Противораковые рнк-вакцины

Группа изобретений относится к противораковым вакцинам. Противораковая мРНК-вакцина содержит липидную наночастицу, содержащую одну или более мРНК с открытыми рамками считывания, кодирующих 1–500 пептидных эпитопов – персонализированных раковых антигенов, и универсальный Т-клеточный эпитоп II типа; одну или более мРНК с открытой рамкой считывания, кодирующую пептид активирующей мутации онкогена; одну или более мРНК с открытой рамкой считывания, кодирующую пептидный эпитоп ракового антигена, причем мРНК-вакцина кодирует 5–100 пептидных эпитопов и по меньшей мере два из пептидных эпитопов – персонализированные раковые антигены; и/или одну или более мРНК с открытой рамкой считывания, кодирующую пептидный эпитоп ракового антигена, причем мРНК-вакцина кодирует 5–100 пептидных эпитопов, и по меньшей мере три из пептидных эпитопов – комплексные варианты, и по меньшей мере два из пептидных эпитопов – точечные мутации; причем липидная наночастица содержит 20–60% ионизируемого аминолипида, 5–25% нейтрального липида, 25–55% стерина и 0,5–15% ПЭГ-модифицированного липида. Также раскрыты другие варианты противораковой мРНК-вакцины, способ вакцинации субъекта, способ получения мРНК. Группа изобретений обеспечивает усиленный иммунный ответ. 6 н. и 130 з.п. ф-лы, 21 ил., 10 табл., 8 пр.

 

РОДСТВЕННЫЕ ЗАЯВКИ

Настоящая заявка испрашивает приоритет согласно разделу 35 Свода законов США 119(e) по дате подачи предварительной заявки на патент США, сер. №62/453444, поданной 1 февраля 2017 г., имеющей название “RNA CANCER VACCINES” («ПРОТИВОРАКОВЫЕ РНК-ВАКЦИНЫ»), предварительной заявки на патент США, сер. №62/453465, поданной 1 февраля 2017 г., имеющей название “IMMUNOMODULATORY THERAPEUTIC MRNA COMPOSITIONS ENCODING ACTIVATING ONCOGENE MUTATION PEPTIDES” («ИММУНОМОДУЛИРУЮЩИЕ ТЕРАПЕВТИЧЕСКИЕ КОМПОЗИЦИИ МРНК, КОДИРУЮЩИЕ ПЕПТИДЫ АКТИВИРУЮЩИХ МУТАЦИЙ ОНКОГЕНОВ»); и предварительной заявки на патент США, сер. № 62/558238, поданной 13 сентября 2017 г., имеющей название “CONCATAMERIC RNA CANCER VACCINES” («КОНКАТЕМЕРНЫЕ ПРОТИВОРАКОВЫЕ РНК-ВАКЦИНЫ»), содержание каждой из которых полностью включено в настоящий документ посредством ссылки.

ОБЛАСТЬ ТЕХНИКИ

Современные теории эволюции рака были сосредоточены на трех этапах, включающих индуцируемую стрессом нестабильность генома, разнообразие или гетерогенность в популяциях и опосредованную геномом макроэволюцию. Указанная теория объясняет, каким образом большинство известных молекулярных механизмов могут вносить вклад в рак, однако единого доминантного механизма для большинства клинических случаев не существует. Тем не менее, указанные общие механизмы предполагают, что противораковые вакцины могут обеспечивать универсальное решение для лечения рака.

Противораковые вакцины включают превентивные или профилактические вакцины, которые предназначены для предотвращения развития рака у здоровых людей; и терапевтические вакцины, которые предназначены для лечения существующего рака путем усиления естественной защиты организма от рака. Противораковые превентивные вакцины могут, например, быть нацелены на инфекционные агенты, которые вызывают рак или вносят вклад в развитие рака, для предотвращения обусловленного инфекционными заболеваниями рака. Двумя примерами коммерчески доступных профилактических вакцин являются Гардасил (Gardasil®) и Церварикс (Cervarix®). Каждая вакцина обеспечивает защиту от инфекции папилломавирусом человека (HPV). Другие превентивные противораковые вакцины могут быть нацелены на белки хозяина или их фрагменты, согласно прогнозам повышающие вероятность развития у индивидуума рака в будущем.

Большинство коммерческих или разрабатываемых вакцин (например, противораковых вакцин) основано на целых микроорганизмах, белковых антигенах, пептидах, полисахаридах или вакцинах на основе дезоксирибонуклеиновой кислоты (ДНК), а также их комбинациях. Вакцинация ДНК представляет собой одну из методик, используемых для стимуляции гуморального и клеточного иммунного ответа на антигены. Прямая инъекция генетически сконструированной ДНК (например, депротеинизированной плазмидной ДНК) живому хозяину приводит к тому, что незначительное число его клеток прямо продуцируют антиген, что ведет к защитному иммунологическому ответу. Указанная методика, однако, сопряжена с потенциальными проблемами интеграции ДНК в геном вакцины, в том числе возможностью инсерционного мутагенеза, который может приводить к активации онкогенов или ингибированию генов-супрессоров опухолей.

КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Согласно настоящему изобретению предложена противораковая вакцина на основе рибонуклеиновой кислоты (РНК) с РНК (например, матричной РНК (мРНК)), которая может безопасным образом направлять клеточные механизмы организма с получением практически любого представляющего интерес ракового белка или его фрагмента. Согласно некоторым вариантам реализации указанная РНК представляет собой модифицированную РНК. РНК-вакцины согласно настоящему описанию могут применяться для индукции сбалансированного иммунного ответа против рака, включающего как клеточный, так и гуморальный иммунитет, без риска, например, инсерционного мутагенеза.

Указанные РНК-вакцины могут применяться в различных условиях в зависимости от распространенности рака, или от степени или уровня неудовлетворенной медицинской потребности. Указанные РНК-вакцины могут применяться для лечения и/или предотвращения рака на различных стадиях или с различными степенями метастазирования. РНК-вакцины обладают превосходящими характеристиками, обеспечивая значительно более высокие титры антител и более ранний ответ по сравнению с альтернативными видами противораковой терапии, в том числе противораковыми вакцинами. Безотносительно какой-либо теории, считается, что РНК-вакцины, представляющие собой мРНК-полинуклеотиды, лучше подходят для получения подходящей конформации белка при трансляции, поскольку РНК-вакцины задействуют естественные клеточные механизмы. В отличие от традиционных видов терапии и вакцин, которые получают ex vivo и которые могут запускать нежелательные клеточные ответы, РНК-вакцины воспринимаются клеточной системой более естественным образом.

РНК-вакцины могут включать полинуклеотид из рибонуклеиновой кислоты (РНК), содержащий открытую рамку считывания, кодирующую по меньшей мере один раковый антигенный полипептид или его иммуногенный фрагмент (например, иммуногенный фрагмент, способный индуцировать иммунный ответ на рак). Другие варианты реализации включают по меньшей мере один полинуклеотид из рибонуклеиновой кислоты (РНК), содержащий открытую рамку считывания, кодирующую два или более антигенов или эпитопов, способных индуцировать иммунный ответ на рак.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая одну или более мРНК, каждая из которых содержит открытую рамку считывания, кодирующую пептидный эпитоп ракового антигена, введенные в состав липидной микрочастицы, при этом указанная мРНК-вакцина кодирует 5-100 пептидных эпитопов, и по меньшей мере два из указанных пептидных эпитопов представляют собой персонализированные раковые антигены; и фармацевтически приемлемый носитель или вспомогательное вещество.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая липидную наночастицу, содержащую одну или более мРНК, каждая из которых содержит одну или более открытых рамок считывания, кодирующих 1-500 пептидных эпитопов, которые представляют собой персонализированные раковые антигены, и универсальный Т-клеточный эпитоп II типа.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая липидную наночастицу, содержащую что-либо одно или более из перечисленного ниже: (a) одна или более мРНК, каждая из которых содержит одну или более открытых рамок считывания, кодирующих 1-500 пептидных эпитопов, которые представляют собой персонализированные раковые антигены, и универсальный Т-клеточный эпитоп II типа; (b) одна или более мРНК, каждая из которых содержит открытую рамку считывания, кодирующую пептид активирующей мутации онкогена, при этом указанная мРНК необязательно дополнительно содержит универсальный Т-клеточный эпитоп II типа; (c) одна или более мРНК, каждая из которых содержит открытую рамку считывания, кодирующую пептидный эпитоп ракового антигена, при этом указанная мРНК-вакцина кодирует 5-100 пептидных эпитопов и по меньшей мере два из указанных пептидных эпитопов представляют собой персонализированные раковые антигены, при этом указанная мРНК необязательно дополнительно содержит универсальный Т-клеточный эпитоп II типа; и/или (d) одна или более мРНК, каждая из которых содержит открытую рамку считывания, кодирующую пептидный эпитоп ракового антигена, при этом указанная мРНК-вакцина кодирует 5-100 пептидных эпитопов и по меньшей мере три из указанных пептидных эпитопов представляют собой комплексные варианты, а по меньшей мере два из указанных пептидных эпитопов представляют собой точечные мутации, при этом указанная мРНК необязательно дополнительно содержит универсальный Т-клеточный эпитоп II типа. Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина кодирует 1-20 универсальных Т-клеточных эпитопов II типа. Согласно другим вариантам реализации указанный универсальный Т-клеточный эпитоп II типа выбран из группы, состоящей из: ILMQYIKANSKFIGI (столбнячный токсин; SEQ ID NO: 226), FNNFTVSFWLRVPKVSASHLE (столбнячный токсин; SEQ ID NO: 227), QYIKANSKFIGITE (столбнячный токсин; SEQ ID NO: 228) QSIALSSLMVAQAIP (дифтерийный токсин; SEQ ID NO: 229) и AKFVAAWTLKAAA (пан-DR-эпитоп; SEQ ID NO: 230).

Согласно некоторым вариантам реализации указанный универсальный Т-клеточный эпитоп II типа представлен одним и тем же универсальным Т-клеточным эпитопом II типа во всей указанной мРНК. Согласно другим вариантам реализации указанный универсальный Т-клеточный эпитоп II типа повторяется 1-20 раз в указанной мРНК. Согласно одному варианту реализации указанные универсальные Т-клеточные эпитопы II типа в пределах указанной мРНК различаются между собой. Согласно некоторым вариантам реализации указанный универсальный Т-клеточный эпитоп II типа локализован между всеми пептидными эпитопами ракового антигена. Согласно другому варианту реализации указанный универсальный Т-клеточный эпитоп II типа локализован через каждые два пептидных эпитопа ракового антигена. Согласно одному варианту реализации указанный универсальный Т-клеточный эпитоп II типа локализован через каждые три пептидных эпитопа ракового антигена.

Согласно некоторым вариантам реализации удовлетворены одно или более из следующих условий: (i) указанная активирующая мутация онкогена представляет собой мутацию KRAS; (ii) указанная мутация KRAS представляет собой мутацию G12, при этом необязательно указанная мутация KRAS G12 выбрана из мутации KRAS G12D, G12V, G12S, G12C, G12A и G12R; (iii) указанная мутация KRAS представляет собой мутацию G13, при этом необязательно указанная мутация KRAS G13 представляет собой мутацию KRAS G13D; и/или (iv) указанная активирующая мутация онкогена представляет собой мутацию H-RAS или N-RAS.

Согласно некоторым вариантам реализации удовлетворены одно или более из следующих условий: (A) указанная мРНК содержит открытую рамку считывания, кодирующую конкатемер из двух или более пептидов активирующей мутации онкогена; (B) по меньшей мере два из указанных пептидных эпитопов отделены друг от друга единственным остатком глицина, при этом необязательно все пептидные эпитопы отделены друг от друга единственным остатком глицина; (C) указанный конкатемер содержит 3-10 пептидов активирующей мутации онкогена; и/или (D) по меньшей мере два из указанных пептидных эпитопов прямо соединены между собой без линкера.

Согласно некоторым вариантам реализации удовлетворены одно или более из следующих условий: (i) по меньшей мере один из указанных пептидных эпитопов представляет собой традиционный раковый антиген; (ii) по меньшей мере один из указанных пептидных эпитопов представляет собой рекуррентный полиморфизм; (iii) указанный рекуррентный полиморфизм содержит рекуррентную соматическую онкомутацию в p53; (iv) указанная рекуррентная соматическая онкомутация в p53 выбрана из группы, состоящей из: (A) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.T125, индуцирующих сохранение интрона с пептидной последовательностью TAKSVTCTVSCPEGLASMRLQCLAVSPCISFVWNFGIPLHPLASCQCFFIVYPLNV (SEQ ID NO: 232), которая содержит эпитопы AVSPCISFVW (SEQ ID NO: 233) (HLA-B*57:01, HLA-B*58:01), HPLASCQCFF (SEQ ID NO: 234) (HLA-B*35:01, HLA-B*53:01), FVWNFGIPL (SEQ ID NO: 235) (HLA-A*02:01, HLA-A*02:06, HLA-B*35:01); (B) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.331, индуцирующих сохранение интрона с пептидной последовательностью EYFTLQVLSLGTSYQVESFQSNTQNAVFFLTVLPAIGAFAIRGQ (SEQ ID NO: 236), которая содержит эпитопы LQVLSLGTSY (SEQ ID NO: 237) (HLA-B*15:01), FQSNTQNAVF (SEQ ID NO: 238) (HLA-B*15:01); (C) мутаций в каноническом 3’-сайте сплайсинга возле кодона p.126, индуцирующих 3’-сайт скрытого альтернативного экзонного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности AKSVTCTMFCQLAK (SEQ ID NO: 239), которая содержит эпитопы CTMFCQLAK (SEQ ID NO: 240) (HLA-A*11:01), KSVTCTMF (SEQ ID NO: 241) (HLA-B*58:01); и/или (D) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.224, индуцирующих 5’-сайт скрытого альтернативного интронного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности VPYEPPEVWLALTVPPSTAWAA (SEQ ID NO: 242), которая содержит эпитопы VPYEPPEVW (SEQ ID NO: 243) (HLA-B*53:01, HLA-B*51:01), LTVPPSTAW (SEQ ID NO: 244) (HLA-B*58:01, HLA-B*57:01), где положения кодонов транскрипта относятся к каноническому полноразмерному транскрипту p53 ENST00000269305 (SEQ ID NO: 245) из аннотации генома человека Ensembl v83; и/или (v) противораковая мРНК-вакцина не содержит стабилизирующего агента.

Согласно некоторым вариантам реализации указанные одна или более мРНК дополнительно содержат открытую рамку считывания, кодирующую иммунопотенциатор. Согласно другим вариантам реализации указанный иммунопотенциатор введен в состав липидной наночастицы. Согласно одному варианту реализации указанный иммунопотенциатор введен в состав отдельной липидной наночастицы. Согласно некоторым вариантам реализации указанный иммунопотенциатор представляет собой конститутивно активный полипептид STING человека. Согласно одному варианту реализации указанный конститутивно активный полипептид STING человека содержит последовательность аминокислот, представленную в SEQ ID NO: 1. Согласно другому варианту реализации указанная мРНК, кодирующая указанный конститутивно активный полипептид STING человека, содержит последовательность нуклеотидов, представленную в SEQ ID NO: 170. Согласно некоторым вариантам реализации указанная мРНК, кодирующая конститутивно активный полипептид STING человека, содержит 3’-UTR, содержащую сайт связывания микроРНК miR-122. Согласно одному варианту реализации указанный сайт связывания микроРНК miR-122 содержит последовательность нуклеотидов, представленную в SEQ ID NO: 175.

Согласно некоторым вариантам реализации каждая из указанных одной или более мРНК содержит 5’ UTR, содержащую последовательность нуклеотидов, представленную в SEQ ID NO: 176. Согласно одному варианту реализации каждая из указанных одной или более мРНК содержит концевой поли-A-фрагмент. Согласно одному варианту реализации указанный концевой поли-A-фрагмент содержит приблизительно 100 нуклеотидов. Согласно некоторым вариантам реализации каждая из указанных одной или более мРНК содержит структуру 5’-кэп-1.

Согласно некоторым вариантам реализации указанные одна или более мРНК содержат по меньшей мере одну химическую модификацию. Согласно одному варианту реализации указанная химическая модификация представлена N1-метилпсевдоуридином. Согласно другому варианту реализации указанные одна или более мРНК полностью модифицированы N1-метилпсевдоуридином.

Согласно некоторым вариантам реализации указанные одна или более мРНК кодируют 45-55 персонализированных раковых антигенов. Согласно одному варианту реализации указанные одна или более мРНК кодируют 52 персонализированных раковых антигена. Согласно некоторым вариантам реализации каждый из указанных персонализированных раковых антигенов кодирует отдельная открытая рамка считывания. Согласно другому варианту реализации указанные пептидные эпитопы находятся в форме конкатемерного ракового антигена, состоящего из 2-100 пептидных эпитопов, при этом указанный конкатемерный раковый антиген необязательно состоит из 5-100 пептидных эпитопов.

Согласно некоторым вариантам реализации указанный конкатемерный раковый антиген характеризуется чем-либо одним или более из нижеперечисленного: a) 2-100 пептидных эпитопов или 5-100 пептидных эпитопов перемежаются чувствительными к расщеплению сайтами; b) мРНК, кодирующие каждый пептидный эпитоп, соединены между собой напрямую без линкера; c) мРНК, кодирующие каждый пептидный эпитоп, соединены между собой однонуклеотидным линкером; d) каждый пептидный эпитоп содержит 25-35 аминокислот и включает центрально расположенную SNP-мутацию; e) по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса I, полученных от субъекта; f) по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса II, полученных от субъекта; g) по меньшей мере 50% пептидных эпитопов имеют предсказанную аффинность связывания IC >500 нМ в отношении HLA-A, HLA-B и/или DRB1; h) указанная мРНК кодирует 45-55 пептидных эпитопов; i) указанная мРНК кодирует 52 пептидных эпитопа; j) 50% пептидных эпитопов обладают аффинностью связывания в отношении MHC класса I и 50% пептидных эпитопов обладают аффинностью связывания в отношении MHC класса II; k) указанная мРНК, кодирующая пептидные эпитопы, скомпонована таким образом, чтобы указанные пептидные эпитопы располагались в порядке, минимизирующем образование псевдоэпитопов, l) по меньшей мере 30% пептидных эпитопов представляют собой связывающие MHC класса I пептиды длиной 15 аминокислот; и/или m) по меньшей мере 30% пептидных эпитопов представляют собой связывающие MHC класса II пептиды длиной в 21 аминокислоту.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая одну или более мРНК, каждая из которых содержит одну или более открытых рамок считывания, кодирующих 45-55 пептидных эпитопов, которые представляют собой персонализированные раковые антигены, введенные в состав липидной микрочастицы.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая одну или более мРНК, каждая из которых содержит одну или более открытых рамок считывания, кодирующих 45-55 пептидных эпитопов, которые представляют собой персонализированные раковые антигены, введенные в состав липидной микрочастицы; при этом необязательно по меньшей мере один из указанных пептидных эпитопов представляет собой пептид активирующей мутации онкогена или традиционный раковый антиген; при этом необязательно по меньшей мере три пептидных эпитопа представляют собой комплексные варианты и по меньшей мере два из указанных пептидных эпитопов представляют собой точечные мутации.

Согласно некоторым вариантам реализации указанные одна или более мРНК кодируют 48-54 персонализированных раковых антигена. Согласно одному варианту реализации указанные одна или более мРНК кодируют 52 персонализированных раковых антигена. Согласно некоторым вариантам реализации каждый из указанных персонализированных раковых антигенов кодирует отдельная открытая рамка считывания.

Согласно другому варианту реализации указанные пептидные эпитопы находятся в форме конкатемерного ракового антигена, состоящего из 2-100 пептидных эпитопов, при этом указанный конкатемерный раковый антиген необязательно состоит из 5-100 пептидных эпитопов. Согласно некоторым вариантам реализации указанный конкатемерный раковый антиген характеризуется чем-либо одним или более из нижеперечисленного: a) 2-100 пептидных эпитопов или 5-100 пептидных эпитопов перемежаются чувствительными к расщеплению сайтами; b) мРНК, кодирующие каждый пептидный эпитоп, соединены между собой напрямую без линкера; c) мРНК, кодирующие каждый пептидный эпитоп, соединены между собой однонуклеотидным линкером; d) каждый пептидный эпитоп содержит 25-35 аминокислот и включает центрально расположенную SNP-мутацию; e) по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса I, полученных от субъекта; f) по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса II, полученных от субъекта; g) по меньшей мере 50% пептидных эпитопов имеют предсказанную аффинность связывания IC >500 нМ в отношении HLA-A, HLA-B и/или DRB1; h) указанная мРНК кодирует 45-55 пептидных эпитопов; i) указанная мРНК кодирует 52 пептидных эпитопа; j) 50% пептидных эпитопов обладают аффинностью связывания в отношении MHC класса I и 50% пептидных эпитопов обладают аффинностью связывания в отношении MHC класса II; k) указанная мРНК, кодирующая пептидные эпитопы, скомпонована таким образом, чтобы указанные пептидные эпитопы располагались в порядке, минимизирующем образование псевдоэпитопов, l) по меньшей мере 30% пептидных эпитопов представляют собой связывающие MHC класса I пептиды длиной 15 аминокислот; и/или m) по меньшей мере 30% пептидных эпитопов представляют собой связывающие MHC класса II пептиды длиной в 21 аминокислоту.

Согласно некоторым вариантам реализации по меньшей мере два из указанных пептидных эпитопов отделены друг от друга универсальным Т-клеточным эпитопом II типа. Согласно одному варианту реализации все пептидные эпитопы отделены друг от друга универсальным Т-клеточным эпитопом II типа. Согласно другому варианту реализации указанная противораковая мРНК-вакцина кодирует 1-20 универсальных Т-клеточных эпитопов II типа.

Согласно некоторым вариантам реализации указанный универсальный Т-клеточный эпитоп II типа выбран из группы, состоящей из: ILMQYIKANSKFIGI (столбнячный токсин; SEQ ID NO: 226), FNNFTVSFWLRVPKVSASHLE (столбнячный токсин; SEQ ID NO: 227), QYIKANSKFIGITE (столбнячный токсин; SEQ ID NO: 228) QSIALSSLMVAQAIP (дифтерийный токсин; SEQ ID NO: 229) и AKFVAAWTLKAAA (пан-DR-эпитоп; SEQ ID NO: 230).

