCCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAAGTGTCCAACAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCCCAAGTGTACACCCTGCCTCCCAGCCAGGAAGAGATGACCAAGAATCAAGTGTCCCTGACTTGTCTGGTCAAGGGCTTCTACCCCTCCGATATCGCCGTGGAGTGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCTCGGCTGACCGTGGACAAGTCCCGGTGGCAGGAAGGCAACGTCTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCTCTGGGC X1X2X3,
где X1 представляет собой A, X2 представляет собой A, и X3 представляет собой G; или X1 отсутствует, X2 отсутствует и X3 отсутствует.
SEQ ID NO: 114 Тяжелая цепь 373.B EVQLLESGGGLVQPGGSLRLSCAASGFTFHRYAMSWVRQAPGKGLEWVSAISGSGMNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 48 (объединенная) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (объединенная) LCDR2 GASTRAT
SEQ ID NO: 50 (объединенная) LCDR3 QQHNAFPYT
SEQ ID NO: 48 (Kabat) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (Kabat) LCDR2 GASTRAT
SEQ ID NO: 50 (Kabat) LCDR3 QQHNAFPYT
SEQ ID NO: 51 (Chothia) LCDR1 SQSVGSN
SEQ ID NO: 52 (Chothia) LCDR2 GAS
SEQ ID NO: 53 (Chothia) LCDR3 HNAFPY
SEQ ID NO: 54 (IMGT) LCDR1 QSVGSN
SEQ ID NO: 52 (IMGT) LCDR2 GAS
SEQ ID NO: 50 (IMGT) LCDR3 QQHNAFPYT
SEQ ID NO: 48 (альтернативная) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (альтернативная) LCDR2 GASTRAT
SEQ ID NO: 50 (альтернативная) LCDR3 QQHNAFPYT
SEQ ID NO: 55 VL EIVLTQSPATLSVSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQHNAFPYTFGGGTKVEIK
SEQ ID NO: 56 ДНК, кодирующая VL GAGATCGTGCTGACACAGTCCCCTGCCACCCTGTCTGTGTCTCCCGGCGAGAGAGCCACCCTGAGCTGCAGAGCCTCCCAGTCCGTGGGCTCCAACCTGGCCTGGTATCAGCAGAAGCCCGGCCAGGCCCCTCGGCTGCTGATCTACGGCGCCTCTACCAGAGCCACCGGCATCCCTGCCAGATTCTCCGGCTCTGGCTCCGGCACCGAGTTCACCCTGACCATCTCCAGCCTGCAGTCCGAGGACTTCGCCGTGTACTACTGCCAGCAGCACAACGCCTTCCCTTACACCTTCGGCGGAGGCACCAAAGTGGAAATCAAG
SEQ ID NO: 57 Легкая цепь EIVLTQSPATLSVSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQHNAFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO: 58 ДНК, кодирующая легкую цепь GAGATCGTGCTGACACAGTCCCCTGCCACCCTGTCTGTGTCTCCCGGCGAGAGAGCCACCCTGAGCTGCAGAGCCTCCCAGTCCGTGGGCTCCAACCTGGCCTGGTATCAGCAGAAGCCCGGCCAGGCCCCTCGGCTGCTGATCTACGGCGCCTCTACCAGAGCCACCGGCATCCCTGCCAGATTCTCCGGCTCTGGCTCCGGCACCGAGTTCACCCTGACCATCTCCAGCCTGCAGTCCGAGGACTTCGCCGTGTACTACTGCCAGCAGCACAACGCCTTCCCTTACACCTTCGGCGGAGGCACCAAAGTGGAAATCAAGCGTACGGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTGCCTGCTGAACAACTTCTACCCTCGCGAGGCCAAAGTGCAGTGGAAAGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC
350
SEQ ID NO: 59 (объединенная) HCDR1 GGSIERYYWS
SEQ ID NO: 60 (объединенная) HCDR2 YIYGRGSTNYNPSLKS
SEQ ID NO: 3 (объединенная) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 61 (Kabat) HCDR1 RYYWS
SEQ ID NO: 60 (Kabat) HCDR2 YIYGRGSTNYNPSLKS
SEQ ID NO: 3 (Kabat) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 62 (Chothia) HCDR1 GGSIERY
SEQ ID NO: 63 (Chothia) HCDR2 YGRGS
SEQ ID NO: 3 (Chothia) HCDR3 ESQESPYNNWFDP
SEQ ID NO: 64 (IMGT) HCDR1 GGSIERYY
SEQ ID NO: 65 (IMGT) HCDR2 IYGRGST
SEQ ID NO: 9 (IMGT) HCDR3 ARESQESPYNNWFDP
SEQ ID NO: 197 (альтернативная) HCDR1 GSIERYYWS
SEQ ID NO: 60 (альтернативная) HCDR2 YIYGRGSTNYNPSLKS
SEQ ID NO: 9 (альтернативная) HCDR3 ARESQESPYNNWFDP
SEQ ID NO: 66 VH QVQLQESGPGLVKPSETLSLTCTVSGGSIERYYWSWIRQPPGKGLEWIGYIYGRGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSS
SEQ ID NO: 67 ДНК, кодирующая VH CAAGTGCAGCTGCAGGAATCTGGCCCTGGCCTGGTCAAGCCCTCCGAGACACTGTCCCTGACCTGCACCGTGTCCGGCGGCTCCATCGAGCGGTACTACTGGTCCTGGATCCGGCAGCCTCCCGGCAAGGGCCTGGAATGGATCGGCTACATCTACGGCAGAGGCTCCACCAACTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCCGTGACCGCCGCTGACACCGCCGTGTACTACTGCGCCAGAGAGTCCCAGGAATCCCCTTACAACAATTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT
SEQ ID NO: 68 Тяжелая цепь 350.A QVQLQESGPGLVKPSETLSLTCTVSGGSIERYYWSWIRQPPGKGLEWIGYIYGRGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 69 ДНК, кодирующая тяжелую цепь 350.A CAAGTGCAGCTGCAGGAATCTGGCCCTGGCCTGGTCAAGCCCTCCGAGACACTGTCCCTGACCTGCACCGTGTCCGGCGGCTCCATCGAGCGGTACTACTGGTCCTGGATCCGGCAGCCTCCCGGCAAGGGCCTGGAATGGATCGGCTACATCTACGGCAGAGGCTCCACCAACTACAACCCCAGCCTGAAGTCCAGAGTGACCATCTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAGCTGTCCTCCGTGACCGCCGCTGACACCGCCGTGTACTACTGCGCCAGAGAGTCCCAGGAATCCCCTTACAACAATTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCTGCCTCCACCAAGGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCAGCGTCGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAAGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTCCTTGCCCTGCCCCTGAGTTCCTGGGCGGACCTTCCGTGTTCCTGTTCCCTCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCTGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAAGTCCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAAGTGTCCAACAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCCCAAGTGTACACCCTGCCTCCCAGCCAGGAAGAGATGACCAAGAATCAAGTGTCCCTGACTTGTCTGGTCAAGGGCTTCTACCCCTCCGATATCGCCGTGGAGTGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCTCGGCTGACCGTGGACAAGTCCCGGTGGCAGGAAGGCAACGTCTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCTCTGGGC X1X2X3,
где X1 представляет собой A, X2 представляет собой A, и X3 представляет собой G; или X1 отсутствует, X2 отсутствует и X3 отсутствует.
SEQ ID NO: 115 Тяжелая цепь 350.B QVQLQESGPGLVKPSETLSLTCTVSGGSIERYYWSWIRQPPGKGLEWIGYIYGRGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 331 Тяжелая цепь 350 Fab QVQLQESGPGLVKPSETLSLTCTVSGGSIERYYWSWIRQPPGKGLEWIGYIYGRGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARESQESPYNNWFDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGP
SEQ ID NO: 14 (объединенная) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (объединенная) LCDR2 AASSLQS
SEQ ID NO: 16 (объединенная) LCDR3 QQGNSFPRT
SEQ ID NO: 14 (Kabat) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (Kabat) LCDR2 AASSLQS
SEQ ID NO: 16 (Kabat) LCDR3 QQGNSFPRT
SEQ ID NO: 17 (Chothia) LCDR1 SQGISSW
SEQ ID NO: 18 (Chothia) LCDR2 AAS
SEQ ID NO: 19 (Chothia) LCDR3 GNSFPR
SEQ ID NO: 20 (IMGT) LCDR1 QGISSW
SEQ ID NO: 18 (IMGT) LCDR2 AAS
SEQ ID NO: 16 (IMGT) LCDR3 QQGNSFPRT
SEQ ID NO: 14 (альтернативная) LCDR1 RASQGISSWLA
SEQ ID NO: 15 (альтернативная) LCDR2 AASSLQS
SEQ ID NO: 16 (альтернативная) LCDR3 QQGNSFPRT
SEQ ID NO: 21 VL DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGNSFPRTFGGGTKVEIK
SEQ ID NO: 22 ДНК, кодирующая VL GACATCCAGATGACCCAGAGCCCCTCCTCCGTGTCCGCCTCCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCTCCCAGGGCATCTCCAGCTGGCTGGCCTGGTATCAGCAGAAGCCCGGCAAGGCCCCTAAGCTGCTGATCTACGCCGCCTCCAGCCTGCAGTCCGGCGTGCCCTCCAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCAACTCCTTCCCTCGGACCTTCGGCGGAGGCACCAAAGTGGAAATCAAG