Согласно одному варианту реализации указанный универсальный Т-клеточный эпитоп II типа представлен одним и тем же универсальным Т-клеточным эпитопом II типа во всей указанной мРНК. Согласно некоторым вариантам реализации указанный универсальный Т-клеточный эпитоп II типа повторяется 1-20 раз в указанной мРНК. Согласно другому варианту реализации указанные универсальные Т-клеточные эпитопы II типа в пределах указанной мРНК различаются между собой. Согласно одному варианту реализации указанный универсальный Т-клеточный эпитоп II типа локализован между всеми пептидными эпитопами. Согласно некоторым вариантам реализации указанный универсальный Т-клеточный эпитоп II типа локализован между всеми пептидными эпитопами. Согласно одному варианту реализации указанный универсальный Т-клеточный эпитоп II типа локализован через каждые три пептидных эпитопа.

Согласно некоторым вариантам реализации указанные одна или более мРНК дополнительно содержат открытую рамку считывания, кодирующую иммунопотенциатор. Согласно одному варианту реализации указанный иммунопотенциатор введен в состав липидной наночастицы. Согласно другому варианту реализации указанный иммунопотенциатор введен в состав отдельной липидной наночастицы. Согласно некоторым вариантам реализации указанный иммунопотенциатор представляет собой конститутивно активный полипептид STING человека. Согласно одному варианту реализации указанный конститутивно активный полипептид STING человека содержит последовательность аминокислот, представленную в SEQ ID NO: 1. Согласно другому варианту реализации указанная мРНК, кодирующая конститутивно активный полипептид STING человека, содержит последовательность нуклеотидов, представленную в SEQ ID NO: 170.

Согласно некоторым вариантам реализации удовлетворены одно или более из следующих условий: (i) указанная активирующая мутация онкогена представляет собой мутацию KRAS; (ii) указанная мутация KRAS представляет собой мутацию G12, при этом необязательно указанная мутация KRAS G12 выбрана из мутации KRAS G12D, G12V, G12S, G12C, G12A и G12R; (iii) указанная мутация KRAS представляет собой мутацию G13, при этом необязательно указанная мутация KRAS G13 представляет собой мутацию KRAS G13D; и/или (iv) указанная активирующая мутация онкогена представляет собой мутацию H-RAS или N-RAS.

Согласно некоторым вариантам реализации удовлетворены одно или более из следующих условий: (A) указанная мРНК содержит открытую рамку считывания, кодирующую конкатемер из двух или более пептидов активирующей мутации онкогена; (B) по меньшей мере два из указанных пептидных эпитопов отделены друг от друга единственным остатком глицина, при этом необязательно все пептидные эпитопы отделены друг от друга единственным остатком глицина; (C) указанный конкатемер содержит 3-10 пептидов активирующей мутации онкогена; и/или (D) по меньшей мере два из указанных пептидных эпитопов прямо соединены между собой без линкера.

Согласно конкретным вариантам реализации удовлетворены одно или более из следующих условий: (i) по меньшей мере один из указанных пептидных эпитопов представляет собой традиционный раковый антиген; (ii) по меньшей мере один из указанных пептидных эпитопов представляет собой рекуррентный полиморфизм; (iii) указанный рекуррентный полиморфизм содержит рекуррентную соматическую онкомутацию в p53; (iv) указанная рекуррентная соматическая онкомутация в p53 выбрана из группы, состоящей из: (A) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.T125, индуцирующих сохранение интрона с пептидной последовательностью TAKSVTCTVSCPEGLASMRLQCLAVSPCISFVWNFGIPLHPLASCQCFFIVYPLNV (SEQ ID NO: 232), которая содержит эпитопы AVSPCISFVW (SEQ ID NO: 233) (HLA-B*57:01, HLA-B*58:01), HPLASCQCFF (SEQ ID NO: 234) (HLA-B*35:01, HLA-B*53:01), FVWNFGIPL (SEQ ID NO: 235) (HLA-A*02:01, HLA-A*02:06, HLA-B*35:01); (B) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.331, индуцирующих сохранение интрона с пептидной последовательностью EYFTLQVLSLGTSYQVESFQSNTQNAVFFLTVLPAIGAFAIRGQ (SEQ ID NO: 236), которая содержит эпитопы LQVLSLGTSY (SEQ ID NO: 237) (HLA-B*15:01), FQSNTQNAVF (SEQ ID NO: 238) (HLA-B*15:01); (C) мутаций в каноническом 3’-сайте сплайсинга возле кодона p.126, индуцирующих 3’-сайт скрытого альтернативного экзонного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности AKSVTCTMFCQLAK (SEQ ID NO: 239), которая содержит эпитопы CTMFCQLAK (SEQ ID NO: 240) (HLA-A*11:01), KSVTCTMF (SEQ ID NO: 241) (HLA-B*58:01); и/или (D) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.224, индуцирующих 5’-сайт скрытого альтернативного интронного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности VPYEPPEVWLALTVPPSTAWAA (SEQ ID NO: 242), которая содержит эпитопы VPYEPPEVW (SEQ ID NO: 243) (HLA-B*53:01, HLA-B*51:01), LTVPPSTAW (SEQ ID NO: 244) (HLA-B*58:01, HLA-B*57:01), где положения кодонов транскрипта относятся к каноническому полноразмерному транскрипту p53 ENST00000269305 (SEQ ID NO: 245) из аннотации генома человека Ensembl v83; и/или (v) противораковая мРНК-вакцина не содержит стабилизирующего агента.

Согласно другому аспекту настоящего изобретения предложена противораковая мРНК-вакцина, содержащая липидную наночастицу, содержащую (i) одну или более мРНК, каждая из которых содержит одну или более открытых рамок считывания, кодирующих 1-500 пептидных эпитопов, которые представляют собой персонализированные раковые антигены, и (ii) мРНК, содержащую открытую рамку считывания, кодирующую полипептид, который усиливает иммунный ответ на персонализированные раковые антигены, при этом необязательно (i) и (ii) присутствуют в массовом соотношении, равном приблизительно 5:1.

Согласно другому аспекту настоящего изобретения предложена противораковая мРНК-вакцина, содержащая: липидную наночастицу, содержащую: (i) одну или более мРНК, каждая из которых содержит одну или более открытых рамок считывания, кодирующих 1-500 пептидных эпитопов, которые представляют собой персонализированные раковые антигены, и (ii) мРНК, содержащую открытую рамку считывания, кодирующую полипептид, который усиливает иммунный ответ на персонализированные раковые антигены, при этом необязательно (i) и (ii) присутствуют в массовом соотношении, равном приблизительно 5:1; при этом необязательно по меньшей мере один из указанных пептидных эпитопов представляет собой пептид активирующей мутации онкогена или традиционный раковый антиген; и при этом необязательно по меньшей мере три пептидных эпитопа представляют собой комплексные варианты и по меньшей мере два из указанных пептидных эпитопов представляют собой точечные мутации.

Согласно некоторым вариантам реализации иммунный ответ включает клеточный или гуморальный иммунный ответ, характеризующийся: (i) стимуляцией сигнализации через путь интерферона типа I; (ii) стимуляцией сигнализации через путь NFkB; (iii) стимуляцией воспалительного ответа; (iv) стимуляцией продуцирования цитокинов; или (v) стимуляцией развития, активности или мобилизации дендритных клеток; и (vi) комбинацией любых из пунктов (i)-(vi).

Согласно одному варианту реализации указанная противораковая мРНК-вакцина содержит единственную мРНК-конструкцию, кодирующую оба пептидных эпитопа и полипептид, который усиливает иммунный ответ на персонализированные раковые антигены. Согласно другому варианту реализации указанные пептидные эпитопы находятся в форме конкатемерного ракового антигена, состоящего из 2-100 пептидных эпитопов, при этом указанный конкатемерный раковый антиген необязательно состоит из 5-100 пептидных эпитопов.

Согласно некоторым вариантам реализации указанный конкатемерный раковый антиген характеризуется чем-либо одним или более из нижеперечисленного: a) 2-100 пептидных эпитопов или 5-100 пептидных эпитопов перемежаются чувствительными к расщеплению сайтами; b) мРНК, кодирующие каждый пептидный эпитоп, соединены между собой напрямую без линкера; c) мРНК, кодирующие каждый пептидный эпитоп, соединены между собой однонуклеотидным линкером; d) каждый пептидный эпитоп содержит 25-35 аминокислот и включает центрально расположенную SNP-мутацию; e) по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса I, полученных от субъекта; f) по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса II, полученных от субъекта; g) по меньшей мере 50% пептидных эпитопов имеют предсказанную аффинность связывания IC >500 нМ в отношении HLA-A, HLA-B и/или DRB1; h) указанная мРНК кодирует 45-55 пептидных эпитопов; i) указанная мРНК кодирует 52 пептидных эпитопа; j) 50% пептидных эпитопов обладают аффинностью связывания в отношении MHC класса I и 50% пептидных эпитопов обладают аффинностью связывания в отношении MHC класса II; k) указанная мРНК, кодирующая пептидные эпитопы, скомпонована таким образом, чтобы указанные пептидные эпитопы располагались в порядке, минимизирующем образование псевдоэпитопов, l) по меньшей мере 30% пептидных эпитопов представляют собой связывающие MHC класса I пептиды длиной 15 аминокислот; и/или m) по меньшей мере 30% пептидных эпитопов представляют собой связывающие MHC класса II пептиды длиной в 21 аминокислоту.

Согласно некоторым вариантам реализации каждый пептидный эпитоп содержит центрально расположенную SNP-мутацию с 15 фланкирующими аминокислотами с каждой стороны SNP-мутации.

Согласно одному варианту реализации указанный полипептид, который усиливает иммунный ответ на по меньшей мере один персонализированный раковый антиген у субъекта, представляет собой конститутивно активный полипептид STING человека. Согласно одному варианту реализации указанный конститутивно активный полипептид STING человека содержит одну или более мутаций, выбранных из группы, состоящей из V147L, N154S, V155M, R284M, R284K, R284T, E315Q, R375A и их комбинаций. Согласно другому варианту реализации указанный конститутивно активный полипептид STING человека содержит мутацию V155M. Согласно другому варианту реализации указанный конститутивно активный полипептид STING человека содержит мутации R284M/V147L/N154S/V155M.

Согласно некоторым вариантам реализации каждая мРНК введена в состав одной и той же или отдельных липидных наночастиц. Согласно другому варианту реализации каждая мРНК, кодирующая персонализированные раковые антигены введена в состав одной и той же или отдельных липидных наночастиц. Согласно некоторым вариантам реализации каждая мРНК, кодирующая полипептид, который усиливает иммунный ответ на персонализированные раковые антигены, введена в состав одной и той же или отдельных липидных наночастиц.

Согласно некоторым вариантам реализации каждая мРНК, кодирующая персонализированный раковый антиген, введена в состав одной и той же липидной наночастицы, а каждая мРНК, кодирующая полипептид, который усиливает иммунный ответ на персонализированный раковый антиген, введена в состав отдельной липидной наночастицы. Согласно другому варианту реализации каждая мРНК, кодирующая персонализированный раковый антиген, введена в состав одной и той же липидной наночастицы, а каждая мРНК, кодирующая полипептид, который усиливает иммунный ответ на персонализированный раковый антиген, введена в состав той же липидной наночастицы, что и каждая из мРНК, кодирующих персонализированный раковый антиген. Согласно некоторым вариантам реализации каждая мРНК, кодирующая персонализированный раковый антиген, введена в состав отдельной липидной наночастицы, а каждая мРНК, кодирующая полипептид, который усиливает иммунный ответ на персонализированный раковый антиген, введена в состав той же липидной наночастицы, что и каждая из мРНК, кодирующих каждый персонализированный раковый антиген.

Согласно некоторым вариантам реализации указанные пептидные эпитопы представляют собой T-клеточные эпитопы и/или B-клеточные эпитопы. Согласно другим вариантам реализации указанные пептидные эпитопы содержат комбинацию T-клеточных эпитопов и B-клеточных эпитопов. Согласно одному варианту реализации по меньшей мере 1 пептидный эпитоп представляет собой T-клеточный эпитоп. Согласно другому варианту реализации по меньшей мере 1 пептидный эпитоп представляет собой B-клеточный эпитоп.

Согласно некоторым вариантам реализации указанные пептидные эпитопы были оптимизированы для обеспечения силы связывания с MHC субъекта. Согласно другим вариантам реализации обращенная к TCR поверхность каждого эпитопа обладает незначительным сходством с эндогенными белками.

Согласно другому варианту реализации указанная противораковая мРНК-вакцина дополнительно содержит антиген-приманку. Согласно некоторым вариантам реализации указанный антиген-приманка представляет собой антиген инфекционного заболевания.

Согласно одному варианту реализации указанная противораковая мРНК-вакцина дополнительно содержит мРНК, содержащую открытую рамку считывания, кодирующую один или более традиционных раковых антигенов.

Согласно одному варианту реализации удовлетворены одно или более из следующих условий: (i) указанная активирующая мутация онкогена представляет собой мутацию KRAS; (ii) указанная мутация KRAS представляет собой мутацию G12, при этом необязательно указанная мутация KRAS G12 выбрана из мутации KRAS G12D, G12V, G12S, G12C, G12A и G12R; (iii) указанная мутация KRAS представляет собой мутацию G13, при этом необязательно указанная мутация KRAS G13 представляет собой мутацию KRAS G13D; и/или (iv) указанная активирующая мутация онкогена представляет собой мутацию H-RAS или N-RAS.

Согласно одному варианту реализации удовлетворены одно или более из следующих условий: (A) указанная мРНК содержит открытую рамку считывания, кодирующую конкатемер из двух или более пептидов активирующей мутации онкогена; (B) по меньшей мере два из указанных пептидных эпитопов отделены друг от друга единственным остатком глицина, при этом необязательно все пептидные эпитопы отделены друг от друга единственным остатком глицина; (C) указанный конкатемер содержит 3-10 пептидов активирующей мутации онкогена; и/или (D) по меньшей мере два из указанных пептидных эпитопов прямо соединены между собой без линкера.

Согласно одному варианту реализации удовлетворены одно или более из следующих условий: (i) по меньшей мере один из указанных пептидных эпитопов представляет собой традиционный раковый антиген; (ii) по меньшей мере один из указанных пептидных эпитопов представляет собой рекуррентный полиморфизм; (iii) указанный рекуррентный полиморфизм содержит рекуррентную соматическую онкомутацию в p53; (iv) указанная рекуррентная соматическая онкомутация в p53 выбрана из группы, состоящей из: (A) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.T125, индуцирующих сохранение интрона с пептидной последовательностью TAKSVTCTVSCPEGLASMRLQCLAVSPCISFVWNFGIPLHPLASCQCFFIVYPLNV (SEQ ID NO: 232), которая содержит эпитопы AVSPCISFVW (SEQ ID NO: 233) (HLA-B*57:01, HLA-B*58:01), HPLASCQCFF (SEQ ID NO: 234) (HLA-B*35:01, HLA-B*53:01), FVWNFGIPL (SEQ ID NO: 235) (HLA-A*02:01, HLA-A*02:06, HLA-B*35:01); (B) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.331, индуцирующих сохранение интрона с пептидной последовательностью YFTLQVLSLGTSYQVESFQSNTQNAVFFLTVLPAIGAFAIRGQ (SEQ ID NO: 236), которая содержит эпитопы LQVLSLGTSY (SEQ ID NO: 237) (HLA-B*15:01), FQSNTQNAVF (SEQ ID NO: 238) (HLA-B*15:01); (C) мутаций в каноническом 3’-сайте сплайсинга возле кодона p.126, индуцирующих 3’-сайт скрытого альтернативного экзонного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности AKSVTCTMFCQLAK (SEQ ID NO: 239), которая содержит эпитопы CTMFCQLAK (SEQ ID NO: 240) (HLA-A*11:01), KSVTCTMF (SEQ ID NO: 241) (HLA-B*58:01); и/или (D) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.224, индуцирующих 5’-сайт скрытого альтернативного интронного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности VPYEPPEVWLALTVPPSTAWAA (SEQ ID NO: 242), которая содержит эпитопы VPYEPPEVW (SEQ ID NO: 243) (HLA-B*53:01, HLA-B*51:01), LTVPPSTAW (SEQ ID NO: 244) (HLA-B*58:01, HLA-B*57:01), где положения кодонов транскрипта относятся к каноническому полноразмерному транскрипту p53 ENST00000269305 (SEQ ID NO: 245) из аннотации генома человека Ensembl v83; и/или (v) противораковая мРНК-вакцина не содержит стабилизирующего агента.

Согласно некоторым вариантам реализации указанная липидная наночастица характеризуется молярным отношением: приблизительно 20-60% ионизируемого аминолипида: 5-25% нейтрального липида: 25-55% стерина; и 0,5-15% ПЭГ-модифицированного липида, при этом необязательно указанный ионизируемый аминолипид представляет собой катионный липид. Согласно одному варианту реализации указанная липидная наночастица характеризуется молярным отношением: приблизительно 50% соединения 25: приблизительно 10% ДСФХ: приблизительно 38,5% холестерина; и приблизительно 1,5% ПЭГ-ДМГ. Согласно другому варианту реализации указанный ионизируемый аминолипид выбран из группы, состоящей из, например, 2,2-дилинолеил-4-диметиламиноэтил-[1,3]-диоксолана (DLin-KC2-DMA), дилинолеил-метил-4-диметиламинобутирата (DLin-MC3-DMA) и ди((Z)-нон-2-ен-1-ил) 9-((4-(диметиламино)бутаноил)окси)гептадекандиоата (L319). Согласно некоторым вариантам реализации указанная липидная наночастица содержит соединение формулы (I). Согласно одному варианту реализации соединение формулы (I) представляет собой соединение 25. Согласно другому варианту реализации указанная липидная наночастица обладает значением полидисперсности менее 0,4. Согласно некоторым вариантам реализации указанная липидная наночастица обладает суммарным нейтральным зарядом при нейтральном значении pH.

Согласно одному варианту реализации обращенная к TCR поверхность каждого эпитопа обладает незначительным сходством с эндогенными белками.

Согласно другому варианту реализации указанный мРНК дополнительно содержит открытую рамку считывания, кодирующую модулятор иммунных контрольных точек. Согласно одному варианту реализации указанная противораковая мРНК-вакцина дополнительно содержит дополнительный противораковый терапевтический агент; указанный дополнительный противораковый терапевтический агент необязательно представляет собой модулятор иммунных контрольных точек. Согласно другому варианту реализации указанный модулятор иммунных контрольных точек представляет собой ингибирующий контрольные точки полипептид. Согласно некоторым вариантам реализации указанный ингибирующий контрольные точки полипептид ингибирует PD1, PD-L1, CTLA4, TIM-3, VISTA, A2AR, B7-H3, B7-H4, BTLA, IDO, KIR, LAG3 или их комбинацию.

Согласно некоторым вариантам реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело. Согласно одному варианту реализации указанный ингибирующий контрольные точки полипептид представляет собой антитело, выбранное из антитела против CTLA4 или его антигенсвязывающего фрагмента, специфически связывающего CTLA4, антитела против PD1 или его антигенсвязывающего фрагмента, специфически связывающего PD1, антитела против PD-L1 или его антигенсвязывающего фрагмента, специфически связывающего PD-L1, и их комбинации. Согласно одному варианту реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело против PD-L1, выбранное из атезолизумаба, авелумаба или дурвалумаба. Согласно другому варианту реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело против CTLA-4, выбранное из тремелимумаба или ипилимумаба. Согласно некоторым вариантам реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело против PD1, выбранное из ниволумаба или пембролизумаба.

Согласно некоторым вариантам реализации указанная химическая модификация выбрана из группы, состоящей из псевдоуридина, N1-метилпсевдоуридина, 2-тиоуридина, 4’-тиоуридина, 5-метилцитозина, 2-тио-1-метил-1-деазапсевдоуридина, 2-тио-1-метилпсевдоуридина, 2-тио-5-азауридина, 2-тиодигидропсевдоуридина, 2-тиодигидроуридина, 2-тиопсевдоуридина, 4-метокси-2-тиопсевдоуридина, 4-метоксипсевдоуридина, 4-тио-1-метилпсевдоуридина, 4-тиопсевдоуридина, 5-азауридина, дигидропсевдоуридина, 5-метилуридина, 5-метилуридина, 5-метоксиуридина и 2’-O-метилуридина.

Согласно другому аспекту настоящего изобретения предложен способ вакцинации субъекта, включающий введение страдающему раком субъекту противораковой мРНК-вакцины, описанной выше.

Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят, используя уровень дозы, достаточный для доставки от 10 мкг до 400 мкг мРНК-вакцины указанному субъекту. Согласно одному варианту реализации указанную мРНК-вакцину вводят, используя уровень дозы, достаточный для доставки 0,033 мг, 0,1 мг, 0,2 мг или 0,4 мг указанному субъекту. Согласно другому варианту реализации указанную мРНК-вакцину вводят указанному субъекту два раза, три раза, четыре раза или более. Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят один раз в сутки каждые три недели. Согласно одному варианту реализации указанную мРНК-вакцину вводят внутрикожным, внутримышечным и/или подкожным путем. Согласно другому варианту реализации указанную мРНК-вакцину вводят внутримышечно.

Согласно некоторым вариантам реализации указанный способ дополнительно включает введение указанному субъекту дополнительного противоракового терапевтического агента; указанный дополнительный противораковый терапевтический агент необязательно представляет собой модулятор иммунных контрольных точек,. Согласно одному варианту реализации указанный модулятор иммунных контрольных точек представляет собой ингибирующий контрольные точки полипептид. Согласно другому варианту реализации указанный ингибирующий контрольные точки полипептид ингибирует PD1, PD-L1, CTLA4, TIM-3, VISTA, A2AR, B7-H3, B7-H4, BTLA, IDO, KIR, LAG3 или их комбинацию. Согласно некоторым вариантам реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело. Согласно другим вариантам реализации указанный ингибирующий контрольные точки полипептид представляет собой антитело, выбранное из антитела против CTLA4 или его антигенсвязывающего фрагмента, специфически связывающего CTLA4, антитела против PD1 или его антигенсвязывающего фрагмента, специфически связывающего PD1, антитела против PD-L1 или его антигенсвязывающего фрагмента, специфически связывающего PD-L1, и их комбинации. Согласно некоторым вариантам реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело против PD-L1, выбранное из атезолизумаба, авелумаба или дурвалумаба. Согласно другому варианту реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело против CTLA-4, выбранное из тремелимумаба или ипилимумаба. Согласно другим вариантам реализации указанный полипептид-ингибитор контрольных точек представляет собой антитело против PD1, выбранное из ниволумаба или пембролизумаба.

Согласно одному варианту реализации указанный модулятор иммунных контрольных точек вводят, используя уровень дозы, достаточный для доставки 100-300 мг указанному субъекту. Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят, используя уровень дозы, достаточный для доставки 200 мг указанному субъекту. Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят путем внутривенной инфузии. Согласно одному варианту реализации указанный модулятор иммунных контрольных точек вводят указанному субъекту два раза, три раза, четыре раза или более. Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят указанному субъекту в тот же день, что и мРНК-вакцину.

Согласно некоторым вариантам реализации указанный рак выбран из группы, состоящей из немелкоклеточного рака легкого (НМРЛ), мелкоклеточного рака легкого, меланомы, уротелиальной карциномы мочевого пузыря, HPV-отрицательной плоскоклеточной карциномы головы и шеи (HNSCC) и солидного злокачественного образования с высокой микросателлитной нестабильностью (MSI H) / дефицитом исправления ошибок спаривания (MMR). Согласно одному варианту реализации в указанном НМРЛ отсутствует сенсибилизирующая мутация рЭФР и/или транслокация ALK. Согласно другому варианту реализации указанное солидное злокачественное образование с высокой микросателлитной нестабильностью (MSI H) / дефицитом исправления ошибок спаривания (MMR) выбрано из группы, состоящей из рака ободочной и прямой кишки, аденокарциномы желудка, аденокарциномы пищевода и рака эндометрия. Согласно некоторым вариантам реализации указанный рак выбран из рака поджелудочной железы, брюшины, толстого кишечника, тонкого кишечника, желчных путей, легкого, эндометрия, яичника, половых путей, желудочно-кишечного тракта, шейки матки, желудка, мочевыводящих путей, ободочной кишки, прямой кишки, гематопоэтических и лимфоидных тканей.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая одну или более мРНК, каждая из которых содержит открытую рамку считывания, кодирующую пептидный эпитоп ракового антигена, введенные в состав липидной микрочастицы, при этом указанная мРНК-вакцина кодирует 5-100 пептидных эпитопов, и по меньшей мере два из указанных пептидных эпитопов представляют собой персонализированные раковые антигены; и фармацевтически приемлемый носитель или вспомогательное вещество.

Согласно другим аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая одну или более мРНК, каждая из которых содержит открытую рамку считывания, кодирующую пептидный эпитоп ракового антигена, при этом указанная мРНК-вакцина кодирует 5-100 пептидных эпитопов и по меньшей мере три из указанных пептидных эпитопов представляют собой комплексные варианты, а по меньшей мере два из указанных пептидных эпитопов представляют собой точечные мутации; и фармацевтически приемлемый носитель или вспомогательное вещество.

Согласно некоторым вариантам реализации указанная липидная наночастица характеризуется следующим молярным отношением: приблизительно 20-60% катионного липида: 5-25% некатионного липида: 25-55% стерина; и 0,5-15% ПЭГ-модифицированного липида. Согласно некоторым вариантам реализации указанный катионный липид выбран из группы, состоящей из например, 2,2-дилинолеил-4-диметиламиноэтил-[1,3]-диоксолана (DLin-KC2-DMA), дилинолеилметил-4-диметиламинобутирата (DLin-MC3-DMA) и ди((Z)-нон-2-ен-1-ил) 9-((4-(диметиламино)бутаноил)окси)гептадекандиоата (L319). Согласно другим вариантам реализации указанная липидная наночастица содержит соединение формулы (I). Согласно некоторым вариантам реализации соединение формулы (I) представляет собой соединение 25.

Согласно некоторым вариантам реализации указанная липидная наночастица обладает значением полидисперсности менее 0,4. Согласно некоторым вариантам реализации указанная липидная наночастица обладает суммарным нейтральным зарядом при нейтральном значении pH.

Согласно некоторым вариантам реализации вакцина представляет собой мРНК, содержащую открытую рамку считывания, кодирующую конкатемерный раковый антиген, состоящий из 5-100 пептидных эпитопов. Согласно другим вариантам реализации по меньшей мере два из указанных пептидных эпитопов отделены друг от друга единственным остатком глицина. Согласно другим вариантам реализации указанный конкатемерный раковый антиген содержит 20-40 пептидных эпитопов. Согласно некоторым вариантам реализации все пептидные эпитопы отделены друг от друга единственным остатком глицина. Согласно некоторым вариантам реализации по меньшей мере два из указанных пептидных эпитопов прямо соединены между собой без линкера.

Каждый пептидный эпитоп согласно вариантам реализации содержит 25-35 аминокислот и включает центрально расположенную SNP-мутацию.

Согласно некоторым вариантам реализации по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса I, полученных от субъекта. Согласно другим вариантам реализации по меньшей мере 30% пептидных эпитопов обладают максимальной аффинностью в отношении молекул MHC класса II, полученных от субъекта. Согласно другим дополнительным вариантам реализации по меньшей мере 50% пептидных эпитопов обладают предсказанной аффинностью связывания IC ˃500 нМ в отношении HLA-A, HLA-B и/или DRB1.

Согласно некоторым вариантам реализации одна или более мРНК согласно настоящему изобретению кодируют до 20 пептидных эпитопов. Согласно некоторым вариантам реализации одна или более мРНК согласно настоящему изобретению кодируют до 50 эпитопов. Согласно некоторым вариантам реализации одна или более мРНК согласно настоящему изобретению кодируют до 100 эпитопов.

В соответствии с другими вариантами реализации указанная мРНК, кодирующая пептидные эпитопы, скомпонована таким образом, что указанные пептидные эпитопы расположены в порядке, минимизирующем образование псевдоэпитопов.

Каждый пептидный эпитоп может содержать 31 аминокислот и включает центрально расположенную SNP-мутацию с 15 фланкирующими аминокислотами с каждой стороны SNP-мутации.

Согласно некоторым вариантам реализации обращенная к TCR поверхность каждого эпитопа обладает незначительным сходством с эндогенными белками.

Согласно другим дополнительным вариантам реализации указанная мРНК дополнительно содержит антиген-приманку. Указанный антиген-приманка может представлять собой антиген инфекционного заболевания.

Согласно другим вариантам реализации по меньшей мере один из указанных пептидных эпитопов представляет собой традиционный раковый антиген. Вакцина, согласно некоторым вариантам реализации, включает мРНК, содержащую открытую рамку считывания, кодирующую один или более рекуррентных полиморфизмов. Указанные один или более рекуррентных полиморфизмов могут содержать рекуррентную соматическую онкомутацию в p53. Указанные одна или более рекуррентных соматических онкомутаций в p53, согласно некоторым вариантам реализации, выбраны из группы, состоящей из: (A) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.T125, индуцирующих сохранение интрона с пептидной последовательностью TAKSVTCTVSCPEGLASMRLQCLAVSPCISFVWNFGIPLHPLASCQCFFIVYPLNV (SEQ ID NO: 232), которая содержит эпитопы AVSPCISFVW (SEQ ID NO: 233) (HLA-B*57:01, HLA-B*58:01), HPLASCQCFF (SEQ ID NO: 234) (HLA-B*35:01, HLA-B*53:01), FVWNFGIPL (SEQ ID NO: 235) (HLA-A*02:01, HLA-A*02:06, HLA-B*35:01); (B) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.331, индуцирующих сохранение интрона с пептидной последовательностью EYFTLQVLSLGTSYQVESFQSNTQNAVFFLTVLPAIGAFAIRGQ (SEQ ID NO: 236), которая содержит эпитопы LQVLSLGTSY (SEQ ID NO: 237) (HLA-B*15:01), FQSNTQNAVF (SEQ ID NO: 238) (HLA-B*15:01); (C) мутаций в каноническом 3’-сайте сплайсинга возле кодона p.126, индуцирующих 3’-сайт скрытого альтернативного экзонного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности AKSVTCTMFCQLAK (SEQ ID NO: 239), которая содержит эпитопы CTMFCQLAK (SEQ ID NO: 240) (HLA-A*11:01), KSVTCTMF (SEQ ID NO: 241) (HLA-B*58:01); и/или (D) мутаций в каноническом 5’-сайте сплайсинга возле кодона p.224, индуцирующих 5’-сайт скрытого альтернативного интронного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности VPYEPPEVWLALTVPPSTAWAA (SEQ ID NO: 242), которая содержит эпитопы VPYEPPEVW (SEQ ID NO: 243) (HLA-B*53:01, HLA-B*51:01), LTVPPSTAW (SEQ ID NO: 244) (HLA-B*58:01, HLA-B*57:01), где положения кодонов транскрипта относятся к каноническому полноразмерному транскрипту p53 ENST00000269305 (SEQ ID NO: 245) из аннотации генома человека Ensembl v83.

Согласно некоторым вариантам реализации указанная мРНК дополнительно содержит открытую рамку считывания, кодирующую модулятор иммунных контрольных точек. Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина содержит модулятор иммунных контрольных точек. Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек представляет собой ингибирующий контрольные точки полипептид. Согласно некоторым вариантам реализации указанный ингибирующий контрольные точки полипептид представляет собой антитело или его фрагмент, специфически связывающийся с молекулой, выбранной из группы, состоящей из PD-1, TIM-3, VISTA, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR и LAG3. Согласно некоторым вариантам реализации указанный ингибирующий контрольные точки полипептид представляет собой антитело против CTLA4 или против PD1. Согласно некоторым вариантам реализации указанное антитело против PD-1 представляет собой пембролизумаб.

Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина не содержит стабилизирующего агента.

Согласно некоторым вариантам реализации указанная мРНК включает по меньшей мере одну химическую модификацию. Указанная химическая модификация может быть выбрана из группы, состоящей из псевдоуридина, N1-метилпсевдоуридина, 2-тиоуридина, 4’-тиоуридина, 5-метилцитозина, 2-тио-1-метил-1-деазапсевдоуридина, 2-тио-1-метилпсевдоуридина, 2-тио-5-азауридина, 2-тиодигидропсевдоуридина, 2-тиодигидроуридина, 2-тиопсевдоуридина, 4-метокси-2-тиопсевдоуридина, 4-метоксипсевдоуридина, 4-тио-1-метилпсевдоуридина, 4-тиопсевдоуридина, 5-азауридина, дигидропсевдоуридина, 5-метилуридина, 5-метилуридина, 5-метоксиуридина и 2’-O-метилуридина.

Согласно другим аспектам предложен способ вакцинации субъекта. Указанный способ включает введение страдающему раком субъекту мРНК-вакцины согласно описанию в настоящем документе.

Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят, используя уровень дозы, достаточный для доставки от 10 мкг до 400 мкг мРНК-вакцины указанному субъекту. Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят, используя уровень дозы, достаточный для доставки 0,033 мг, 0,1 мг, 0,2 мг или 0,4 мг указанному субъекту. Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят указанному субъекту два раза, три раза, четыре раза или более. Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят один раз в сутки каждые три недели.

Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят внутрикожным, внутримышечным и/или подкожным путем. Согласно некоторым вариантам реализации указанную мРНК-вакцину вводят внутримышечно.

Согласно некоторым вариантам реализации указанный способ дополнительно включает введение указанному субъекту дополнительного противоракового терапевтического агента; указанный дополнительный противораковый терапевтический агент необязательно представляет собой модулятор иммунных контрольных точек. Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек представляет собой ингибирующий контрольные точки полипептид. Согласно некоторым вариантам реализации указанный ингибирующий контрольные точки полипептид представляет собой антитело или его фрагмент, специфически связывающийся с молекулой, выбранной из группы, состоящей из PD-1, TIM-3, VISTA, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR и LAG3. Согласно некоторым вариантам реализации указанный ингибирующий контрольные точки полипептид представляет собой антитело против PD1. Согласно некоторым вариантам реализации указанное антитело против PD-1 представляет собой пембролизумаб.

Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят, используя уровень дозы, достаточный для доставки 100-300 мг указанному субъекту. Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят, используя уровень дозы, достаточный для доставки 200 мг указанному субъекту.

Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят путем внутривенной инфузии.

Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят указанному субъекту два раза, три раза, четыре раза или более. Согласно некоторым вариантам реализации указанный модулятор иммунных контрольных точек вводят указанному субъекту в тот же день, что и мРНК-вакцину.

Согласно некоторым вариантам реализации указанный рак выбран из группы, состоящей из немелкоклеточного рака легкого (НМРЛ), мелкоклеточного рака легкого, меланомы, уротелиальной карциномы мочевого пузыря, HPV-отрицательной плоскоклеточной карциномы головы и шеи (HNSCC) и солидного злокачественного образования с высокой микросателлитной нестабильностью (MSI H) / дефицитом исправления ошибок спаривания (MMR). Согласно некоторым вариантам реализации в указанном НМРЛ отсутствует сенсибилизирующая мутация рЭФР и/или транслокация ALK. Согласно некоторым вариантам реализации указанное солидное злокачественное образование с высокой микросателлитной нестабильностью (MSI H) / дефицитом исправления ошибок спаривания (MMR) выбрано из группы, состоящей из рака ободочной и прямой кишки, аденокарциномы желудка, аденокарциномы пищевода и рака эндометрия. Согласно некоторым вариантам реализации указанный рак выбран из рака поджелудочной железы, брюшины, толстого кишечника, тонкого кишечника, желчных путей, легкого, эндометрия, яичника, половых путей, желудочно-кишечного тракта, шейки матки, желудка, мочевыводящих путей, ободочной кишки, прямой кишки, гематопоэтических и лимфоидных тканей.

Согласно другим аспектам предложен способ получения противораковой мРНК-вакцины. Указанный способ включает выделение образца из организма субъекта, идентификацию совокупности раковых антигенов в образце, определение иммуногенных эпитопов из указанной совокупности раковых антигенов, приготовление противораковой мРНК-вакцины, содержащей открытую рамку считывания, кодирующую указанные раковые антигены. Согласно другим аспектам настоящего изобретения предложен способ получения мРНК, кодирующей конкатемерный раковый антиген, содержащей от 1000 до 3000 нуклеотидов. Указанный способ включает

(a) связывание первого полинуклеотида, содержащего открытую рамку считывания, кодирующую раковый антиген по любому из предшествующих пунктов, и второго полинуклеотида, содержащего 5′-UTR, с полинуклеотидом, конъюгированным с твердой подложкой;

(b) лигирование 3′-конца указанного второго полинуклеотида с 5′-концом указанного первого полинуклеотида в подходящих условиях, где подходящие условия включают ДНК-лигазу, с получением таким образом первого продукта лигирования;

(c) лигирование 5’-конца третьего полинуклеотида, содержащего 3′-UTR, с 3’-концом указанного первого продукта лигирования в подходящих условиях, где подходящие условия включают РНК-лигазу, с получением таким образом второго продукта лигирования; и

(d) высвобождение указанного второго продукта лигирования с твердой подложки,

с получением таким образом мРНК, кодирующей конкатемерный раковый антиген, содержащей от 1000 до 3000 нуклеотидов.

Согласно другим аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая конкатемерный раковый антиген, которая может быть получена в соответствии со способами, описанными в настоящем документе.

В соответствии с другими аспектами настоящего изобретения предложен способ лечения субъекта персонализированной противораковой мРНК-вакциной. Указанный способ включает идентификацию набора неоэпитопов путем анализа транскриптома пациента и/или экзома пациента из образца с получением специфического для пациента метанома, выбор набора неоэпитопов для вакцины из указанного метанома на основании силы связывания MHC, разнообразия связывания MHC, предсказанной степени иммуногенности, низкой аутореактивности, присутствия активирующих онкогены мутаций и/или T-клеточной реактивности; получение мРНК-вакцины, кодирующей указанный набор неоэпитопов, и введение указанной мРНК-вакцины указанному субъекту в пределах двух месяцев после выделения образца из организма указанного субъекта. Согласно некоторым вариантам реализации идентификация включает анализ транскриптома пациента и/или экзома пациента из образца, полученного от субъекта. Согласно некоторым вариантам реализации указанный образец, полученный от субъекта, представляет собой биологический образец, например, биоптат. Согласно некоторым вариантам реализации указанный способ дополнительно включает выделение образца, полученного от субъекта. Согласно некоторым вариантам реализации идентификация включает анализ тканеспецифической экспрессии в доступных базах данных.

Согласно другим аспектам настоящего изобретения предложен способ идентификации набора неоэпитопов для применения в персонализированной противораковой мРНК-вакцине, содержащей один или более полинуклеотидов, которые кодируют указанный набор неоэпитопов. Указанный способ включает:

a. идентификацию специфического для пациента метанома путем анализа транскриптома пациента и экзома пациента,

b. выбор поднабора из 15-500 неоэпитопов из мутанома с использованием взвешенного значения для неоэпитопов, основанного по меньшей мере на трех показателях из: оценки экспрессии на уровне генов или транскриптов при RNA-seq у пациента; показателя достоверности при распознавании вариантов; аллель-специфической экспрессии при RNA-seq; консервативной или неконсервативной замены аминокислот; положения точечной мутации (индекс центрирования для повышенного вовлечения TCR); положения точечной мутации (индекс привязки для дифференциального связывания HLA); «самость»: <100% гомологии коровых эпитопов по данным WES (полноэкзомного секвенирования) пациента; HLA-A и -B IC50 для 8-меров-11-меров; HLA-DRB1 IC50 для 15-меров-20-меров; показателя неизбирательности (т.е. числа HLA пациента, которые будут связаны согласно прогнозу); HLA-C IC50 для 8-меров-11-меров; HLA-DRB3-5 IC50 для 15-меров-20-меров; HLA-DQB1/A1 IC50 для 15-меров-20-меров; HLA-DPB1/A1 IC50 для 15-меров-20-меров; пропорции класса I относительно класса II; разнообразия охваченных аллотипов HLA-A, -B и DRB1 пациента; пропорции точечных мутаций/комплексных эпитопов (например, со сдвигом рамки); показателей связывания псевдоэпитопов HLA; присутствия и/или распространенности ридов RNAseq, и

c. выбор набора неоэпитопов для применения в персонализированной противораковой мРНК-вакцине из указанного поднабора на основании максимального взвешенного значения, при этом указанный набор неоэпитопов содержит 15-40 неоэпитопов.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, содержащая одну или более мРНК, каждая из которых содержит открытую рамку считывания, кодирующую пептидный эпитоп ракового антигена, при этом указанная мРНК дополнительно содержит сайт связывания миРНК. Согласно определенному варианту реализации указанная вакцина кодирует 5-100 пептидных эпитопов.

Согласно некоторым вариантам реализации вакцины на основе нуклеиновых кислот, описанные в настоящем документе, химически модифицированы. Согласно другим вариантам реализации указанные вакцины на основе нуклеиновых кислот не модифицированы.

Согласно другим дополнительным аспектам предложены композиции и способы для вакцинации субъекта, включающие введение указанному субъекту вакцины на основе нуклеиновой кислоты, содержащей один или более РНК-полинуклеотидов, содержащих открытую рамку считывания, кодирующую эпитоп ракового антигена, при этом указанный РНК-полинуклеотид не содержит элемента стабилизации, и адъювант не входит в состав с вакциной или не вводится совместно с вакциной.

Согласно другим аспектам настоящего изобретения предложена композиция для вакцинации или способ вакцинации субъекта, включающий введение указанному субъекту вакцины на основе нуклеиновой кислоты, содержащей один или более РНК-полинуклеотидов, содержащих открытую рамку считывания, кодирующую первый эпитоп ракового антигена, при этом указанному субъекту вводят вакцину на основе нуклеиновой кислоты в дозировке, составляющей от 10 мкг/кг до 400 мкг/кг. Согласно некоторым вариантам реализации дозировка РНК-полинуклеотида составляет 1-5 мкг, 5-10 мкг, 10-15 мкг, 15-20 мкг, 10-25 мкг, 20-25 мкг, 20-50 мкг, 30-50 мкг, 40-50 мкг, 40-60 мкг, 60-80 мкг, 60-100 мкг, 50-100 мкг, 80-120 мкг, 40-120 мкг, 40-150 мкг, 50-150 мкг, 50-200 мкг, 80-200 мкг, 100-200 мкг, 120-250 мкг, 150-250 мкг, 180-280 мкг, 200-300 мкг, 50-300 мкг, 80-300 мкг, 100-300 мкг, 40-300 мкг, 50-350 мкг, 100-350 мкг, 200-350 мкг, 300-350 мкг, 320-400 мкг, 40-380 мкг, 40-100 мкг, 100-400 мкг, 200-400 мкг или 300-400 мкг на дозу. Согласно некоторым вариантам реализации указанную вакцину на основе нуклеиновой кислоты вводят указанному субъекту путем внутрикожной или внутримышечной инъекции. Согласно некоторым вариантам реализации указанную вакцину на основе нуклеиновой кислоты вводят указанному субъекту на нулевой день. Согласно некоторым вариантам реализации вторую дозу вакцины на основе нуклеиновой кислоты вводят указанному субъекту на 21 день.