SEQ ID NO: 23 Легкая цепь DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGNSFPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO: 24 ДНК, кодирующая легкую цепь GACATCCAGATGACCCAGAGCCCCTCCTCCGTGTCCGCCTCCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCTCCCAGGGCATCTCCAGCTGGCTGGCCTGGTATCAGCAGAAGCCCGGCAAGGCCCCTAAGCTGCTGATCTACGCCGCCTCCAGCCTGCAGTCCGGCGTGCCCTCCAGATTCTCCGGCTCTGGCTCCGGCACCGACTTCACCCTGACCATCAGCTCCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCAGCAGGGCAACTCCTTCCCTCGGACCTTCGGCGGAGGCACCAAAGTGGAAATCAAGCGTACGGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTGCCTGCTGAACAACTTCTACCCTCGCGAGGCCAAAGTGCAGTGGAAAGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC
374
SEQ ID NO: 70 (объединенная) HCDR1 GFTFSYNAMS
SEQ ID NO: 71 (объединенная) HCDR2 SISGTGGSTYYADSVKG
SEQ ID NO: 37 (объединенная) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 72 (Kabat) HCDR1 YNAMS
SEQ ID NO: 71 (Kabat) HCDR2 SISGTGGSTYYADSVKG
SEQ ID NO: 37 (Kabat) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 73 (Chothia) HCDR1 GFTFSYN
SEQ ID NO: 74 (Chothia) HCDR2 SGTGGS
SEQ ID NO: 37 (Chothia) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 75 (IMGT) HCDR1 GFTFSYNA
SEQ ID NO: 76 (IMGT) HCDR2 ISGTGGST
SEQ ID NO: 43 (IMGT) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 191 (альтернативная) HCDR1 FTFSYNAMS
SEQ ID NO: 71 (альтернативная) HCDR2 SISGTGGSTYYADSVKG
SEQ ID NO: 43 (альтернативная) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 77 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSYNAMSWVRQAPGKGLEWVSSISGTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSS
SEQ ID NO: 78 ДНК, кодирующая VH GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCCTGGCGGCTCCCTGAGACTGTCTTGCGCCGCCTCCGGCTTCACCTTCTCCTACAACGCCATGTCCTGGGTCCGACAGGCCCCTGGCAAGGGCCTGGAGTGGGTGTCCTCCATCTCCGGCACCGGCGGCTCCACCTACTACGCCGACTCTGTGAAGGGCCGGTTCACCATCTCCCGGGACAACTCCAAGAACACCCTGTACCTGCAGATGAACTCCCTGCGGGCCGAGGACACCGCCGTGTACTACTGTGCCAGAGGCGGCCTGTACGGCTCCGGCTCCTACCTGTCCGACTTCGACCTGTGGGGCAGAGGCACCCTGGTCACCGTGTCCTCC
SEQ ID NO: 79 Тяжелая цепь 374.A EVQLLESGGGLVQPGGSLRLSCAASGFTFSYNAMSWVRQAPGKGLEWVSSISGTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 80 ДНК, кодирующая тяжелую цепь 374.A GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCCTGGCGGCTCCCTGAGACTGTCTTGCGCCGCCTCCGGCTTCACCTTCTCCTACAACGCCATGTCCTGGGTCCGACAGGCCCCTGGCAAGGGCCTGGAGTGGGTGTCCTCCATCTCCGGCACCGGCGGCTCCACCTACTACGCCGACTCTGTGAAGGGCCGGTTCACCATCTCCCGGGACAACTCCAAGAACACCCTGTACCTGCAGATGAACTCCCTGCGGGCCGAGGACACCGCCGTGTACTACTGTGCCAGAGGCGGCCTGTACGGCTCCGGCTCCTACCTGTCCGACTTCGACCTGTGGGGCAGAGGCACCCTGGTCACCGTGTCCTCCGCCTCCACAAAGGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCAGCGTCGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAAGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTCCTTGCCCTGCCCCTGAGTTCCTGGGCGGACCTTCCGTGTTCCTGTTCCCTCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCTGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAAGTCCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAAGTGTCCAACAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCCCAAGTGTACACCCTGCCTCCCAGCCAGGAAGAGATGACCAAGAATCAAGTGTCCCTGACTTGTCTGGTCAAGGGCTTCTACCCCTCCGATATCGCCGTGGAGTGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCTCGGCTGACCGTGGACAAGTCCCGGTGGCAGGAAGGCAACGTCTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCTCTGGGC X1X2X3,
где X1 представляет собой A, X2 представляет собой A, и X3 представляет собой G; или X1 отсутствует, X2 отсутствует и X3 отсутствует.
SEQ ID NO: 116 Тяжелая цепь 374.B EVQLLESGGGLVQPGGSLRLSCAASGFTFSYNAMSWVRQAPGKGLEWVSSISGTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 48 (объединенная) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (объединенная) LCDR2 GASTRAT
SEQ ID NO: 50 (объединенная) LCDR3 QQHNAFPYT
SEQ ID NO: 48 (Kabat) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (Kabat) LCDR2 GASTRAT
SEQ ID NO: 50 (Kabat) LCDR3 QQHNAFPYT
SEQ ID NO: 51 (Chothia) LCDR1 SQSVGSN
SEQ ID NO: 52 (Chothia) LCDR2 GAS
SEQ ID NO: 53 (Chothia) LCDR3 HNAFPY
SEQ ID NO: 54 (IMGT) LCDR1 QSVGSN
SEQ ID NO: 52 (IMGT) LCDR2 GAS
SEQ ID NO: 50 (IMGT) LCDR3 QQHNAFPYT
SEQ ID NO: 48 (альтернативная) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (альтернативная) LCDR2 GASTRAT
SEQ ID NO: 50 (альтернативная) LCDR3 QQHNAFPYT
SEQ ID NO: 55 VL EIVLTQSPATLSVSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQHNAFPYTFGGGTKVEIK
SEQ ID NO: 56 ДНК, кодирующая VL GAGATCGTGCTGACACAGTCCCCTGCCACCCTGTCTGTGTCTCCCGGCGAGAGAGCCACCCTGAGCTGCAGAGCCTCCCAGTCCGTGGGCTCCAACCTGGCCTGGTATCAGCAGAAGCCCGGCCAGGCCCCTCGGCTGCTGATCTACGGCGCCTCTACCAGAGCCACCGGCATCCCTGCCAGATTCTCCGGCTCTGGCTCCGGCACCGAGTTCACCCTGACCATCTCCAGCCTGCAGTCCGAGGACTTCGCCGTGTACTACTGCCAGCAGCACAACGCCTTCCCTTACACCTTCGGCGGAGGCACCAAAGTGGAAATCAAG
SEQ ID NO: 57 Легкая цепь EIVLTQSPATLSVSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQHNAFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO: 58 ДНК, кодирующая легкую цепь GAGATCGTGCTGACACAGTCCCCTGCCACCCTGTCTGTGTCTCCCGGCGAGAGAGCCACCCTGAGCTGCAGAGCCTCCCAGTCCGTGGGCTCCAACCTGGCCTGGTATCAGCAGAAGCCCGGCCAGGCCCCTCGGCTGCTGATCTACGGCGCCTCTACCAGAGCCACCGGCATCCCTGCCAGATTCTCCGGCTCTGGCTCCGGCACCGAGTTCACCCTGACCATCTCCAGCCTGCAGTCCGAGGACTTCGCCGTGTACTACTGCCAGCAGCACAACGCCTTCCCTTACACCTTCGGCGGAGGCACCAAAGTGGAAATCAAGCGTACGGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTGCCTGCTGAACAACTTCTACCCTCGCGAGGCCAAAGTGCAGTGGAAAGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC
379
SEQ ID NO: 81 (объединенная) HCDR1 GFTFSRYAMS
SEQ ID NO: 71 (объединенная) HCDR2 SISGTGGSTYYADSVKG
SEQ ID NO: 37 (объединенная) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 38 (Kabat) HCDR1 RYAMS
SEQ ID NO: 71 (Kabat) HCDR2 SISGTGGSTYYADSVKG
SEQ ID NO: 37 (Kabat) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 82 (Chothia) HCDR1 GFTFSRY
SEQ ID NO: 74 (Chothia) HCDR2 SGTGGS
SEQ ID NO: 37 (Chothia) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 83 (IMGT) HCDR1 GFTFSRYA