Согласно некоторым вариантам реализации в вакцину на основе нуклеиновой кислоты, которую вводят указанному субъекту, включают РНК-полинуклеотид в дозировке 25 мкг. Согласно некоторым вариантам реализации в вакцину на основе нуклеиновой кислоты, которую вводят указанному субъекту, включают РНК-полинуклеотид в дозировке 100 мкг. Согласно некоторым вариантам реализации в вакцину на основе нуклеиновой кислоты, которую вводят указанному субъекту, включают РНК-полинуклеотид в дозировке 50 мкг. Согласно некоторым вариантам реализации в вакцину на основе нуклеиновой кислоты, которую вводят указанному субъекту, включают РНК-полинуклеотид в дозировке 75 мкг. Согласно некоторым вариантам реализации в вакцину на основе нуклеиновой кислоты, которую вводят указанному субъекту, включают РНК-полинуклеотид в дозировке 150 мкг. Согласно некоторым вариантам реализации в вакцину на основе нуклеиновой кислоты, которую вводят указанному субъекту, включают РНК-полинуклеотид в дозировке 400 мкг. Согласно некоторым вариантам реализации в вакцину на основе нуклеиновой кислоты, которую вводят указанному субъекту, включают РНК-полинуклеотид в дозировке 200 мкг. Согласно некоторым вариантам реализации уровень накопления указанного РНК-полинуклеотида в 100 раз выше в локальном лимфатическом узле по сравнению с отдаленным лимфатическим узлом. Согласно другим вариантам реализации указанная вакцина на основе нуклеиновой кислоты химически модифицирована и согласно другим вариантам реализации указанная вакцина на основе нуклеиновой кислоты химически не модифицирована.

Согласно некоторым вариантам реализации эффективное количество представляет собой общую дозу 1-100 мкг. Согласно некоторым вариантам реализации эффективное количество представляет собой общую дозу 100 мкг. Согласно некоторым вариантам реализации эффективное количество представляет собой дозу 25 мкг, которую вводят указанному субъекту в общей сложности один или два раза. Согласно некоторым вариантам реализации эффективное количество представляет собой дозу 100 мкг, которую вводят указанному субъекту в общей сложности два раза. Согласно некоторым вариантам реализации эффективное количество представляет собой дозу 1 мкг - 10 мкг, 1 мкг - 20 мкг, 1 мкг - 30 мкг, 5 мкг - 10 мкг, 5 мкг - 20 мкг, 5 мкг - 30 мкг, 5 мкг - 40 мкг, 5 мкг - 50 мкг, 10 мкг - 15 мкг, 10 мкг - 20 мкг, 10 мкг - 25 мкг, 10 мкг - 30 мкг, 10 мкг - 40 мкг, 10 мкг - 50 мкг, 10 мкг - 60 мкг, 15 мкг - 20 мкг, 15 мкг - 25 мкг, 15 мкг - 30 мкг, 15 мкг - 40 мкг, 15 мкг - 50 мкг, 20 мкг - 25 мкг, 20 мкг - 30 мкг, 20 мкг - 40 мкг, 20 мкг - 50 мкг, 20 мкг - 60 мкг, 20 мкг - 70 мкг, 20 мкг - 75 мкг, 30 мкг - 35 мкг, 30 мкг - 40 мкг, 30 мкг - 45 мкг, 30 мкг - 50 мкг, 30 мкг - 60 мкг, 30 мкг - 70 мкг, 30 мкг - 75 мкг, который может быть введена указанному субъекту в общей сложности один или два раза, или более.

Согласно аспектам настоящего изобретения предложена вакцина на основе нуклеиновой кислоты, содержащая один или более РНК-полинуклеотидов, содержащих открытую рамку считывания, кодирующую первый антигенный полипептид, при этом указанный РНК-полинуклеотид не содержит элемента стабилизации, и фармацевтически приемлемый носитель или вспомогательное вещество, при этом в вакцину не включен адъювант. Согласно некоторым вариантам реализации указанный элемент стабилизации представляет собой гистон типа «петля на стебле». Согласно некоторым вариантам реализации указанный элемент стабилизации представляет собой последовательность нуклеиновой кислоты с бо́льшим содержанием GC по сравнению с последовательностью дикого типа.

Согласно аспектам предложены вакцины на основе нуклеиновых кислот, содержащие один или более РНК-полинуклеотидов, содержащих открытую рамку считывания, содержащую по меньшей мере одну химическую модификацию или, необязательно, не содержащую химических модификаций, кодирующую первый антигенный полипептид, при этом присутствие указанного РНК-полинуклеотида в составе для введения субъекту in vivo обеспечивает уровень экспрессии антигена у указанного субъекта, значимо превышающий уровень экспрессии антигена, обеспечиваемый мРНК-вакциной, содержащей стабилизирующий элемент или имеющей в составе адъювант, и кодирующей указанный первый антигенный полипептид.

Согласно другим аспектам предложены вакцины на основе нуклеиновых кислот, содержащие один или более РНК-полинуклеотидов, содержащих открытую рамку считывания, содержащую по меньшей мере одну химическую модификацию или, необязательно, не содержащую химических модификаций, кодирующую первый антигенный полипептид, при этом указанная вакцина содержит по меньшей мере в 10 раз меньше РНК-полинуклеотида, чем необходимо для немодифицированной мРНК-вакцины для получения эквивалентного титра антител.

Согласно аспектам настоящего изобретения также предложена порционная вакцина, содержащая от 10 мкг до 400 мкг одного или более РНК-полинуклеотидов, содержащих открытую рамку считывания, содержащую по меньшей мере одну химическую модификацию или, необязательно, не содержащую химических модификаций, кодирующую первый антигенный полипептид; и фармацевтически приемлемый носитель или вспомогательное вещество, введенные в состав для доставки субъекту-человеку. Согласно некоторым вариантам реализации указанная вакцина дополнительно содержит катионную липидную наночастицу.

Согласно аспектам настоящего изобретения предложены наборы, включающие емкость, содержащую противораковую мРНК-вакцину согласно описанию в настоящем документе. Согласно некоторым вариантам реализации указанная емкость содержит от 0,1 мг до 1 мг мРНК. Согласно некоторым вариантам реализации указанная емкость содержит 0,35 мг мРНК. Согласно некоторым вариантам реализации концентрация указанной мРНК составляет 1 мг/мл.

Согласно некоторым вариантам реализации общее содержание липидов в указанной емкости составляет 5-15 мг. Согласно некоторым вариантам реализации общее содержание липидов в указанной емкости составляет 7 мг. Согласно некоторым вариантам реализации общая концентрация липидов составляет 20 мг/мл.

Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина представляет собой жидкость.

Согласно некоторым вариантам реализации указанный набор дополнительно включает шприц. Согласно некоторым вариантам реализации указанный шприц подходит для внутримышечного введения.

Согласно аспектам настоящего изобретения предложены способы вакцинации субъекта, включающие введение указанному субъекту единственной дозы от 25 мкг/кг до 400 мкг/кг вакцины на основе нуклеиновой кислоты, содержащей один или более РНК-полинуклеотидов, содержащих открытую рамку считывания, кодирующую первый антигенный полипептид, в эффективном количестве для вакцинации указанного субъекта.

Согласно некоторым аспектам настоящего изобретения предложена противораковая мРНК-вакцина, которая может включать активирующую мутацию онкогена в качестве антигена. Согласно некоторым вариантам реализации указанная активирующая мутация онкогена представляет собой мутацию KRAS. Согласно некоторым вариантам реализации указанная мутация KRAS представляет собой мутацию G12. Согласно некоторым вариантам реализации указанная мутация KRAS G12 выбрана из мутации KRAS G12D, G12V, G12S, G12C, G12A и G12R, например, указанная мутация KRAS G12 выбрана из мутации KRAS G12D, G12V и G12S. Согласно другим вариантам реализации указанная мутация KRAS представляет собой мутацию G13, например, указанная мутация KRAS G13 представляет собой мутацию KRAS G13D. Согласно некоторым вариантам реализации указанная активирующая мутация онкогена представляет собой мутацию H-RAS или N-RAS.

Согласно некоторым вариантам реализации специалист выбирает мутацию KRAS, подтип HLA и тип опухоли на основании руководящих принципов, предложенных в настоящем документе, и получает KRAS-вакцину для терапии. Согласно некоторым вариантам реализации указанные мутации KRAS выбраны из: G12C, G12V, G12D, G13D. Согласно некоторым вариантам реализации указанный подтип HLA выбран из: A*02:01, C*07:01, C*04:01, C*07:02. Согласно некоторым вариантам реализации указанный тип опухоли выбран из опухоли ободочной и прямой кишки, поджелудочной железы, легкого и эндометрия.

Согласно некоторым вариантам реализации мутация HRAS представляет собой мутацию в кодоне 12, кодоне 13 или кодоне 61. Согласно некоторым вариантам реализации указанный HRAS мутация представляет собой мутацию 12V, 61L или 61R.

Согласно некоторым вариантам реализации мутация NRAS представляет собой мутацию в кодоне 12, кодоне 13 или кодоне 61. Согласно некоторым вариантам реализации мутация NRAS представляет собой мутацию 12D, 13D, 61K или 61R.

Согласно некоторым вариантам реализации настоящего изобретения предложена противораковая мРНК-вакцина, которая содержит мРНК, содержащую открытую рамку считывания, кодирующую конкатемер из двух или более пептидов активирующей мутации онкогена. Согласно некоторым вариантам реализации по меньшей мере два из указанных пептидных эпитопов отделены друг от друга единственным остатком глицина. Согласно некоторым вариантам реализации указанный конкатемер содержит 3-10 пептидов активирующей мутации онкогена. Согласно некоторым таким вариантам реализации все пептидные эпитопы отделены друг от друга единственным остатком глицина. Согласно другим вариантам реализации по меньшей мере два из указанных пептидных эпитопов прямо соединены между собой без линкера.

Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина дополнительно содержит противораковый терапевтический агент. Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина дополнительно содержит ингибирующий контрольные точки полипептид. Например, согласно некоторым вариантам реализации указанный ингибирующий контрольные точки полипептид представляет собой антитело или его фрагмент, специфически связывающийся с молекулой, выбранной из группы, состоящей из PD-1, TIM-3, VISTA, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR и LAG3. Согласно другим вариантам реализации указанная противораковая мРНК-вакцина дополнительно содержит антиген-приманку. Например, согласно некоторым вариантам реализации указанный антиген-приманка представляет собой антиген инфекционного заболевания.

Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина не содержит стабилизирующего агента.

Согласно некоторым вариантам реализации указанная мРНК введена в состав липидной наночастицы-носителя, такой как липидная наночастица-носитель с молярным отношением приблизительно 20-60% катионного липида: 5-25% некатионного липида: 25-55% стерина; и 0,5-15% ПЭГ-модифицированного липида. Указанный катионный липид может быть выбран из группы, состоящей из например, 2,2-дилинолеил-4-диметиламиноэтил-[1,3]-диоксолана (DLin-KC2-DMA), дилинолеил-метил-4-диметиламинобутирата (DLin-MC3-DMA) и ди((Z)-нон-2-ен-1-ил) 9-((4-(диметиламино)бутаноил)окси)гептадекандиоата (L319).

Согласно некоторым вариантам реализации указанная мРНК включает по меньшей мере одну химическую модификацию. Указанная химическая модификация может быть выбрана из группы, состоящей из псевдоуридина, N1-метилпсевдоуридина, 2-тиоуридина, 4’-тиоуридина, 5-метилцитозина, 2-тио-1-метил-1-деазапсевдоуридина, 2-тио-1-метилпсевдоуридина, 2-тио-5-азауридина, 2-тиодигидропсевдоуридина, 2-тиодигидроуридина, 2-тиопсевдоуридина, 4-метокси-2-тиопсевдоуридина, 4-метоксипсевдоуридина, 4-тио-1-метилпсевдоуридина, 4-тиопсевдоуридина, 5-азауридина, дигидропсевдоуридина, 5-метилуридина, 5-метилуридина, 5-метоксиуридина и 2’-O-метилуридина.

Согласно другим аспектам предложен способ лечения субъекта. Указанный способ включает введение страдающему раком субъекту противораковой мРНК-вакцины по любому из вышеупомянутых вариантов реализации. Согласно некоторым вариантам реализации указанная противораковую мРНК-вакцину вводят в комбинации с противораковым терапевтическим агентом. Согласно некоторым вариантам реализации указанная противораковую мРНК-вакцину вводят в комбинации с ингибирующим контрольные точки полипептидом. Например, согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина представляет собой антитело или его фрагмент, специфически связывающийся с молекулой, выбранной из группы, состоящей из PD-1, TIM-3, VISTA, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR и LAG3.

Способы, предложенные в настоящем документе, могут применяться для лечения субъекта, страдающего раком. Согласно некоторым вариантам реализации указанный рак выбран из рака поджелудочной железы, брюшины, толстого кишечника, тонкого кишечника, желчных путей, легкого, эндометрия, яичника, половых путей, желудочно-кишечного тракта, шейки матки, желудка, мочевыводящих путей, ободочной кишки, прямой кишки, гематопоэтических и лимфоидных тканей. Согласно некоторым вариантам реализации указанный рак представляет собой рак ободочной и прямой кишки.

Согласно некоторым вариантам реализации дозировка противораковой мРНК-вакцины, вводимой субъекту, составляет 1-5 мкг, 5-10 мкг, 10-15 мкг, 15-20 мкг, 10-25 мкг, 20-25 мкг, 20-50 мкг, 30-50 мкг, 40-50 мкг, 40-60 мкг, 60-80 мкг, 60-100 мкг, 50-100 мкг, 80-120 мкг, 40-120 мкг, 40-150 мкг, 50-150 мкг, 50-200 мкг, 80-200 мкг, 100-200 мкг, 120-250 мкг, 150-250 мкг, 180-280 мкг, 200-300 мкг, 50-300 мкг, 80-300 мкг, 100-300 мкг, 40-300 мкг, 50-350 мкг, 100-350 мкг, 200-350 мкг, 300-350 мкг, 320-400 мкг, 40-380 мкг, 40-100 мкг, 100-400 мкг, 200-400 мкг или 300-400 мкг на дозу. Согласно некоторым вариантам реализации указанную противораковую мРНК-вакцину вводят указанному субъекту путем внутрикожной или внутримышечной инъекции. Согласно некоторым вариантам реализации указанная противораковую мРНК-вакцину вводят указанному субъекту на нулевой день. Согласно некоторым вариантам реализации вторую дозу противораковой мРНК-вакцины вводят указанному субъекту на 21 день.

Согласно некоторым вариантам реализации указанному субъекту вводят указанную противораковую мРНК-вакцину в дозировке 25 мкг. Согласно некоторым вариантам реализации указанному субъекту вводят указанную противораковую мРНК-вакцину в дозировке 100 мкг. Согласно некоторым вариантам реализации указанному субъекту вводят указанную противораковую мРНК-вакцину в дозировке 50 мкг. Согласно некоторым вариантам реализации указанному субъекту вводят указанную противораковую мРНК-вакцину в дозировке 75 мкг. Согласно некоторым вариантам реализации указанному субъекту вводят указанную противораковую мРНК-вакцину в дозировке 150 мкг. Согласно некоторым вариантам реализации указанному субъекту вводят указанную противораковую мРНК-вакцину в дозировке 400 мкг. Согласно некоторым вариантам реализации указанную противораковую мРНК-вакцину вводят указанному субъекту в дозировке 200 мкг. Согласно некоторым вариантам реализации уровень накопления указанной противораковой мРНК-вакцины в 100 раз выше в локальном лимфатическом узле по сравнению с отдаленным лимфатическим узлом. Согласно другим вариантам реализации противораковая мРНК-вакцина химически модифицирована; согласно другим вариантам реализации противораковая мРНК-вакцина химически не модифицирована.

Согласно некоторым вариантам реализации эффективное количество представляет собой общую дозу 1-100 мкг. Согласно некоторым вариантам реализации эффективное количество представляет собой общую дозу 100 мкг. Согласно некоторым вариантам реализации эффективное количество представляет собой дозу 25 мкг, которую вводят указанному субъекту в общей сложности один или два раза. Согласно некоторым вариантам реализации эффективное количество представляет собой дозу 100 мкг, которую вводят указанному субъекту в общей сложности два раза. Согласно некоторым вариантам реализации эффективное количество представляет собой дозу 1 мкг - 10 мкг, 1 мкг - 20 мкг, 1 мкг - 30 мкг, 5 мкг - 10 мкг, 5 мкг - 20 мкг, 5 мкг - 30 мкг, 5 мкг - 40 мкг, 5 мкг - 50 мкг, 10 мкг - 15 мкг, 10 мкг - 20 мкг, 10 мкг - 25 мкг, 10 мкг - 30 мкг, 10 мкг - 40 мкг, 10 мкг - 50 мкг, 10 мкг - 60 мкг, 15 мкг - 20 мкг, 15 мкг - 25 мкг, 15 мкг - 30 мкг, 15 мкг - 40 мкг, 15 мкг - 50 мкг, 20 мкг - 25 мкг, 20 мкг - 30 мкг, 20 мкг - 40 мкг 20 мкг - 50 мкг, 20 мкг - 60 мкг, 20 мкг - 70 мкг, 20 мкг - 75 мкг, 30 мкг - 35 мкг, 30 мкг - 40 мкг, 30 мкг - 45 мкг 30 мкг - 50 мкг, 30 мкг - 60 мкг, 30 мкг - 70 мкг, 30 мкг - 75 мкг, которая может быть введена указанному субъекту в общей сложности один или два раза, или более.

Согласно аспектам настоящего изобретения предложены способы получения мРНК, кодирующей конкатемерный раковый антиген, содержащий от 1000 до 3000 нуклеотидов, включающие: (a) связывание первого полинуклеотида, содержащего открытую рамку считывания, кодирующую раковый антиген по любому из пп. 1-103, и второго полинуклеотида, содержащего 5′-UTR, с полинуклеотидом, конъюгированным с твердой подложкой; (b) лигирование 3′-конца указанного второго полинуклеотида с 5′-концом указанного первого полинуклеотида в подходящих условиях, где подходящие условия включают ДНК-лигазу, с получением таким образом первого продукта лигирования; (c) лигирование 5’-конца третьего полинуклеотида, содержащего 3′-UTR, с 3’-концом указанного первого продукта лигирования в подходящих условиях, где подходящие условия включают РНК-лигазу, с получением таким образом второго продукта лигирования; и (d) высвобождение указанного второго продукта лигирования с твердой подложки, с получением таким образом мРНК, кодирующей конкатемерный раковый антиген, содержащей от 1000 до 3000 нуклеотидов.

Согласно аспектам настоящего изобретения предложены способы лечения субъекта персонализированной противораковой мРНК-вакциной, включающие идентификацию набора неоэпитопов для получения специфического для пациента метанома, выбор набора неоэпитопов для вакцины из указанного метанома на основании силы связывания MHC, разнообразия связывания MHC, предсказанной степени иммуногенности, низкой аутореактивности и/или реактивности в отношении T-клеток; получение мРНК-вакцины, кодирующей указанный набор неоэпитопов; и введение указанной мРНК-вакцины указанному субъекту в пределах двух месяцев после выделения образца из организма указанного субъекта.

Согласно аспектам настоящего изобретения предложены способы идентификации набора неоэпитопов для применения в персонализированной противораковой мРНК-вакцине, содержащей один или более полинуклеотидов, которые кодируют указанный набор неоэпитопов, включающие: (a) идентификацию специфического для пациента метанома путем анализа транскриптома пациента и экзома пациента, (b) выбор поднабора из 15-500 неоэпитопов из мутанома с использованием взвешенного значения для неоэпитопов, основанного по меньшей мере на трех показателях из: оценки экспрессии на уровне генов или транскриптов при RNA-seq у пациента; показателя достоверности при распознавании вариантов; аллель-специфической экспрессии при RNA-seq; консервативной или неконсервативной замены аминокислот; положения точечной мутации (индекс центрирования для повышенного вовлечения TCR); положения точечной мутации (индекс привязки для дифференциального связывания HLA); «самость»: < 100% гомологии коровых эпитопов по данным WES (полноэкзомного секвенирования) пациента; HLA-A и -B IC50 для 8-меров-11-меров; HLA-DRB1 IC50 для 15-меров-20-меров; показателя неизбирательности; HLA-C IC50 для 8-меров-11-меров; HLA-DRB3-5 IC50 для 15-меров-20-меров; HLA-DQB1/A1 IC50 для 15-меров-20-меров; HLA-DPB1/A1 IC50 для 15-меров-20-меров; пропорции класса I относительно класса II; разнообразия охваченных аллотипов HLA-A, -B и DRB1 пациента; пропорции точечных мутаций/комплексных эпитопов; показателей связывания псевдоэпитопов HLA; присутствия и/или распространенности ридов RNAseq, и (c) выбор набора неоэпитопов для применения в персонализированной противораковой мРНК-вакцине из указанного поднабора на основании максимального взвешенного значения, при этом указанный набор неоэпитопов содержат 15-40 неоэпитопов.

Согласно аспектам настоящего изобретения предложены способы идентификации набора неоэпитопов для применения в персонализированной противораковой мРНК-вакцине, содержащей один или более полинуклеотидов, которые кодируют указанный набор неоэпитопов, включающий: (a) получение полученного секвенированием РНК (RNA-seq) образца из опухоли пациента для получения набора ридов RNA-seq, (b) компиляцию с получением общего числа последовательностей нуклеотидов из всех ридов RNA-seq, (c) сравнение информации о последовательностях из образца опухоли и из соответствующей базы данных нормальных тканей того же типа, и (d) выбор набора неоэпитопов для применения в персонализированной противораковой мРНК-вакцине из указанного поднабора на основании максимального взвешенного значения, при этом указанный набор неоэпитопов содержит 15-40 неоэпитопов.

Подробная информация о различных вариантах реализации настоящего изобретения приведена в описании ниже. Другие признаки, предметы и преимущества настоящего изобретения будут очевидны из описания и чертежей, а также формулы изобретения.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Вышеупомянутые и другие предметы, признаки и преимущества очевидны из приведенного ниже описания конкретных вариантов реализации настоящего изобретения, проиллюстрированных сопроводительными чертежами, где сходные референсные обозначения относятся к одним и тем же частям, рассматриваемым с разных точек зрения. Чертежи не обязательно выполнены в масштабе, вместо этого акцент сделан на иллюстрации принципов различных вариантов реализации настоящего изобретения.

На фиг. 1 приведено подтверждение полного считывания по всему конкатемеру (SIINFEKL представляет собой SEQ ID NO: 231).

На фиг. 2 показан антиген-специфический ответ на эпитопы класса I обнаруживаемые в обеих конструкциях.

На фиг. 3 показан антиген-специфический ответ на эпитопы класса I, обнаруживаемые исключительно в 52-мерных конструкциях.

На фиг. 4 показан антиген-специфический ответ на эпитопы класса II, обнаруживаемые в обеих конструкциях (слева) и обнаруживаемые исключительно в 52-мерных конструкциях (справа).

На фиг. 5 представлена блок-диаграмма примера компьютерной системы, на основе которой могут быть осуществлены некоторые варианты реализации.

На фиг. 6 показан антиген-специфический ответ у мышей, иммунизированных мРНК, кодирующей конкатемер из 52 эпитопов мышей (добавление эпитопов 4a_DX_RX_perm) в комбинации с мРНК иммунопотенциатора STING при варьирующих дозировках антигена и STING и соотношениях антиген:STING. Показаны данные для in vitro рестимуляции пептидной последовательностью, соответствующей РНК 2 эпитопа класса II, закодированного в конкатемере.

На фиг. 7 показан антиген-специфический ответ у мышей, иммунизированных мРНК, кодирующей конкатемер из 52 эпитопов мышей (добавление эпитопов 4a_DX_RX_perm) в комбинации с мРНК иммунопотенциатора STING при варьирующих дозировках антигена и STING и соотношениях антиген:STING. Показаны данные для in vitro рестимуляции пептидной последовательностью, соответствующей РНК 3 эпитопа класса II, закодированного в конкатемере.

На фиг. 8 показан антиген-специфический ответ у мышей, иммунизированных мРНК, кодирующей конкатемер из 52 эпитопов мышей (добавление эпитопов 4a_DX_RX_perm) в комбинации с мРНК иммунопотенциатора STING при варьирующих дозировках антигена и STING и соотношениях антиген:STING. Показаны данные для in vitro рестимуляции пептидной последовательностью, соответствующей РНК 7 эпитопа класса I, закодированного в конкатемере.

На фиг. 9 показан антиген-специфический ответ у мышей, иммунизированных мРНК, кодирующей конкатемер из 52 эпитопов мышей (добавление эпитопов 4a_DX_RX_perm) в комбинации с мРНК иммунопотенциатора STING при варьирующих дозировках антигена и STING и соотношениях антиген:STING. Показаны данные для in vitro рестимуляции пептидной последовательностью, соответствующей РНК 13 эпитопа класса I, закодированного в конкатемере.

На фиг. 10 показан антиген-специфический ответ у мышей, иммунизированных мРНК, кодирующей конкатемер из 52 эпитопов мышей (добавление эпитопов 4a_DX_RX_perm) в комбинации с мРНК иммунопотенциатора STING при варьирующих дозировках антигена и STING и соотношениях антиген:STING. Показаны данные для in vitro рестимуляции пептидной последовательностью, соответствующей РНК 22 эпитопа класса I, закодированного в конкатемере.

На фиг. 11 показан антиген-специфический ответ у мышей, иммунизированных мРНК, кодирующей конкатемер из 52 эпитопов мышей (добавление эпитопов 4a_DX_RX_perm) в комбинации с мРНК иммунопотенциатора STING при варьирующих дозировках антигена и STING и соотношениях антиген:STING. Показаны данные для in vitro рестимуляции пептидной последовательностью, соответствующей РНК 10 эпитопа класса II, закодированного в конкатемере.

На фиг. 12 приведена столбчатая диаграмма, отражающая антиген-специфический ИФН-γ-ответ T-клеток у мышей, иммунизированных мРНК, кодирующей конкатемер из 20 эпитопов мышей (РНК 31), в комбинации с мРНК иммунопотенциатора STING, в сравнении со стандартными адъювантами или не введенным в состав лекарственной формы средством (не инкапсулированным в ЛНЧ). Показаны данные для пептидной рестимуляции in vitro эпитопами класса II (РНК 2 и РНК 3), закодированными в конкатемере.

На фиг. 13 приведена столбчатая диаграмма, отражающая антиген-специфический ИФН-γ-ответ T-клеток у мышей, иммунизированных мРНК, кодирующей конкатемер из 20 эпитопов мышей (РНК 31) в комбинации с мРНК иммунопотенциатора STING, в сравнении со стандартными адъювантами или не введенным в состав лекарственной формы средством (не инкапсулированным в ЛНЧ). Показаны данные для in vitro пептидной рестимуляции эпитопами класса I (РНК 7, РНК 10 и РНК 13), закодированными в конкатемере.

На фиг. 14 приведена столбчатая диаграмма, отражающая антиген-специфический ИФН-γ-ответ T-клеток у мышей, иммунизированных мРНК, кодирующей конкатемер из 20 эпитопов мышей (РНК 31) в комбинации с мРНК иммунопотенциатора STING, причем конструкцию STING вводили либо одновременно с вакциной, либо через 24 часа, либо через 48 часов. Показаны данные для пептидной рестимуляции in vitro эпитопами класса II (РНК 2 и РНК 3) или эпитопами класса I (РНК 7, РНК 10, РНК 13), закодированными в конкатемере.

На фиг. 15 показаны мутации KRAS при раке ободочной и прямой кишки, идентифицированные в пакете данных COSMIC от 2012 г.

На фиг. 16 показана специфичность изоформ-специфических точечных мутаций для HRAS. Данные для общего числа опухолей при каждой точечной мутации были взяты из каталога COSMIC версии v52. Отмечены мутации одного основания, приводящие к каждой из замен аминокислот. Наиболее частые мутации для каждой изоформы при каждом типе рака выделены серым цветом. Г/Л: гематопоэтические/лимфоидные ткани. (Prior et al. Cancer Res. 2012 May 15; 72(10): 2457-2467).

На фиг. 17 показана специфичность изоформ-специфических точечных мутаций для KRAS. Данные для общего числа опухолей при каждой точечной мутации были взяты из каталога COSMIC версии v52. Отмечены мутации одного основания, приводящие к каждой из замен аминокислот. Наиболее частые мутации для каждой изоформы при каждом типе рака выделены серым цветом. Г/Л: гематопоэтические/лимфоидные ткани. (Prior et al. Cancer Res. 2012 May 15; 72(10): 2457-2467).

На фиг. 18 показана специфичность изоформ-специфических точечных мутаций для NRAS. Данные для общего числа опухолей при каждой точечной мутации были взяты из каталога COSMIC версии v52. Отмечены мутации одного основания, приводящие к каждой из замен аминокислот. Наиболее частые мутации для каждой изоформы при каждом типе рака выделены серым цветом. Г/Л: гематопоэтические/лимфоидные ткани. (Prior et al. Cancer Res. 2012 May 15; 72(10): 2457-2467).

На фиг. 19 показаны вторичные мутации KRAS после приобретения устойчивости к блокаде рЭФР. (Diaz et al. The molecular evolution of acquired resistance to targeted EGFR blockade in colorectal cancers, Nature 486:537 (2012)).

На фиг. 20 показаны вторичные мутации KRAS после блокады рЭФР. (Misale et al. Emergence of KRAS muations and acquired resistance to anti-EGFR therapy in colorectal cancer, Nature 486:532 (2012)).

На фиг. 21 показана частота мутаций NRAS и KRAS при раке ободочной и прямой кишки, идентифицированная с использованием cBioPortal.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

Согласно вариантам реализации настоящего изобретения предложены РНК-вакцины (например, мРНК-вакцины), которые включают полинуклеотид, кодирующий раковый антиген. Противораковые РНК-вакцины, предложенные согласно настоящему изобретению, могут применяться для индукции сбалансированного иммунного ответа, задействующего клеточный и/или гуморальный иммунитет, в отсутствие многих рисков, ассоциированных с ДНК-вакцинацией. Согласно некоторым вариантам реализации вакцина содержит по меньшей мере один РНК- (например, мРНК-) полинуклеотид, содержащий открытую рамку считывания, кодирующую раковый антиген. Согласно некоторым вариантам реализации вакцина содержит по меньшей мере один РНК- (например, мРНК-) полинуклеотид, содержащий по меньшей мере одну открытую рамку считывания, кодирующую раковый антиген, и по меньшей мере одну открытую рамку считывания, кодирующую универсальный Т-клеточный эпитоп II типа. Согласно другому варианту реализации вакцина содержит по меньшей мере один РНК- (например, мРНК-) полинуклеотид, содержащий по меньшей мере одну открытую рамку считывания, кодирующую раковый антиген, и по меньшей мере одну открытую рамку считывания, кодирующую иммунопотенциатор (например, адъювант). Согласно некоторым вариантам реализации вакцина содержит по меньшей мере один РНК-полинуклеотид (например, мРНК-полинуклеотид), содержащий открытую рамку считывания, кодирующую раковый антиген (например, пептид активирующей мутации онкогена).

Несмотря на попытки получения функциональных РНК-вакцин, в том числе противораковых мРНК-вакцин, терапевтическая эффективность указанных РНК-вакцин еще не была полностью определена. Достаточно неожиданным образом, авторы настоящего изобретения обнаружили класс составов для доставки мРНК-вакцины, обеспечивающий к значимо повышенному, и во многих отношениях синергическому иммунному ответу, включающему повышенный ответ T-клеток. Вакцины согласно настоящему изобретению включают традиционные противораковые вакцины, а также персонализированные противораковые вакцины. Настоящим изобретением охвачено, согласно некоторым аспектам, неожиданное открытие, заключающееся в том, что составы с липидными наночастицами значимо усиливают эффективность мРНК-вакцин, в том числе химически модифицированных и немодифицированных мРНК-вакцин.

Липидная наночастица, используемая в исследованиях, описанных в настоящем документе, ранее использовалась для доставки ми-РНК в различных моделях на животных, а также у человека. Принимая во внимание наблюдения в контексте доставки ми-РНК в составах с липидными наночастицами, тот факт, что липидная наночастица, в отличие от липосомы, подходит для применения в противораковых вакцинах, является достаточно неожиданным. Было отмечено, что терапевтическая доставка ми-РНК, введенной в состав липидной микрочастицы, вызывает нежелательный воспалительный ответ, ассоциированный с транзиентным IgM-ответом, как правило, ведущим к снижению продуцирования антигенов и нарушению иммунного ответа. В отличие от наблюдаемых для ми-РНК результатов, составы с противораковыми мРНК-вакцинами в липидных наночастицах, описанные в настоящем документе, демонстрируют стимуляцию повышенных уровней IgG, достаточных для профилактических и терапевтических способов, а не транзиентный IgM-ответ. Липидные наночастицы согласно настоящему изобретению не представляют собой липосомы. Липосома в настоящем документе представляет собой структуру на основе липидов с липидной бислойной или монослойной оболочкой, и грузом нуклеиновой кислоты внутри кора.

Продуцирование раковых антигенов, вызывающих требуемый иммунный ответ (например, ответы T-клеток) против нацеленных последовательностей полипептидов при разработке вакцин остается сложной задачей. Настоящим изобретением предусмотрена технология, позволяющая преодолеть трудности, ассоциированные с такой разработкой. За счет применения технологии согласно настоящему изобретению возможна настройка требуемого иммунного ответа путем выбора подходящих T- или B-клеточных раковых эпитопов и получения состава с указанными эпитопами или антигенами для эффективной доставки in vivo. Согласно дополнительному или альтернативному варианту иммунный ответ может быть дополнительно усилен путем выбора одного или более универсальных T-клеточных эпитопов типа II для доставки наряду с подходящими T-клеточными и/или B-клеточными раковыми эпитопами или антигенами.

Согласно дополнительному или альтернативному варианту указанные мРНК-вакцины могут включать пептид активирующей мутации онкогена (например, пептид мутации KRAS). Более ранние исследования показали ограниченную возможность стимуляции образования T-клеток, специфических для указанной онкогенной мутации. Значительную часть указанных исследований проводили в контексте наиболее распространенного аллеля HLA (A2, который встречается к ~50% европеоидов). В более поздней работе исследовали получение специфических T-клеток, направленных против точечных мутаций, в контексте менее распространенных аллелей HLA (A11, C8). Полученные данные имеют большое значение для лечения рака. Онкогенные мутации распространены при многих видах рака. Возможность нацеливания на указанные мутации и получения T-клеток, достаточных для киллинга опухолей, отличается широкой применимостью для терапии рака. Достаточно неожиданным образом, доставка антигенов с применением мРНК обладает таким значимым преимуществом по сравнению с доставкой пептидных вакцин. Соответственно, настоящим изобретением охвачено, согласно некоторым аспектам, неожиданное открытие, заключающееся в том, что доставка антигенов активирующих онкогенных мутаций in vivo в форме мРНК значимо усиливает эффективность противораковой терапии.

Молекулы HLA класса I представляют собой высокополиморфные трансмембранные гликопротеины, состоящие из двух полипептидных цепей (тяжелой цепи и легкой цепи). Антиген лейкоцитов человека, главный комплекс гистосовместимости у человека, является специфическим для каждого индивидуума и отличается наследуемыми признаками. Тяжелые цепи класс I кодируют три гена: HLA-A, HLA-B и HLA-C. Молекулы HLA класса I важны для формирования иммунного ответа за счет презентации эндогенных антигенов T-лимфоцитам, инициирующей цепь иммунных реакций, которые приводят к элиминации опухолевых клеток цитотоксическими T-клетками. Измененные уровни продуцирования антигенов HLA класса I представляют собой широко распространенное явление при злокачественных новообразованиях и сопровождается значимым ингибированием противоопухолевой функции T-клеток. Это один из основных механизмов, используемых раковыми клетками для обхода иммунологического надзора. Отрицательная регуляция уровней антигенов HLA класса I была детектирована в 90% опухолей НМРЛ (n=65). Снижение количества или утрату HLA детектировали в 76% образцов опухолей поджелудочной железы (n=19). Экспрессия антигенов HLA класса I при раке толстой кишки резко снижалась или была недетектируемой в 96% образцов опухоли (n=25).

Растущий объем данных свидетельствует о том, что опухолевые клетки используют две общие стратегии избегания иммунологического надзора: иммуноселекция (малоиммуногенные варианты опухолевых клеток) и иммуносубверсия («подрыв» иммунной системы). Была продемонстрирована корреляция изменений антигенов HLA класса I и присутствия мутаций кодона 12 KRAS, что предполагает возможный индуцирующий эффект мутаций кодона 12 KRAS на регуляцию антигенов HLA класса I при прогрессировании рака. Для многих часто встречающихся раковых мутаций предсказано связывание аллелей HLA класса I с высокой аффинностью (IC50 <= 50 нМ)7, и они могут подходить для профилактической противораковой вакцинации.

Терапевтические мРНК могут быть доставлены по отдельности или в комбинации с другими противораковыми терапевтическими средствами, такими как ингибиторы контрольных точек, чтобы обеспечить значимое усиление иммунного ответа против опухолей. Ингибиторы контрольных точек могут усиливать эффекты мРНК, кодирующей активирующие онкогенные пептиды, за счет элиминации некоторых препятствий для стимуляции иммунного ответа, позволяя таким образом активированным T-клеткам эффективно стимулировать иммунный ответ против опухоли.

Было обнаружено, что мРНК-вакцины, описанные в настоящем документе, превосходят известные к настоящему времени вакцины в нескольких отношениях. Во-первых, доставка липидных наночастиц (ЛНЧ) превосходит другие составы для доставки, в том числе способы доставки на основе липосом или протаминов, описанные в опубликованных источниках. Применение ЛНЧ обеспечивает эффективную доставку химически модифицированных или немодифицированных мРНК-вакцин. Как модифицированные, так и немодифицированные мРНК-вакцины в составах с ЛНЧ значительно превосходят стандартные вакцины. Согласно некоторым вариантам реализации мРНК-вакцины согласно настоящему изобретению превосходят стандартные вакцины по меньшей мере в 10 раз, 20 раз, 40 раз, 50 раз, 100 раз, 500 раз или 1000 раз.

Несмотря на усилия, направленные на получение функциональных РНК-вакцин, в том числе мРНК-вакцин и самореплицирующихся РНК-вакцин, терапевтическая эффективность указанных РНК-вакцин пока не полностью определена. Достаточно неожиданным образом авторы настоящего изобретения обнаружили, в соответствии с аспектами настоящего изобретения, класс составов для доставки мРНК-вакцины in vivo, которые обеспечивают значимо усиленный и во многих отношениях синергический иммунный ответ, включающий повышенное продуцирование антигенов и функциональных антител с нейтрализующей способностью. Указанные результаты могут быть достигнуты даже при введении значимо более низких доз мРНК по сравнению с дозами мРНК, применяемыми для других классов составов на основе липидов. При применении составов согласно настоящему изобретению был продемонстрирован неожиданный значимый иммунный ответ in vivo, достаточный для обеспечения эффективности функциональных мРНК-вакцин в качестве профилактических и терапевтических агентов. Кроме того, самореплицирующиеся РНК-вакцины задействуют пути вирусной репликации для доставки в клетку достаточного количества РНК для получения иммуногенного ответа. Составы согласно настоящему изобретению не требуют вирусной репликации для получения количества белка, достаточного для выраженного иммунного ответа. Соответственно, мРНК согласно настоящему изобретению не являются самореплицирующимися РНК и не включают компонентов, которые необходимы для вирусной репликации.

Согласно некоторым аспектам настоящим изобретением охвачено неожиданное открытие, заключающееся в том, что составы с липидными наночастицами (ЛНЧ) значимо усиливают эффективность мРНК-вакцин, в том числе химически модифицированных и немодифицированных мРНК-вакцин. Кроме того, было обнаружено, что иммуногенность эпитопов аналогична независимо от общего числа эпитопов в пределах конструкции. Эпитопы, содержащиеся в 52-мерных конструкциях, обладают иммуногенностью, аналогичной иммуногенности 20-мерных конструкций, согласно оценке эпитоп-специфических ответов ИФН-γ. Достаточно неожиданным образом, было продемонстрировано, что увеличение длины мРНК не оказывает пагубного эффекта на иммуногенность эпитопов. Последние эпитопы, кодируемые 20-мером и 52-мером (SIINFEKL, SEQ ID NO: 231), были сопоставимыми, что также указывает на полное считывание указанных конкатемеров. Также неожиданно было обнаружено, что антиген-специфические ответы на эпитопы класса I усиливались при введении в состав вакцин конститутивно активного иммунопотенциатора.

ЛНЧ, применяемые для исследований, описанных в настоящем документе, ранее использовались для доставки ми-РНК в различных моделях на животных, а также у человека. Исходя из наблюдений, сделанных в связи с доставкой ми-РНК в ЛНЧ-составах, тот факт, что ЛНЧ подходят для применения в вакцинах, является достаточно неожиданным. Было отмечено, что терапевтическая доставка ми-РНК в составах с ЛНЧ вызывает нежелательный воспалительный ответ, ассоциированный с транзиентным IgM-ответом, как правило, ведущим к снижению продуцирования антигенов и нарушению иммунного ответа. В отличие от наблюдаемых для ми-РНК результатов, ЛНЧ-мРНК-составы согласно настоящему изобретению, как продемонстрировано в настоящем документе, обеспечивают повышенные уровни IgG, достаточные для реализации профилактических и терапевтических способов, а не транзиентные IgM-ответы.

Противораковые мРНК-вакцины обеспечивают уникальную терапевтическую альтернативу вакцинам на основе пептидов или ДНК-вакцинам. При доставке противораковой мРНК-вакцины в клетку происходит процессинг указанной мРНК с получением полипептида за счет внутриклеточных механизмов, которые затем могут осуществлять процессинг указанного полипептида с образованием иммуночувствительных фрагментов, способных стимулировать иммунный ответ против опухоли.

Согласно некоторым вариантам реализации указанная противораковая мРНК-вакцина может быть введена с противораковым терапевтическим агентом, в том числе, но не ограничиваясь указанным, с традиционной противораковой вакциной. Противораковая мРНК-вакцина и противораковые терапевтические средства могут быть скомбинированы для еще большего усиления иммунного терапевтического ответа. Противораковая мРНК-вакцина и другой терапевтический агент могут быть введены одновременно или последовательно. Если указанные другие терапевтические агенты вводят одновременно, они могут быть введены в том же составе или в отдельном составе, однако в то же самое время. Другие терапевтические агенты и противораковую мРНК-вакцину вводят последовательно, если введение указанных других терапевтических агентов и противораковой мРНК-вакцины разделены во времени. Период времени, разделяющий введение указанных соединений, может составлять минуты, или может быть более длительным, например, составлять часы, дни, недели, месяцы. Другие терапевтические агенты включают, не ограничиваясь перечисленными, противораковые терапевтические средства, адъюванты, цитокины, антитела, антигены и т.п.

Противораковые вакцины, описанные в настоящем документе, включают по меньшей мере один полинуклеотид рибонуклеиновой кислоты (РНК), содержащий открытую рамку считывания, кодирующую по меньшей мере один раковый антигенный полипептид или его иммуногенный фрагмент (например, иммуногенный фрагмент, способный индуцировать иммунный ответ на рак). Указанный антигенный пептид может представлять собой персонализированный эпитоп ракового антигена и/или рекуррентный антиген. Согласно некоторым предпочтительные варианты реализации указанная вакцина представлена несколькими эпитопами из смеси чего-либо из вышеперечисленного. Соответственно, указанные противораковые вакцины могут представлять собой традиционные или персонализированные противораковые вакцины, или их смеси. Традиционная противораковая вакцина представляет собой вакцину, содержащую раковый антиген, который, как известно, обнаруживается при раке или в опухолях в общем или в специфическом типе раке или опухоли. Антигены, экспрессируемые в раковых клетках или экспрессируемые опухолевыми клетками, называют «опухолеассоциированными антигенами». Конкретный опухолеассоциированный антиген также может экспрессироваться или не экспрессироваться в нераковых клетках. В данной области техники известны многие опухолевые мутации.

Неожиданным образом было обнаружено, что мультиэпитопные противораковые вакцины на основе РНК, в виде составов с индивидуальными эпитопами или конкатемерами, могут обеспечивать оптимальную иммунную стимуляцию за счет точного баланса эпитопов MHC класса I и эпитопов MHC класса II. РНК-вакцины, которые кодируют оба компонента, отличаются повышенной иммуногенностью.