SEQ ID NO: 76 (IMGT) HCDR2 ISGTGGST
SEQ ID NO: 43 (IMGT) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 192 (альтернативная) HCDR1 FTFSRYAMS
SEQ ID NO: 71 (альтернативная) HCDR2 SISGTGGSTYYADSVKG
SEQ ID NO: 43 (альтернативная) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 84 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISGTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSS
SEQ ID NO: 85 ДНК, кодирующая VH GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCCTGGCGGCTCCCTGAGACTGTCTTGCGCCGCCTCCGGCTTCACCTTCTCCAGATACGCCATGTCCTGGGTCCGACAGGCCCCTGGCAAGGGCCTGGAGTGGGTGTCCTCCATCTCCGGCACCGGCGGCTCCACCTACTACGCCGACTCTGTGAAGGGCCGGTTCACCATCTCCCGGGACAACTCCAAGAACACCCTGTACCTGCAGATGAACTCCCTGCGGGCCGAGGACACCGCCGTGTACTACTGTGCCAGAGGCGGCCTGTACGGCTCCGGCTCCTACCTGTCCGACTTCGACCTGTGGGGCAGAGGCACCCTGGTCACCGTGTCCTCC
SEQ ID NO: 86 Тяжелая цепь 379.A EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISGTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 87 ДНК, кодирующая тяжелую цепь 379.A GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCCTGGCGGCTCCCTGAGACTGTCTTGCGCCGCCTCCGGCTTCACCTTCTCCAGATACGCCATGTCCTGGGTCCGACAGGCCCCTGGCAAGGGCCTGGAGTGGGTGTCCTCCATCTCCGGCACCGGCGGCTCCACCTACTACGCCGACTCTGTGAAGGGCCGGTTCACCATCTCCCGGGACAACTCCAAGAACACCCTGTACCTGCAGATGAACTCCCTGCGGGCCGAGGACACCGCCGTGTACTACTGTGCCAGAGGCGGCCTGTACGGCTCCGGCTCCTACCTGTCCGACTTCGACCTGTGGGGCAGAGGCACCCTGGTCACCGTGTCCTCCGCCTCCACAAAGGGCCCCTCCGTGTTCCCTCTGGCCCCTTGCTCCCGGTCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGACTACTTCCCCGAGCCCGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCAGCGTCGTGACCGTGCCCTCCTCCAGCCTGGGCACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAAGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTCCTTGCCCTGCCCCTGAGTTCCTGGGCGGACCTTCCGTGTTCCTGTTCCCTCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCTGAAGTGACCTGCGTGGTGGTGGACGTGTCCCAGGAAGATCCCGAAGTCCAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAAGTGTCCAACAAGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGCGAGCCCCAAGTGTACACCCTGCCTCCCAGCCAGGAAGAGATGACCAAGAATCAAGTGTCCCTGACTTGTCTGGTCAAGGGCTTCTACCCCTCCGATATCGCCGTGGAGTGGGAGTCCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTGTACTCTCGGCTGACCGTGGACAAGTCCCGGTGGCAGGAAGGCAACGTCTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGTCTCTGGGC X1X2X3,
где X1 представляет собой A, X2 представляет собой A, и X3 представляет собой G; или X1 отсутствует, X2 отсутствует и X3 отсутствует.