Персонализированные вакцины, например, могут включать РНК, кодирующую один или более известных раковых антигенов, специфических для опухоли, или раковых антигенов, специфических для каждого субъекта, называемых неоэпитопами, или специфическими для субъекта эпитопами или антигенами (называемыми персонализированными антигенами). «Специфический для субъекта раковый антиген» представляет собой антиген, который был идентифицирован как экспрессирующийся в опухоли конкретного пациента. Специфический для субъекта раковый антиген может преимущественно присутствовать или не присутствовать в образцах опухолей в общем случае. Опухолеассоциированные антигены, которые не экспрессируются или редко экспрессируются в нераковых клетках, или отличающиеся достаточно сниженной экспрессией в нераковых клетках по сравнению с экспрессией в раковых клетках, и индуцирующие иммунный ответ, индуцируемый при вакцинации, называются неоэпитопами. Неоэпитопы, такие как опухолеассоциированные антигены, являются полностью чужеродными для организма и, соответственно не будут вызывать иммунного ответа против здоровой ткани или не будут маскированы защитными компонентами иммунной системы. Согласно некоторым вариантам реализации персонализированные вакцин на основе неоэпитопов являются желательными, поскольку вакцины с таким составом будут максимизировать специфичность в отношении специфической опухоли пациента. Обусловленные мутациями неоэпитопы могут возникать в результате точечных мутаций, несинонимичных мутаций, приводящих к появлению других аминокислот в белке; мутаций сквозного прочитывания, когда происходит модификация или удаление стоп-кодона, что приводит к трансляции более длинного белка с новой опухолеспецифической последовательностью на C-конце; мутаций сайта сплайсинга, которые приводят к включению интрона в зрелую мРНК и, соответственно, образованию уникальной опухолеспецифической белковой последовательности; хромосомных перестроек, в результате которых образуется химерный белок с опухолеспецифическими последовательностями в участке сращивания двух белков (т.е. слияния генов); мутаций со сдвигом рамки или делеций, приводящих к образованию новой открытой рамки считывания с новой опухолеспецифической белковой последовательностью; и транслокаций. Соответственно, согласно некоторым вариантам реализации указанные противораковые мРНК-вакцины включают по меньшей мере 2 раковых антигена, в том числе мутации, выбранные из группы, состоящей из мутаций со сдвигом рамки и рекомбинаций, или любых других мутаций, описанных в настоящем документе.

Способы получения персонализированных противораковых РНК-вакцин обычно включают идентификацию мутаций, например, с применением методик глубокого секвенирования нуклеиновых кислот или белков, идентификацию неоэпитопов, например, с применением валидированных алгоритмов предсказания связывания пептидов с MHC или других аналитических методик для создания набора кандидатных Т-клеточных эпитопов, которые могут связываться с аллелями HLA пациента и основаны на мутациях, присутствующих в опухолях, необязательную демонстрацию антиген-специфических T-клеток, направленных против выбранных неоэпитопов, или демонстрацию того, что кандидатный неоэпитоп связывается с белками HLA на поверхности опухоли, и разработку вакцины. Противораковые мРНК-вакцины согласно настоящему изобретению могут включать несколько копий единственного неоэпитопа, несколько разных неоэпитопов, основанных на одном типе мутации, таком как точечная мутация, несколько разных неоэпитопов, основанных на различных типах мутаций, неоэпитопы и другие антигены, такие как опухолеассоциированные антигены или антигены-приманки.

Примеры методик для идентификации мутаций включают, не ограничиваясь перечисленными, динамическую аллель-специфическую гибридизацию (DASH), микропланшетный диагональный гель-электрофорез (MADGE), пиросеквенирование, олигонуклеотид-специфическое лигирование, систему TaqMan, а также различные технологии ДНК-«чипов», таких как SNP-чипы Affymetrix, и способы, основанные на получении малых сигнальных молекул путем инвазивного расщепления с последующим использованием масс-спектрометрии или иммобилизованных замыкающих кольцо зондов и амплификации по типу катящегося кольца.

Методики глубокого секвенирования нуклеиновых кислот или белков известны в данной области техники. Может быть использован любой способ анализа последовательностей. Секвенирование нуклеиновых кислот может быть выполнено на целых опухолевых геномах, опухолевых экзомах (кодирующей белки ДНК), опухолевых транскриптомах или экзосомах. Технологии одномолекулярного секвенирования путем синтеза в реальном времени основаны на детекции флуоресцентных нуклеотидов, поскольку их включают в образующуюся цепь ДНК, комплементарную секвенируемой матрице. Существуют и другие способы быстрого высокопроизводительного секвенирования. Секвенирование белков может быть выполнено на опухолевых протеомах. Кроме того, масс-спектрометрия белков может применяться для идентификации или валидации присутствия мутированных пептидов связанных с белками MHC на опухолевых клетках. Пептиды могут быть элюированы кислотой из опухолевых клеток или из молекул HLA, иммунопреципитированных из опухоли, а затем идентифицированы с применением масс-спектрометрии. Результаты секвенирования могут сравниваться с известными контрольными наборами или результатами анализов методом секвенирования для нормальной ткани пациента.

Соответственно, настоящее изобретение относится к способам идентификации и/или детекции неоэпитопов антигена. В частности, согласно настоящему изобретению предложены способы идентификации и/или детекции опухолеспецифических неоэпитопов, которые подходят для индукции опухолеспецифического иммунного ответа у субъекта. Необязательно, некоторые из указанные неоэпитопов связываются с белками HLA класса I с более высокой аффинностью, чем пептид дикого типа, и/или способны активировать противоопухолевые CD8 T-клетки. Другие связываются с классом II и активируют хелперные CD4+ T-клетки. Хотя была признана важная роль, которую играют в вакцине антигены класса I, авторами настоящего изобретения было обнаружено, что вакцины, состоящие из сбалансированных антигенов класса I и класса II, фактически вызывают более устойчивый иммунный ответ, чем вакцина на основе класса I или класса II по отдельности.

Белки MHC класса I присутствуют на поверхности почти всех клеток организма, в том числе большинства опухолевых клеток. Белки MHC класса I нагружаются антигенами, которые обычно происходят из эндогенных белков или патогенов, присутствующих внутри клеток, и затем презентируются цитотоксическим T-лимфоцитам (CTL). T-клеточные рецепторы способны распознавать и связывать пептиды в комплексах с молекулами MHC класса I. Каждый цитотоксический T-лимфоцит экспрессирует уникальный T-клеточный рецептор, который способен к связыванию специфических MHC/пептидных комплексов.

Используя компьютерные алгоритмы, можно предсказывать потенциальные неоэпитопы, т.е. последовательности пептидов, связываемые молекулами MHC класса I или класса II в форме пептид-презентирующего комплекса, и затем, в указанной форме, распознаваемые T-клеточными рецепторами T-лимфоцитов. Примеры программ, подходящих для идентификации пептидов, которые будут связываться с MHC, включают, например: Lonza Epibase, SYFPEITHI (Rammensee et al., Immunogenetics, 50 (1999), 213-219) и HLA_BIND (Parker et al., J. Immunol., 152 (1994), 163-175).

После выбора предполагаемых неоэпитопов они могут быть дополнительно протестированы с применением анализов in vitro и/или in vivo. Стандартные лабораторные анализы in vitro, такие как анализы Elispot, могут применяться для изолята от каждого пациента, чтобы уточнить перечень неоэпитопов, выбранных на основе полученных с помощью алгоритма предсказаний.

Противораковые мРНК-вакцины согласно настоящему изобретению представлены композициями, в том числе фармацевтическими композициями. Настоящим изобретением также охвачены способы выбора, дизайна, составления, приготовления, получения составов и/или применения противораковые мРНК-вакцины. Также предложены системы, процессы, устройства и наборы для выбора, дизайна и/или применения противораковых мРНК-вакцин, описанных в настоящем документе.

мРНК-вакцины согласно настоящему изобретению могут включать один или более раковых антигенов. Согласно некоторым вариантам реализации указанная мРНК-вакцина состоит из 45 или более, 46 или более, 47 или более, 48 или более, 49 или более, 50 или более, 51 или более, 52 или более, 53 или более, 54 или более, или 55 или более антигенов. Согласно другим вариантам реализации указанная мРНК-вакцина состоит из 3 или более, 4 или более, 5 или более, 6 или более, 7 или более, 8 или более, или 9 или более антигенов. Согласно другим вариантам реализации указанная мРНК-вакцина состоит из 1000 или менее, 900 или менее, 500 или менее, 100 или менее, 75 или менее, 50 или менее, 40 или менее, 30 или менее, 20 или менее или 100 или менее раковых антигенов. Согласно другим дополнительным вариантам реализации указанная мРНК-вакцина содержит 3-100, 5-100, 10-100, 15-100, 20-100, 25-100, 30-100, 35-100, 40-100, 45-100, 50-100, 55-100, 60-100, 65-100, 70-100, 75-100, 80-100, 90-100, 5-50, 10-50, 15-50, 20-50, 25-50, 30-50, 35-50, 40-50, 45-50, 100-150, 100-200, 100-300, 100-400, 100-500, 50-500, 50-800, 50-1000; или 100-1000 раковых антигенов.

Согласно некоторым вариантам реализации противораковые мРНК-вакцины и способы вакцинации включают эпитопы или антигены на основе специфических мутаций (неоэпитопы) и экспрессируемых раковых генов зародышевой линии (общие антигены опухолей, обнаруживаемые у множества пациентов).

Эпитоп, также известный как антигенная детерминанта, в настоящем документе представляет собой часть антигена, распознаваемую иммунной системой в подходящих условиях, в частности, антителами, B-клетками или T-клетками. Эпитопы включают B-клеточные эпитопы и T-клеточные эпитопы. B-клеточные эпитопы представляют собой последовательности пептидов, необходимые для распознавания продуцирующими специфическое антитело B-клетками. B-клеточные эпитопы относятся к специфической области антигена, распознаваемой антителом. Часть антитела, которая связывается с эпитопом, называют паратопом. Эпитоп может быть классифицирован как конформационный эпитоп или линейный эпитоп на основе структуры и взаимодействия с паратопом. Линейный эпитоп, или эпитоп непрерывного типа определен первичной последовательностью аминокислот конкретной области белка. Последовательности, которые взаимодействуют с антителом, расположены рядом на белке в последовательном порядке, и эпитоп может быть, как правило, имитирован единственным пептидом. Конформационные эпитопы представляют собой эпитопы, которые определены конформационной структурой природного белка. Указанные эпитопы может быть непрерывными или прерывистыми, т.е. компоненты эпитопа могут быть расположены на разрозненных участках белка, которые сближены друг с другом в структуре укладки природного белка.

T-клеточные эпитопы представляют собой пептидные последовательности, которые, в ассоциированном с белками на АПК виде, необходимы для распознавания специфическими T-клетками. T-клеточные эпитопы процессируются внутриклеточно и представляются на поверхности АПК, где связываются с молекулами MHC, в том числе MHC класса II и MHC класса I. Пептидный эпитоп может иметь любую целесообразную для эпитопа длину. Согласно некоторым вариантам реализации длина пептидного эпитопа составляет 9-30 аминокислот. Согласно другим вариантам реализации указанная длина составляет 9-22, 9-29, 9-28, 9-27, 9-26, 9-25, 9-24, 9-23, 9-21, 9-20, 9-19, 9-18, 10-22, 10-21, 10-20, 11-22, 22-21, 11-20, 12-22, 12-21, 12-20,13-22, 13-21, 13-20, 14-19, 15-18 или 16-17 аминокислот.

Согласно некоторым вариантам реализации указанные пептидные эпитопы содержат по меньшей мере один эпитоп MHC класса I и по меньшей мере один эпитоп MHC класса II. Согласно некоторым вариантам реализации по меньшей мере 10% указанных эпитопов представляют собой эпитопы MHC класса I. Согласно некоторым вариантам реализации по меньшей мере 20% указанных эпитопов представляют собой эпитопы MHC класса I. Согласно некоторым вариантам реализации по меньшей мере 30% указанных эпитопов представляют собой эпитопы MHC класса I. Согласно некоторым вариантам реализации по меньшей мере 40% указанных эпитопов представляют собой эпитопы MHC класса I. Согласно некоторым вариантам реализации по меньшей мере 50%, 60%, 70%, 80%, 90% или 100% указанных эпитопов представляют собой эпитопы MHC класса I. Согласно некоторым вариантам реализации по меньшей мере 10% указанных эпитопов представляют собой эпитопы MHC класса II. Согласно некоторым вариантам реализации по меньшей мере 20% указанных эпитопов представляют собой эпитопы MHC класса II. Согласно некоторым вариантам реализации по меньшей мере 30% указанных эпитопов представляют собой эпитопы MHC класса II. Согласно некоторым вариантам реализации по меньшей мере 40% указанных эпитопов представляют собой эпитопы MHC класса II. Согласно некоторым вариантам реализации по меньшей мере 50%, 60%, 70%, 80%, 90% или 100% указанных эпитопов представляют собой эпитопы MHC класса II. Согласно некоторым вариантам реализации соотношение эпитопов MHC класса I и эпитопов MHC класса II представляет собой соотношение, выбранное из: приблизительно 10%:приблизительно 90%; приблизительно 20%:приблизительно 80%; приблизительно 30%:приблизительно 70%; приблизительно 40%:приблизительно 60%; приблизительно 50%:приблизительно 50%; приблизительно 60%:приблизительно 40%; приблизительно 70%:приблизительно 30%; приблизительно 80%: приблизительно 20%; приблизительно 90%: приблизительно 10% эпитопов MHC класса 1: MHC класса II. Согласно одному варианту реализации соотношение эпитопов MHC класса I и эпитопов MHC класса II составляет 3:1. Согласно некоторым вариантам реализации соотношение эпитопов MHC класса II и эпитопов MHC класса I представляет собой соотношение, выбранное из: приблизительно 10%:приблизительно 90%; приблизительно 20%:приблизительно 80%; приблизительно 30%:приблизительно 70%; приблизительно 40%:приблизительно 60%; приблизительно 50%:приблизительно 50%; приблизительно 60%:приблизительно 40%; приблизительно 70%:приблизительно 30%; приблизительно 80%: приблизительно 20%; приблизительно 90%: приблизительно 10% эпитопов MHC класса II: эпитопов MHC класса I. Согласно одному варианту реализации соотношение эпитопов MHC класса II : эпитопов MHC класса I составляет 1:3. Согласно некоторым вариантам реализации по меньшей мере один из указанных пептидных эпитопов противораковой вакцины представляет собой B-клеточный эпитоп. Согласно некоторым вариантам реализации указанный T-клеточный эпитоп противораковой вакцины содержит 8-11 аминокислот. Согласно некоторым вариантам реализации указанный B-клеточный эпитоп противораковой вакцины содержит 13-17 аминокислот.

Согласно другим аспектам настоящего изобретения противораковая вакцина включает мРНК-вакцину, кодирующую несколько антигенов с пептидными эпитопами, перемежающимися одним или более универсальными Т-клеточными эпитопами II типа. Указанные универсальные Т-клеточные эпитопы II типа включают, не ограничиваясь перечисленными, ILMQYIKANSKFIGI (столбнячный токсин; SEQ ID NO: 226), FNNFTVSFWLRVPKVSASHLE (столбнячный токсин; SEQ ID NO: 227), QYIKANSKFIGITE (столбнячный токсин; SEQ ID NO: 228) QSIALSSLMVAQAIP (дифтерийный токсин; SEQ ID NO: 229) и AKFVAAWTLKAAA (пан-DR-эпитоп (PADRE); SEQ ID NO: 230). Согласно некоторым вариантам реализации указанная мРНК-вакцина содержит один и тот же универсальный Т-клеточный эпитоп II типа. Согласно другим вариантам реализации указанная мРНК-вакцина содержит 2, 3, 4, 5, 6, 7, 8, 9, 10, 15 или 20 разных универсальных Т-клеточных эпитопов II типа. Согласно некоторым вариантам реализации указанный один или более универсальных Т-клеточных эпитопов II типа перемежают все раковые антигены. Согласно другим вариантам реализации указанный один или более универсальных Т-клеточных эпитопов II типа перемежают каждые 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90 или 100 раковых антигенов.

Согласно некоторым аспектам настоящего изобретения противораковая вакцина включает мРНК-вакцину, кодирующую несколько антигенов с пептидными эпитопами, между которыми расположен однонуклеотидный спейсер, или где эпитопы расположены непосредственно друг за другом, без спейсера между ними. Указанные несколько антигенов с эпитопами включают смесь эпитопов MHC класса I и эпитопов MHC класса II. Например, указанные несколько антигенов с пептидными эпитопами могут быть представлены полипептидом, имеющим структуру:

(X-G-X)1-10 (G-Y-G-Y)1-10(G-X-G-X)0-10(G-Y-G-Y)0-10, (X-G)1-10 (G-Y)1-10(G-X)0-10(G-Y)0-10, (X-G-X-G-X)1-10 (G-Y-G-Y)1-10(X-G-X)0-10(G-Y-G-Y)0-10, (X-G-X)1-10 (G-Y-G-Y-G-Y)1-10(X-G-X)0-10(G-Y-G-Y)0-10, (X-G-X-G-X-G-X)1-10 (G-Y-G-Y)1-10(X-G-X)0-10(G-Y-G-Y)0-10, (X-G-X)1-10 (G-Y-G-Y-G-Y-G-Y)1-10(X-G-X)0-10(G-Y-G-Y)0-10, (X)1-10 (Y)1-10 (X)0-10(Y)0-10, (Y)1-10 (X)1-10 (Y)0-10(X)0-10, (XX)1-10 (Y)1-10(X)0-10(Y)0-10, (YY)1-10(XX)1-10 (Y)0-10 (X)0-10, (X)1-10 (YY)1-10(X)0-10(Y)0-10, (XXX)1-10 (YYY)1-10(XX)0-10(YY)0-10, (YYY)1-10(XXX)1-10 (YY)0-10(XX)0-10, (XY)1-10 (Y)1-10(X)1-10(Y)1-10, (YX)1-10 (Y)1-10(X)1-10(Y)1-10, (YX)1-10 (X)1-10(Y)1-10(Y)1-10, (Y-G-Y)1-10 (G-X-G-X)1-10(G-Y-G-Y)0-10(G-X-G-X)0-10, (Y-G)1-10 (G-X)1-10(G-Y)0-10(G-X)0-10, (Y-G-Y-G-Y)1-10 (G-X-G-X)1-10(Y-G-Y)0-10(G-X-G-X)0-10, (Y-G-Y)1-10 (G-X-G-X-G-X)1-10(Y-G-Y)0-10(G-X-G-X)0-10, (Y-G-Y-G-Y-G-Y)1-10 (G-X-G-X)1-10(Y-G-Y)0-10(G-X-G-X)0-10, (Y-G-Y)1-10 (G-X-G-X-G-X-G-X)1-10(Y-G-Y)0-10(G-X-G-X)0-10, (XY)1-10 (YX)1-10 (XY)0-10(YX)0-10, (YX)1-10 (XY)1-10 (Y)0-10(X)0-10, (YY)1-10 (X)1-10(Y)0-10(X)0-10, (XY)1-10(XY)1-10 (X)0-10 (X)0-10, (Y)1-10 (YX)1-10(X)0-10(Y)0-10, (XYX)1-10 (YXX)1-10(YX)0-10(YY)0-10; или (YYX)1-10(XXY)1-10 (YX)0-10(XY)0-10,

X представляет собой эпитоп MHC класса I длиной 10-40 аминокислот, Y представляет собой эпитоп MHC класса II длиной 10-40 аминокислот, и G представляет собой глицин.

Противораковая вакцина, согласно некоторым аспектам настоящего изобретения, содержит мРНК-вакцину, кодирующую несколько антигенов с пептидными эпитопами, содержащими центрально локализованную мутацию - однонуклеотидный полиморфизм (SNP), с фланкирующими аминокислотами с каждой стороны SNP-мутации. Согласно некоторым вариантам реализации число фланкирующих аминокислот на каждой стороне центрально локализованной SNP-мутации равно 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28 или 30. Согласно одному варианту реализации эпитоп противораковой вакцины содержит SNP, фланкированный двумя последовательностями класса I, каждая из которых содержит семь аминокислот. Согласно другому варианту реализации эпитоп противораковой вакцины содержит SNP, фланкированный двумя последовательностями класса II, каждая из которых содержит 10 аминокислот. Согласно некоторым вариантам реализации эпитоп может содержать центрально локализованную SNP и фланкирующие последовательности, обе из которых представляют собой последовательности класса I или последовательности класса II; либо одна последовательность относится к классу I, а другая - к классу II.

Иммунопотенциирующие мРНК

Согласно одному аспекту настоящее изобретение относится к мРНК, которые кодируют полипептид, который стимулирует или усиливает иммунный ответ против одного или более из представляющих интерес раковых антигенов. Такие мРНК, усиливающие иммунный ответ на представляющий интерес раковый антиген или антигены, называются в настоящем документе иммунопотенциирующими мРНК-конструкциями или иммунопотенциирующей мРНК, включающей химически модифицированные мРНК (ммРНК). Иммунопотенциатор согласно настоящему изобретению усиливает иммунный ответ на представляющий интерес антиген у субъекта. Усиленный иммунный ответ может представлять собой клеточный ответ, гуморальный ответ; или и первое, и второе. В настоящем документе «клеточный» иммунный ответ охватывает иммунный ответ, задействующий T-клетки или опосредованный T-клетками, тогда как «гуморальный» иммунный ответ охватывает иммунный ответ, задействующий B-клетки или опосредованный B-клетками. Иммунопотенциатор может усиливать иммунный ответ за счет, например,

(i) стимуляции сигнализации через путь интерферона типа I;

(ii) стимуляции сигнализации через путь NFkB;

(iii) стимуляции воспалительного ответа;

(iv) стимуляции продуцирование цитокинов; или

(v) стимуляции развития, активности или мобилизации дендритных клеток; и

(vi) комбинации любых из пунктов (i)-(vi).