SEQ ID NO: 117 Тяжелая цепь 379.B EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISGTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGX,
где X представляет собой K или отсутствует
SEQ ID NO: 48 (объединенная) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (объединенная) LCDR2 GASTRAT
SEQ ID NO: 50 (объединенная) LCDR3 QQHNAFPYT
SEQ ID NO: 48 (Kabat) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (Kabat) LCDR2 GASTRAT
SEQ ID NO: 50 (Kabat) LCDR3 QQHNAFPYT
SEQ ID NO: 51 (Chothia) LCDR1 SQSVGSN
SEQ ID NO: 52 (Chothia) LCDR2 GAS
SEQ ID NO: 53 (Chothia) LCDR3 HNAFPY
SEQ ID NO: 54 (IMGT) LCDR1 QSVGSN
SEQ ID NO: 52 (IMGT) LCDR2 GAS
SEQ ID NO: 50 (IMGT) LCDR3 QQHNAFPYT
SEQ ID NO: 48 (альтернативная) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (альтернативная) LCDR2 GASTRAT
SEQ ID NO: 50 (альтернативная) LCDR3 QQHNAFPYT
SEQ ID NO: 55 VL EIVLTQSPATLSVSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQHNAFPYTFGGGTKVEIK
SEQ ID NO: 56 ДНК, кодирующая VL GAGATCGTGCTGACACAGTCCCCTGCCACCCTGTCTGTGTCTCCCGGCGAGAGAGCCACCCTGAGCTGCAGAGCCTCCCAGTCCGTGGGCTCCAACCTGGCCTGGTATCAGCAGAAGCCCGGCCAGGCCCCTCGGCTGCTGATCTACGGCGCCTCTACCAGAGCCACCGGCATCCCTGCCAGATTCTCCGGCTCTGGCTCCGGCACCGAGTTCACCCTGACCATCTCCAGCCTGCAGTCCGAGGACTTCGCCGTGTACTACTGCCAGCAGCACAACGCCTTCCCTTACACCTTCGGCGGAGGCACCAAAGTGGAAATCAAG
SEQ ID NO: 57 Легкая цепь EIVLTQSPATLSVSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQHNAFPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID NO: 58 ДНК, кодирующая легкую цепь GAGATCGTGCTGACACAGTCCCCTGCCACCCTGTCTGTGTCTCCCGGCGAGAGAGCCACCCTGAGCTGCAGAGCCTCCCAGTCCGTGGGCTCCAACCTGGCCTGGTATCAGCAGAAGCCCGGCCAGGCCCCTCGGCTGCTGATCTACGGCGCCTCTACCAGAGCCACCGGCATCCCTGCCAGATTCTCCGGCTCTGGCTCCGGCACCGAGTTCACCCTGACCATCTCCAGCCTGCAGTCCGAGGACTTCGCCGTGTACTACTGCCAGCAGCACAACGCCTTCCCTTACACCTTCGGCGGAGGCACCAAAGTGGAAATCAAGCGTACGGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTCGTGTGCCTGCTGAACAACTTCTACCCTCGCGAGGCCAAAGTGCAGTGGAAAGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAAGTGTACGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGC
376
SEQ ID NO: 135 (объединенная) HCDR1 GFTFRSYAMS
SEQ ID NO: 136 (объединенная) HCDR2 AITGSGGLTYYADSVKG
SEQ ID NO: 37 (объединенная) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 137 (Kabat) HCDR1 SYAMS
SEQ ID NO: 136 (Kabat) HCDR2 AITGSGGLTYYADSVKG
SEQ ID NO: 37 (Kabat) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 138 (Chothia) HCDR1 GFTFRSY
SEQ ID NO: 139 (Chothia) HCDR2 TGSGGL
SEQ ID NO: 37 (Chothia) HCDR3 GGLYGSGSYLSDFDL
SEQ ID NO: 140 (IMGT) HCDR1 GFTFRSYA
SEQ ID NO: 141 (IMGT) HCDR2 ITGSGGLT
SEQ ID NO: 43 (IMGT) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 193 (альтернативная) HCDR1 FTFRSYAMS
SEQ ID NO: 136 (альтернативная) HCDR2 AITGSGGLTYYADSVKG
SEQ ID NO: 43 (альтернативная) HCDR3 ARGGLYGSGSYLSDFDL
SEQ ID NO: 142 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFRSYAMSWVRQAPGKGLEWVSAITGSGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGLYGSGSYLSDFDLWGRGTLVTVSS
SEQ ID NO: 143 ДНК, кодирующая VH GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTCGTAGCTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCTATTACGGGAAGTGGTGGTTTGACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCGGTGTACTACTGCGCCAGAGGTGGATTGTACGGAAGCGGAAGCTACTTGAGTGACTTCGACCTATGGGGGAGAGGTACCTTGGTCACCGTCTCCTCA
SEQ ID NO: 48 (объединенная) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (объединенная) LCDR2 GASTRAT
SEQ ID NO: 50 (объединенная) LCDR3 QQHNAFPYT
SEQ ID NO: 48 (Kabat) LCDR1 RASQSVGSNLA
SEQ ID NO: 49 (Kabat) LCDR2 GASTRAT
SEQ ID NO: 50 (Kabat) LCDR3 QQHNAFPYT
SEQ ID NO: 51 (Chothia) LCDR1 SQSVGSN
SEQ ID NO: 52 (Chothia) LCDR2 GAS
SEQ ID NO: 53 (Chothia) LCDR3 HNAFPY