В настоящем документе термин «стимуляция сигнализации через путь интерферона типа I» охватывает активацию одного или более компонентов сигнального пути интерферона I типа (например, модификацию фосфорилирования, димеризации или т.п. таких компонентов, с активацией таким образом указанного пути), стимуляцию транскрипции интерферон-чувствительным элементом ответа (ISRE) и/или стимуляцию продуцирования или секреции интерферона I типа (например, ИФН-α, ИФН-β, ИФН-ε, ИФН-κ и/или ИФН-ω). В настоящем документе «стимуляция сигнализации через путь NFkB» охватывает активацию одного или более компонентов сигнального пути NFkB (например, модификацию фосфорилирования, димеризации или т.п. таких компонентов, с активацией таким образом указанного пути), стимуляцию транскрипции с сайта NFkB и/или стимуляцию продуцирования генного продукта, экспрессию которого регулирует NFkB. В настоящем документе «стимуляция воспалительного ответа» охватывает стимуляция продуцирования воспалительных цитокинов (в том числе, но не ограничиваясь перечисленными, интерферонов I типа, ИЛ-6 и/или ФНО-α). В настоящем документе «стимуляция развития, активности или мобилизации дендритных клеток» охватывает прямую или непрямую стимуляцию созревания, пролиферации и/или функциональной активности дендритных клеток.

Согласно некоторым аспектам настоящего изобретения предложена мРНК, кодирующая полипептид, который стимулирует или усиливает иммунный ответ у нуждающегося в этом субъекта (например, потенциирует иммунный ответ у указанного субъекта) за счет, например, индукции адаптивного иммунитета (например, путем стимуляции продуцирования интерферона I типа), стимуляции воспалительного ответа, стимуляции NFkB-сигнализации и/или стимуляции развития, активности или мобилизации дендритных клеток (ДК) у указанного субъекта. Согласно некоторым аспектам введение иммунопотенциирующей мРНК нуждающемуся в этом субъекту усиливает клеточный иммунитет (например, опосредованный T-клетками иммунитет), гуморальный иммунитет (например, опосредованный B-клетками иммунитет); или как клеточный, так и гуморальный иммунитет у указанного субъекта. Согласно некоторым аспектам введение иммунопотенциирующей мРНК стимулирует продуцирование цитокинов (например, продуцирование воспалительных цитокинов), стимулирует специфические в отношении раковых антигенов ответы эффекторных CD8+ клеток, стимулирует антиген-специфические ответы CD4+ хелперных клеток, увеличивает популяцию эффекторных CD62Llo T-клеток памяти, стимулирует активность B-клеток или стимулирует продуцирование антиген-специфического антитела; и том числе стимулирует комбинации вышеперечисленных ответов. Согласно некоторым аспектам введение иммунопотенциирующей мРНК стимулирует продуцирование цитокинов (например, продуцирование воспалительных цитокинов) и стимулирует антиген-специфические ответы эффекторных CD8+ клеток. Согласно некоторым аспектам введение иммунопотенциирующей мРНК стимулирует продуцирование цитокинов (например, продуцирование воспалительных цитокинов) и стимулирует антиген-специфические ответы хелперных CD4+ клеток. Согласно некоторым аспектам введение иммунопотенциирующей мРНК стимулирует продуцирование цитокинов (например, продуцирование воспалительных цитокинов) и увеличивает популяцию эффекторные CD62Llo T-клеток памяти. Согласно некоторым аспектам введение иммунопотенциирующей мРНК стимулирует продуцирование цитокинов (например, продуцирование воспалительных цитокинов) и стимулирует активность B-клеток или стимулирует продуцирование антиген-специфического антитела.

Согласно одному варианту реализации иммунопотенциатор увеличивает специфические в отношении раковых антигенов ответы CD8+ эффекторных клеток (клеточный иммунитет). Например, иммунопотенциатор может увеличивать один или более показателей антиген-специфической активности эффекторных CD8+ клеток, в том числе, но не ограничиваясь перечисленными, пролиферацию CD8+ T-клеток и продуцирование цитокинов CD8+ T-клетками. Например, согласно одному варианту реализации иммунопотенциатор увеличивает продуцирование ИФН-γ, ФНО-α и/или ИЛ-2 антиген-специфическими CD8+ T-клетками. Согласно различным вариантам реализации иммунопотенциатор может увеличивать продуцирование цитокинов CD8+ T-клетками (например, продуцирование ИФН-γ, ФНО-α и/или ИЛ-2) в ответ на антиген (по сравнению с продуцированием цитокинов CD8+ T-клетками в отсутствие иммунопотенциатора) по меньшей мере на 5%, или по меньшей мере на 10%, или по меньшей мере на 15%, или по меньшей мере на 20%, или по меньшей мере на 25%, или по меньшей мере на 30%, или по меньшей мере на 35%, или по меньшей мере на 40%, или по меньшей мере на 45%, или по меньшей мере на 50%. Например, T-клетки, взятые от получающего лечение субъекта, могут быть стимулированы in vitro раковыми антигенами, и продуцирование цитокинов CD8+ T-клетками может быть оценено in vitro. Продуцирование цитокинов CD8+ T-клетками может быть определено с применением стандартных способов, известных в данной области техники, в том числе, но не ограничиваясь перечисленными, путем измерения секретируемых уровней продуцирования цитокинов (например, с применением ИФА ELISA или другого подходящего известного в данной области техники способа определения количества цитокина в супернатанте) и/или определения процента CD8+ T-клеток, положительных по внутриклеточному окрашиванию (ICS) на указанный цитокин. Например, внутриклеточное окрашивание (ICS) CD8+ T-клеток на экспрессию ИФН-γ, ФНО-α и/или ИЛ-2 может быть проведено с применением способов, известных в данной области техники (см., например, примеры). Согласно одному варианту реализации иммунопотенциатор увеличивает процент CD8+ T-клеток, положительных по ICS на один или более цитокинов (например, ИФН-γ, ФНО-α и/или ИЛ-2), при ответе на антиген (по сравнению с процентом CD8+ T-клеток, положительных по ICS на цитокин(ы), в отсутствие иммунопотенциатора), по меньшей мере на 5%, или по меньшей мере на 10%, или по меньшей мере на 15%, или по меньшей мере на 20%, или по меньшей мере на 25%, или по меньшей мере на 30%, или по меньшей мере на 35%, или по меньшей мере на 40%, или по меньшей мере на 45% или по меньшей мере на 50%.

Согласно еще одному варианту реализации иммунопотенциатор увеличивает процент CD8+ T-клеток в общей популяции T-клеток (например, T-клеток селезенки и/или МКПК) по сравнению с процентом CD8+ T-клеток в отсутствие иммунопотенциатора. Например, иммунопотенциатор может увеличивать процент CD8+ T-клеток в общей популяции T-клеток по меньшей мере на 5%, или по меньшей мере на 10%, или по меньшей мере на 15%, или по меньшей мере на 20%, или по меньшей мере на 25%, или по меньшей мере на 30%, или по меньшей мере на 35%, или по меньшей мере на 40%, или по меньшей мере на 45%, или по меньшей мере на 50% по сравнению с процентом CD8+ T-клеток в отсутствие иммунопотенциатора. Общий процент CD8+ T-клеток в общей популяции T-клеток может быть определен с применением стандартных способов, известных в данной области техники, в том числе, но не ограничиваясь перечисленным, сортировки клеток с активированной флуоресценцией (FACS) или активируемой магнитным полем сортировки клеток (MACS).

Согласно другому варианту реализации иммунопотенциатор увеличивает опухолеспецифический ответ иммунных клеток по оценке на основании уменьшения объема опухоли in vivo в присутствии иммунопотенциатора по сравнению с объемом опухоли в отсутствие иммунопотенциатора. Например, иммунопотенциатор может уменьшать объем опухоли по меньшей мере на 5%, или по меньшей мере на 10%, или по меньшей мере на 15%, или по меньшей мере на 20%, или по меньшей мере на 25%, или по меньшей мере на 30%, или по меньшей мере на 35%, или по меньшей мере на 40%, или по меньшей мере на 45%, или по меньшей мере на 50% по сравнению с объемом опухоли в отсутствие иммунопотенциатора. Измерение объема опухоли может быть проведено с применением способов, хорошо известных в данной области техники.

Согласно другому варианту реализации иммунопотенциатор увеличивает активность B-клеток (гуморальный иммунный ответ), например, путем увеличения объема продуцирования антиген-специфического антитела по сравнению с продуцированием антиген-специфического антитела в отсутствие иммунопотенциатора. Например, иммунопотенциатор может увеличивать продуцирование антиген-специфического антитела по меньшей мере на 5%, или по меньшей мере на 10%, или по меньшей мере на 15%, или по меньшей мере на 20%, или по меньшей мере на 25%, или по меньшей мере на 30%, или по меньшей мере на 35%, или по меньшей мере на 40%, или по меньшей мере на 45%, или по меньшей мере на 50% по сравнению с продуцированием антиген-специфического антитела в отсутствие иммунопотенциатора. Согласно одному варианту реализации оценивают продуцирование антиген-специфического IgG. Оценка продуцирования антиген-специфического антитела может быть получена с применением способов, хорошо известных в данной области техники, в том числе, но не ограничиваясь перечисленным, ИФА ELISA, РИА и т.п., для измерения уровня антиген-специфического антитела (например, IgG) в образце (например, образце сыворотки).

Согласно другому варианту реализации иммунопотенциатор увеличивает популяцию эффекторных CD62Llo T-клеток памяти. Например, иммунопотенциатор может увеличивать общий % CD62Llo T-клеток в CD8+ T-клетках. Помимо других функций, популяция эффекторных CD62Llo T-клеток памяти, как было показано, выполняет важную для миграции лимфоцитов функцию (см., например, Schenkel, J.M. and Masopust, D. (2014) Immunity 41:886-897). Согласно различным вариантам реализации иммунопотенциатор может увеличивать общий процент эффекторных CD62Llo T-клеток памяти в CD8+ T-клетках при ответе на антиген (по сравнению с общим процентом CD62Llo T-клеток в популяции CD8+ T-клеток в отсутствие иммунопотенциатора) по меньшей мере на 5%, или по меньшей мере на 10%, или по меньшей мере на 15%, или по меньшей мере на 20%, или по меньшей мере на 25%, или по меньшей мере на 30%, или по меньшей мере на 35%, или по меньшей мере на 40%, или по меньшей мере на 45% или по меньшей мере на 50%. Общий процент эффекторных CD62Llo T-клеток памяти в CD8+ T-клетках может быть определен с применением стандартных способов, известных в данной области техники, в том числе, но не ограничиваясь перечисленным, сортировки клеток с активированной флуоресценцией (FACS) или активируемой магнитным полем сортировки клеток (MACS).

Оценка способности иммунопотенциирующей мРНК-конструкции усиливать иммунный ответ на раковый антиген может быть проведена в модельных системах на мышах, известных в данной области техники. Согласно одному варианту реализации используют модельную систему с иммунокомпетентными мышами. Согласно одному варианту реализации модельная система на мышах включает мышей C57/Bl6 (например, для оценки ответов антиген-специфических CD8+ T-клеток на раковый антиген, например, согласно описанию в примерах). Согласно другому варианту реализации указанный модельная система на мышах включает мышей BalbC или мышей CD1 (например, для оценки ответов B-клеток, таких как ответы с образованием антиген-специфических антител).

Согласно одному варианту реализации иммунопотенциирующий полипептид согласно настоящему описанию функционирует в нисходящем направлении от по меньшей мере одного Toll-подобного рецептора (TLR), усиливая таким образом иммунный ответ. Соответственно, согласно одному варианту реализации указанный иммунопотенциатор представляет собой не TLR, а молекулу сигнального пути TLR в 3’-направлении от собственно рецептора.

Согласно одному варианту реализации мРНК согласно настоящему описанию, кодирующая иммунопотенциатор, может содержать одно или более модифицированных нуклеиновых оснований. Подходящие модификации более подробно обсуждаются ниже.

Согласно одному варианту реализации мРНК согласно настоящему описанию, кодирующая иммунопотенциатор, введена в состав липидной наночастицы. Согласно одному варианту реализации указанная липидная наночастица дополнительно содержит мРНК, кодирующую раковый антиген. Согласно одному варианту реализации указанную липидную наночастицу вводят субъекту для усиления иммунного ответа против указанного ракового антигена у указанного субъекта. Подходящие наночастицы и способы их применения более подробно обсуждаются ниже.

Иммунопотенциирующие мРНК, которые стимулируют интерферон I типа

Согласно некоторым аспектам настоящего изобретения предложена иммунопотенциирующая мРНК, кодирующая полипептид, который стимулирует или усиливает иммунный ответ против представляющего интерес антигена путем стимуляции или усиления сигнализации через путь интерферона типа I, стимулируя или усиливая таким образом продуцирование интерферона I типа (ИФН). Было установлено, что для успешной индукции противоопухолевого или противомикробного адаптивного иммунитета требуется сигнализация через ИФН I типа (см., например, Fuertes, M.B. et al. (2013) Trends Immunol. 34:67-73). Продуцирование ИФН I типа (в том числе ИФН-α, ИФН-β, ИФН-ε, ИФН-κ и ИФН-ω) играет роль в выведении микробиологических инфекций, таких как вирусные инфекции. Было также выяснено, что ДНК клетки-хозяина (например, происходящая из поврежденных или умирающих клеток) способна индуцировать продуцирование интерферона I типа, и что сигнальный путь ИФН I типа играет роль в развитии адаптивного противоопухолевого иммунитета. Однако у многих патогенов и раковых клеток развились механизмы для снижения или ингибирования ответа интерферона I типа. Соответственно, активация (в том числе стимуляция и/или усиление) сигнального пути ИФН I типа у нуждающегося в этом субъекта, путем введения иммунопотенциирующей мРНК согласно настоящему описанию указанному субъекту, стимулирует или усиливает иммунный ответ у указанного субъекта при широком спектре клинических ситуаций, в том числе для лечения рака и патогенных инфекций, а также потенциирования ответов на вакцины для обеспечения защитного иммунитета.

Интерфероны I типа (ИФН) представляют собой провоспалительные цитокины, которые быстро продуцируются в несколько отличный типах клеток, как правило, при вирусной инфекции, и, как известно, оказывают широкий спектр эффектов Канонические последствия продуцирования ИФН I типа in vivo представлены активацией противомикробных клеточных программ и развитием врожденного и адаптивного иммунного ответа. ИФН I типа индуцирует внутренний противомикробный статус в инфицированных и соседних с ними клетках, что ограничивает распространение инфекционных агентов, в частности, вирусных патогенов. ИФН I типа также модулирует активацию клеток врожденной иммунной системы (например, созревание дендритных клеток), способствуя презентации антигенов и функциям естественных киллерных клеток. ИФН I типа также способствует развитию высокоаффинных антигенспецифических T- и B-клеточных ответов и иммунологической памяти (Ivashkiv and Donlin (2014) Nat Rev Immunol 14(1):36-49).

ИФН I типа активирует дендритные клетки (ДК) и способствует их способности стимулировать T-клетки посредством аутокринной сигнализации (Montoya et al., (2002) Blood 99:3263-3271). Воздействие ИФН I типа облегчает созревание ДК, повышая экспрессию хемокиновых рецепторов и молекул адгезии (например, чтобы способствовать миграции ДК в дренирующие лимфатические узлы), костимулирующих молекул; и презентацию антигенов MHC класса I и класса II. ДК, созревающие после воздействия ИФН I типа может эффективно примировать защитные ответы T-клеток (Wijesundara et al., (2014) Front Immunol 29(412), с упоминаемыми источниками).

ИФН I типа может либо способствовать активации, пролиферации, дифференцировке и выживанию T-клеток, либо ингибировать их, что в значительной мере зависит от распределения во времени сигнализации ИФН I типа относительно сигнализации T-клеточных рецепторов (Crouse et al., (2015) Nat Rev Immunol 15:231-242). Первые исследования показали, что положительная регуляция экспрессии MHC-I в ответ на ИФН I типа происходит в нескольких типах клеток (Lindahl et al., (1976), J Infect Dis 133(Suppl):A66-A68; Lindahl et al., (1976) Proc Natl Acad Sci USA 17:1284-1287), что необходимо для оптимальной стимуляции, дифференцировки, размножения и цитолитической активности T-клеток. ИФН I типа может оказывать мощные костимулирующие эффекты на CD8 T-клетки, усиливая пролиферацию и дифференцировку CD8 T-клеток (Curtsinger et al., (2005) J Immunol 174:4465-4469; Kolumam et al., (2005) J Exp Med 202:637-650).

Как и в случае с эффектами на T-клетки, сигнализация ИФН I типа оказывает как положительные, так и отрицательные эффекты на ответ B-клеток в зависимости от распределения во времени и контекста воздействия (Braun et al., (2002) Int Immunol 14(4):411-419; Lin et al, (1998) 187(1):79-87). Выживание и созревание незрелых B-клетки могут быть ингибированы сигнализацией ИФН I типа. Вопреки действию на незрелые B-клетки, как было показано, воздействие ИФН I типа способствует активации B-клеток, продуцированию антител и переключению изотипов после вирусной инфекции или после экспериментальной иммунизации (Le Bon et al., (2006) J Immunol 176:4:2074-2078; Swanson et al., (2010) J Exp Med 207:1485-1500).

Был установлен ряд компонентов, вовлеченных в сигнальный путь ИФН I типа, в том числе STING, регуляторные факторы интерферонов («Interferon Regulatory Factors»), такие как IRF1, IRF3, IRF5, IRF7, IRF8 и IRF9, TBK1, IKKi, MyD88 и TRAM. Дополнительные компоненты, вовлеченные в сигнальный путь ИФН I типа, включают TRAF3, TRAF6, IRAK-1, IRAK-4, TRIF, IPS-1, TLR-3, TLR-4, TLR-7, TLR-8, TLR-9, RIG-1, DAI и IFI16.

Соответственно, согласно одному варианту реализации иммунопотенциирующая мРНК кодирует любой из вышеупомянутых компонентов, вовлеченных в сигнальный путь ИФН I типа.

Иммунопотенциирующие мРНК, кодирующие STING

Настоящим изобретением предусмотрена мРНК (в том числе ммРНК), кодирующая STING, в том числе конститутивно активные формы STING, в качестве иммунопотенциаторов. STING («STimulator of INterferon Genes», стимулятор генов интерферона; также известный как трансмембранный белок 173 (TMEM173), медиатор активации IRF3 (MITA), метионин-пролин-тирозин-сериновый (MPYS) и ЭПР-ИФН-стимулятор (ERIS)) представляет собой резидентный (ER) трансмембранный белок эндоплазматического ретикулума размером 379 аминокислот, который функционирует в качестве сигнальной молекулы, контролирующей транскрипцию генов иммунного ответа, в том числе ИФН I типа и провоспалительных цитокинов (Ishikawa & Barber, (2008) Nature 455:647-678; Ishikawa et al., (2009) Nature 461:788-792; Barber (2010) Nat Rev Immunol 15(12):760-770).

STING функционирует как сигнальный адаптор, связывающий детекцию ДНК в цитозоле с осью сигнализации TBK1/IRF3/ИФН I типа. Сигнальные адапторные функции STING активируются за счет прямого сенсорного восприятия циклических динуклеотидов (ЦДН). Примеры ЦДН включают циклический ди-ГМФ (гуанозин 5'-монофосфат), циклический ди-АМФ (аденозин 5'-монофосфат) и циклический ГМФ-АМФ (цГАМФ). Изначально охарактеризованные как общераспространенные бактериальные вторичные мессенджеры, в настоящее время ЦДН известны как класс молекул ассоциированных с патогенами молекулярных паттернов (PAMP), которые активируют ось сигнализации TBK1/IRF3/ИФН I типа за счет прямого взаимодействия со STING. STING способен к восприятию аберрантных видов ДНК и/или ЦДН в цитозоле клетки, в том числе ЦДН, происходящих из бактерий и/или из белка хозяина, циклической ГМФ-АМФ-синтазы (cGAS). Белок cGAS представляет собой сенсор ДНК, который продуцирует цГАМФ в ответ на детекцию ДНК в цитозоле (Burdette et al., (2011) Nature 478:515-518; Sun et al., (2013) Science 339:786-791; Diner et al., (2013) Cell Rep 3:1355-1361; Ablasser et al., (2013) Nature 498:380-384).

При связывании с ЦДН STING димеризуется и подвергается конформационному изменению, способствующему образованию комплекса с TANK-связывающей киназой 1 (TBK1) (Ouyang et al., (2012) Immunity 36(6):1073-1086). Указанный комплекс транслоцируется в перинуклеарную часть аппарата Гольджи, обуславливая доставку TBK1 в эндолизосомальные компартменты, где он фосфорилирует транскрипционные факторы IRF3 и NF-κB (Zhong et al., (2008) Immunity 29:538-550). Недавнее исследование показало, что STING функционирует в качестве скаффолда, связываясь и с TBK1, и с IRF3, что способствует, в частности, фосфорилированию IRF3 киназой TBK1 (Tanaka & Chen, (2012) Sci Signal 5(214):ra20). Активация IRF3-, IRF7- и NF-κB-зависимых сигнальных путей индуцирует продуцирование цитокинов и других связанных с иммунным ответом белков, таких как ИФН I типа, которые способствуют антипатогенной и/или противоопухолевой активности.

В ряде исследований изучали применение ЦДН-агонистов STING в качестве потенциальных вакцинных адъювантов или иммуномодулирующих агентов, вызывающих гуморальный и клеточный иммунный ответ (Dubensky et al., (2013) Ther Adv Vaccines 1(4):131-143, включая упоминаемые источники). Начальные исследования продемонстрировали, что введение ЦДН c-ди-ГМФ ослабляло инфекцию Staphylococcus aureus in vivo, уменьшало количество выделенных бактериальных клеток в модели инфекции на мышах, однако c-ди-ГМФ оказывал не поддающийся наблюдению ингибиторный или бактерицидный эффект на бактериальные клетки in vitro, что позволяет предположить, что снижение количества бактериальных клеток было обусловлено эффектом, оказываемым на иммунную систему хозяина (Karaolis et al., (2005) Antimicrob Agents Chemother 49:1029-1038; Karaolis et al., (2007) Infect Immun 75:4942-4950). Недавние исследования показали, что молекулы синтетических производных ЦДН, введенные в состав продуцирующих гранулоцитарно-макрофагальный колониестимулирующий фактор (ГМ-КСФ) противораковых вакцин (называемых STINGVAX), вызывали усиленные противоопухолевые эффекты in vivo в терапевтических моделях рака на животных по сравнению с иммунизацией только ГМ-КСФ-вакциной (Fu et al., (2015) Sci Transl Med 7(283):283ra52), что предполагает, что ЦДН являются мощными вакцинными адъювантами.

Были описаны мутантные белки STING, образующиеся в результате полиморфизмов, картированных на ген TMEM173 человека, демонстрирующие фенотип «с приобретением функции» или конститутивно активный фенотип. Было показано, что при экспрессии in vitro мутантные аллели STING действенно стимулируют индукцию ИФН I типа (Liu et al., (2014) N Engl J Med 371:507-518; Jeremiah et al., (2014) J Clin Invest 124:5516-5520; Dobbs et al., (2015) Cell Host Microbe 18(2):157-168; Tang & Wang, (2015) PLoS ONE 10(3):e0120090; Melki et al., (2017) J Allergy Clin Immunol In Press; Konig et al., (2017) Ann Rheum Dis 76(2):468-472; Burdette et al. (2011) Nature 478:515-518).

Согласно настоящему изобретению предложены модифицированные мРНК (ммРНК), кодирующие конститутивно активные формы STING, в том числе мутантные изоформы STING человека для применения в качестве иммунопотенциаторов согласно описанию в настоящем документе. ммРНК, кодирующая конститутивно активные формы STING, в том числе мутантные изоформы STING человека, приведены в перечне последовательностей в настоящем документе. Нумерация остатков аминокислот для мутантных полипептидов STING человека, применяемых согласно настоящему изобретению, соответствует используемой для 379 остатков аминокислоты STING человека дикого типа (изоформа 1), доступных в данной области техники как номер доступа Genbank NP_938023.

Соответственно, согласно одному аспекту настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутацию остатка аминокислоты 155, в частности, замену аминокислоты, такую как мутация V155M. Согласно одному варианту реализации указанная ммРНК кодирует последовательность аминокислот, соответствующую SEQ ID NO:1. Согласно одному варианту реализации указанный мутант STING V155M кодирует последовательность нуклеотидов, представленная в SEQ ID NO: 199. Согласно одному варианту реализации указанная ммРНК содержит последовательность 3’ UTR, представленную в SEQ ID NO: 209, которая включает сайт связывания miR122.

Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутацию остатка аминокислоты 284, такую как замена аминокислоты. Неограничивающие примеры замен остатка 284 включают R284T, R284M и R284K. Согласно некоторым вариантам реализации указанный мутантный белок STING человека содержит мутацию R284T, например, имеет последовательность аминокислот, представленную в SEQ ID NO: 2, или его кодирует последовательность нуклеотидов, представленную в SEQ ID NO 200. Согласно некоторым вариантам реализации указанный мутантный белок STING человека содержит мутацию R284M, например, имеет последовательность аминокислот, соответствующую SEQ ID NO: 3, или его кодирует последовательность нуклеотидов, представленная в SEQ ID NO: 201. Согласно некоторым вариантам реализации указанный мутантный белок STING человека содержит мутацию R284K, например, имеет последовательность аминокислот, соответствующую SEQ ID NO: 4 или 224, или его кодирует последовательность нуклеотидов, представленная в SEQ ID NO: 202 или 225.

Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутацию остатка аминокислоты 154, такую как замена аминокислоты, такую как мутация N154S. Согласно некоторым вариантам реализации указанный мутантный белок STING человека содержит мутацию N154S, например, имеет последовательность аминокислот, соответствующую SEQ ID NO: 5, или его кодирует последовательность нуклеотидов, представленная в SEQ ID NO: 203.

Согласно другим дополнительным аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутацию остатка аминокислоты 147, такую как замена аминокислоты, такую как мутация V147L. Согласно некоторым вариантам реализации указанный мутантный белок STING человека, содержащий мутацию V147L имеет последовательность аминокислот, соответствующую SEQ ID NO: 6, или его кодирует последовательность нуклеотидов, представленная в SEQ ID NO: 204.

Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутацию остатка аминокислоты 315, такую как замена аминокислоты, такую как мутация E315Q. Согласно некоторым вариантам реализации указанный мутантный белок STING человека, содержащий мутацию E315Q имеет последовательность аминокислот, соответствующую SEQ ID NO: 7, или его кодирует последовательность нуклеотидов, представленная в SEQ ID NO: 205.

Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутацию остатка аминокислоты 375, такую как замена аминокислоты, такую как мутация R375A. Согласно некоторым вариантам реализации указанный мутантный белок STING человека, содержащий мутацию R375A, имеет последовательность аминокислот, соответствующую SEQ ID NO: 8, или его кодирует последовательность нуклеотидов, представленная в SEQ ID NO: 206.

Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий одну или более, или комбинацию двух, трех, четырех или более из вышеупомянутых мутаций. Соответственно, согласно одному аспекту настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий одну или более мутаций, выбранных из группы, состоящей из: V147L, N154S, V155M, R284T, R284M, R284K, E315Q и R375A, и их комбинаций. Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий комбинацию мутаций, выбранных из группы, состоящей из: V155M и R284T; V155M и R284M; V155M и R284K; V155M и V147L; V155M и N154S; V155M и E315Q; и V155M и R375A.

Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутацию V155M и одну, две, три или более из следующих мутаций: R284T; R284M; R284K; V147L; N154S; E315Q; и R375A. Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутации V155M, V147L и N154S. Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутации V155M, V147L, N154S и, необязательно, мутацию аминокислоты 284. Согласно другим дополнительным аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутации V155M, V147L, N154S, и мутацию аминокислоты 284, выбранную из R284T, R284M и R284K. Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутации V155M, V147L, N154S и R284T. Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутации V155M, V147L, N154S и R284M. Согласно другим аспектам настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий мутации V155M, V147L, N154S и R284K.

Согласно другим вариантам реализации настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, содержащий комбинацию мутаций остатков аминокислот 147, 154, 155 и, необязательно, 284, в частности, замены аминокислот, такие как V147L, N154S, V155M и, необязательно, R284M. Согласно некоторым вариантам реализации указанный мутантный белок STING человека содержит мутации V147N, N154S и V155M, например, последовательность аминокислот, соответствующую SEQ ID NO: 9 или кодируемую последовательностью нуклеотидов, представленной в SEQ ID NO: 207. Согласно некоторым вариантам реализации указанный мутантный белок STING человека содержит мутации R284M, V147N, N154S и V155M, например, последовательность аминокислот, соответствующую SEQ ID NO: 10 или кодируемую последовательностью нуклеотидов, представленной в SEQ ID NO: 208.

Согласно другому варианту реализации настоящего изобретения предложена ммРНК, кодирующая мутантный белок STING человека, который представляет собой конститутивно активную усеченную форму полноразмерного белка дикого типа длиной 379 аминокислот, такую как конститутивно активный полипептид STING человека, состоящий из аминокислот 137-379.

Агенты для стимуляции антигенпрезентирующих клеток

Согласно некоторым вариантам реализации указанные РНК-вакцины могут быть скомбинированы с агентами, способствующими получению антигенпрезентирующих клеток (АПК), например, путем преобразования не-АПК в псевдо-АПК. Презентация антигена представляет собой ключевой этап инициации, амплификации и продолжительности иммунного ответа. В ходе указанного процесса фрагменты антигенов презентируются через главный комплекс гистосовместимости (MHC) или антигены лейкоцитов человека (HLA) T-клеткам, запускающим антиген-специфический иммунный ответ. При иммунной профилактике и терапии усиление указанного ответа важно для повышения эффективности. РНК-вакцины согласно настоящему изобретению могут быть разработаны или усовершенствованы для обеспечения эффективной презентации антигена. Один из способов усиления процессинга и презентации АПК заключается в обеспечении лучшего нацеливания РНК-вакцин на антигенпрезентирующие клетки (АПК). Другой подход включает активацию АПК-клеток иммуностимулирующими составами и/или компонентами.

Как вариант, способы репрограммирования не-АПК для преобразования их в АПК могут применяться с РНК-вакцинами согласно настоящему изобретению. Важно отметить, что большинство клеток, поглощающих мРНК-составы и являющихся мишенями их терапевтического действия, не являются АПК. Соответственно, разработка способа преобразования указанных клеток в АПК будет благоприятным для эффективности. Согласно настоящему изобретению предложены способы и подходы для доставки в клетки РНК-вакцин, например, мРНК-вакцин, одновременно также способствующие переходу не-АПК в АПК. Согласно некоторым вариантам реализации мРНК, кодирующую репрограммирующую АПК молекулу, включают в указанную РНК-вакцину или вводят совместно с указанной РНК-вакциной.

Репрограммирующая АПК молекула в настоящем документе представляет собой молекулу, которая способствует переходу не являющейся АПК клетки к АПК-подобному фенотипу. АПК-подобный фенотип представляет собой свойство, обеспечивающее процессинг MHC класса II. Соответственно, АПК-клетка с АПК-подобным фенотипом представляет собой клетку, содержащую одну или более экзогенных молекул (репрограммирующую АПК молекулу), которая обладает повышенной способностью к процессингу MHC класса II по сравнению с той же клеткой, не содержащей указанных одной или более экзогенных молекул. Согласно некоторым вариантам реализации репрограммирующая АПК молекула представляет собой CIITA (центральный регулятор экспрессии MHC класса II); белок-шаперон, такой как CLIP, HLA-DO, HLA-DM и т.п. (усиливающие нагрузку фрагментами антигенов MHC класса II) и/или костимулирующую молекулу, например, CD40, CD80, CD86 и т.п. (усиливающие распознавание антигенов T-клетками и активацию T-клеток).

Белок CIITA представляет собой транс-активатор, который усиливает активацию транскрипции генов MHC класса II (Steimle et al., 1993, Cell 75:135-146) за счет взаимодействия с консервативным набором ДНК-связывающих белков, которые ассоциированы с промоторной областью класса II. Функция активации транскрипции CIITA был картирована на аминоконцевой кислотный домен (аминокислоты 26-137). Молекула нуклеиновой кислоты, кодирующая белок, который взаимодействует с CIITA, называемый CIITA-взаимодействующим белком 104 (также называемым в настоящем документе CIP104). И CITTA, и CIP104, как было показано, усиливают транскрипцию с промоторов MHC класса II и, соответственно, подходят для применения в качестве репрограммирующей АПК молекулы согласно настоящему изобретению. Согласно некоторым вариантам реализации репрограммирующая АПК молекула представлена полноразмерным CIITA, CIP104 или другими родственными молекулами или их активными фрагментами, например, аминокислотами 26-137 CIITA, или аминокислотами, последовательности которых по меньшей мере на 80% идентичны им, и сохраняющими способность усиливать активацию транскрипции генов MHC класса II.

Согласно предпочтительным вариантам реализации репрограммирующую АПК молекулу доставляют субъекту в форме мРНК, кодирующей указанную репрограммирующую АПК молекулу. Соответственно, РНК-вакцины согласно настоящему изобретению могут включать мРНК, кодирующую репрограммирующую АПК молекулу. Согласно некоторым вариантам реализации указанная мРНК является моноцистронной. Согласно другим вариантам реализации она является полицистронной. Согласно некоторым вариантам реализации мРНК, кодирующая один или более антигенов, и мРНК, кодирующая репрограммирующую АПК молекулу, содержатся в отдельных составах. Согласно другим вариантам реализации мРНК, кодирующая один или более антигенов, и мРНК, кодирующая репрограммирующую АПК молекулу, содержатся в одном составе. Согласно некоторым вариантам реализации мРНК, кодирующая один или более антигенов, вводят субъекту одновременно с мРНК, кодирующей репрограммирующую АПК молекулу. Согласно другим вариантам реализации мРНК, кодирующий один или более антигенов, и мРНК, кодирующую репрограммирующую АПК молекулу, вводят субъекту в разное время. Например, мРНК, кодирующая репрограммирующую АПК молекулу, может быть введена до введения мРНК, кодирующей один или более антигенов. мРНК, кодирующая репрограммирующую АПК молекулу, может быть введена непосредственно перед введением, по меньшей мере за 1 час до введения, по меньшей мере за 1 сутки до введения, по меньшей мере за одну неделю до введения или по меньшей мере за один месяц до введения мРНК, кодирующей указанные антигены.

Как вариант, мРНК, кодирующая репрограммирующую АПК молекулу, может быть введена после введения мРНК, кодирующей один или более антигенов. мРНК, кодирующая репрограммирующую АПК молекулу, может быть введена непосредственно после введения, по меньшей мере через 1 час после введения, по меньшей мере через 1 сутки после введения, по меньшей мере через одну неделю после введения, или по меньшей мере через один месяц после введения мРНК, кодирующей указанные антигены. Согласно некоторым вариантам реализации указанный антиген представляет собой раковый антиген, такой как специфический для пациента антиген. Согласно другим вариантам реализации указанный антиген представляет собой антиген инфекционного заболевания.

Согласно некоторым вариантам реализации указанная мРНК-вакцина может включать антиген-приманку, также иногда называемый антигеном памяти. Антиген-приманка представляет собой антиген, с которым ранее сталкивался индивидуум и для которого уже существуют лимфоциты памяти. Согласно некоторым вариантам реализации указанный антиген-приманка может представлять собой антиген инфекционного заболевания, с которым предположительно сталкивался индивидуум, такой как антиген гриппа. Антиген-приманка помогает стимулировать более сильный иммунный ответ.

Антигены или неоэпитопы, выбранные для включения в мРНК-вакцину, как правило, представляют собой связывающиеся с высокой аффинностью пептиды. Согласно некоторым аспектам указанные антигены или неоэпитопы связывают белок HLA с более высокой аффинностью, чем пептид дикого типа. Указанный антиген или неоэпитоп имеет IC50 по меньшей мере ниже 5000 нМ, по меньшей мере ниже 500 нМ, по меньшей мере ниже 250 нМ, по меньшей мере ниже 200 нМ, по меньшей мере ниже 150 нМ, по меньшей мере ниже 100 нМ, по меньшей мере ниже 50 нМ; или меньше, согласно некоторым вариантам реализации. Как правило, пептиды с предсказанной IC50<50 нМ обычно считают связывающими пептидами с аффинностью от средней до высокой, и выбирают для эмпирического тестирования аффинности с применением биохимических анализов связывания HLA. Раковые антигены могут представлять собой персонализированные раковые антигены. Персонализированная противораковая РНК-вакцина, например, может включать РНК, кодирующую один или более известных раковых антигенов, специфических для опухоли, или раковых антигенов, специфических для каждого субъекта, называемых неоэпитопами или специфическими для субъекта эпитопами или антигенами. «Специфический для субъекта раковый антиген» представляет собой антиген, который был идентифицирован как экспрессирующийся в опухоли конкретного пациента. Специфический для субъекта раковый антиген может преимущественно присутствовать или не присутствовать в образцах опухолей в общем случае. Опухолеассоциированные антигены, которые не экспрессируются или редко экспрессируются в нераковых клетках, или отличающиеся достаточно сниженной экспрессией в нераковых клетках по сравнению с экспрессией в раковых клетках, и индуцирующие иммунный ответ, индуцируемый при вакцинации, называются неоэпитопами. Неоэпитопы, такие как опухолеассоциированные антигены, являются полностью чужеродными для организма и, соответственно, не будут вызывать иммунного ответа против здоровой ткани или не будут маскированы защитными компонентами иммунной системы. Согласно некоторым вариантам реализации персонализированные противораковые РНК-вакцины на основе неоэпитопов являются желательными, поскольку вакцины с таким составом будут максимизировать специфичность в отношении специфической опухоли пациента. Обусловленные мутациями неоэпитопы могут возникать в результате точечных мутаций, несинонимичных мутаций, приводящих к появлению других аминокислот в белке; мутаций сквозного прочитывания, когда происходит модификация или удаление стоп-кодона, что приводит к трансляции более длинного белка с новой опухолеспецифической последовательностью на C-конце; мутаций сайта сплайсинга, которые приводят к включению интрона в зрелую мРНК и, соответственно, образованию уникальной опухолеспецифической белковой последовательности; хромосомных перестроек, в результате которых образуется химерный белок с опухолеспецифическими последовательностями в участке сращивания двух белков (т.е. слияния генов); мутаций со сдвигом рамки или делеций, приводящих к образованию новой открытой рамки считывания с новой опухолеспецифической белковой последовательностью; и транслокаций. Соответственно, согласно некоторым вариантам реализации противораковые РНК-вакцины включают по меньшей мере 1 раковый антиген, включающий мутации, выбранные из группы, состоящей из мутаций со сдвигом рамки и рекомбинаций, или любых других мутаций, описанных в настоящем документе.

Способы получения персонализированных противораковых РНК-вакцин обычно включают идентификацию мутаций, например, с применением методик глубокого секвенирования нуклеиновых кислот или белков, идентификацию неоэпитопов, например, с применением валидированных алгоритмов предсказания связывания пептидов с MHC или других аналитических методик для создания набора кандидатных Т-клеточных эпитопов, которые могут связываться с аллелями HLA пациента и основаны на мутациях, присутствующих в опухолях, необязательную демонстрацию антиген-специфических T-клеток, направленных против выбранных неоэпитопов, или демонстрацию того, что кандидатный неоэпитоп связывается с белками HLA на поверхности опухоли, и разработку вакцины. Противораковые РНК-вакцины согласно настоящему изобретению могут включать несколько копий единственного неоэпитопа, несколько разных неоэпитопов, основанных на одном типе мутации, таком как точечная мутация, несколько разных неоэпитопов, основанных на различных типах мутаций, неоэпитопы и другие антигены, такие как опухолеассоциированные антигены или антигены-приманки.

Примеры методик для идентификации мутаций включают, не ограничиваясь перечисленными, динамическую аллель-специфическую гибридизацию (DASH), микропланшетный диагональный гель-электрофорез (MADGE), пиросеквенирование, олигонуклеотид-специфическое лигирование, систему TaqMan, а также различные технологии ДНК-«чипов», таких как т.е. SNP-чипы Affymetrix, и способы, основанные на получении малых сигнальных молекул путем инвазивного расщепления с последующим использованием масс-спектрометрии или иммобилизованных замыкающих кольцо зондов и амплификации по типу катящегося кольца.

Методики глубокого секвенирования нуклеиновых кислот или белков известны в данной области техники. Может быть использован любой способ анализа последовательностей. Секвенирование нуклеиновых кислот может быть выполнено на целых опухолевых геномах, опухолевых экзомах (кодирующей белки ДНК), опухолевых транскриптомах или экзосомах. Технологии одномолекулярного секвенирования путем синтеза в реальном времени основаны на детекции флуоресцентных нуклеотидов, поскольку их включают в образующуюся цепь ДНК, комплементарную секвенируемой матрице. Существуют и другие способы быстрого высокопроизводительного секвенирования. Секвенирование белков может быть выполнено на опухолевых протеомах. Кроме того, масс-спектрометрия белков может применяться для идентификации или валидации присутствия мутированных пептидов, связанных с белками MHC на опухолевых клетках. Пептиды могут быть элюированы кислотой из опухолевых клеток или из молекул HLA, иммунопреципитированных из опухоли, а затем идентифицированы с применением масс-спектрометрии. Результаты секвенирования могут сравниваться с известными контрольными наборами или результатами анализов методом секвенирования для нормальной ткани пациента.

Соответственно, настоящее изобретение относится к способам идентификации и/или детекции неоэпитопов антигена, таких как T-клеточные эпитопы. В частности, согласно настоящему изобретению предложены способы идентификации и/или детекции опухолеспецифических неоэпитопов, которые подходят для индуцирования опухолеспецифического иммунного ответа у субъекта. Необязательно, указанные неоэпитопы связываются с белками HLA класса I с более высокой аффинностью, чем пептид дикого типа, и/или способны активировать противоопухолевые CD8 T-клетки. Идентичные мутации какого-либо конкретного гена редко встречаются в разных опухолях.

Белки MHC класса I присутствуют на поверхности на поверхности почти всех клеток организма, в том числе большинства опухолевых клеток. Белки MHC класса I нагружаются антигенами, которые обычно происходят из эндогенных белков или патогенов, присутствующих внутри клеток, и затем презентируются цитотоксическим T-лимфоцитам (CTL). T-клеточные рецепторы способны распознавать и связывать пептиды в комплексах с молекулами MHC класса I. Каждый цитотоксический T-лимфоцит экспрессирует уникальный T-клеточный рецептор, который способен к связыванию специфических MHC/пептидных комплексов.

Используя компьютерные алгоритмы, можно предсказывать потенциальные неоэпитопы, такие как T-клеточные эпитопы, т.е. последовательности пептидов, связываемые молекулами MHC класса I или класса II в форме пептид-презентирующего комплекса, и затем, в указанной форме, распознаваемые T-клеточными рецепторами T-лимфоцитов. Примеры программ, подходящих для идентификации пептидов, которые будут связываться с MHC, включают, например: Lonza Epibase, SYFPEITHI (Rammensee et al., Immunogenetics, 50 (1999), 213-219) и HLA_BIND (Parker et al., J. Immunol., 152 (1994), 163-175).

После выбора предполагаемых неоэпитопов они могут быть дополнительно протестированы с применением анализов in vitro и/или in vivo. Стандартные лабораторные анализы in vitro, такие как анализы Elispot, могут применяться для изолята от каждого пациента, чтобы уточнить перечень неоэпитопов, выбранных на основе полученных с помощью алгоритма предсказаний. И вакцины с неоэпитопами, и способы их применения и получения описаны в PCT/US2016/044918, включенном в настоящий документ полностью посредством ссылки.

Пептиды активирующей мутации онкогена, выбранные для включения в противораковые РНК-вакцины, как правило, представляют собой высокоаффинные связывающие пептиды. Согласно некоторому аспекту пептид активирующей мутации онкогена связывает белок HLA с более высокой аффинностью, чем пептид дикого типа. Указанные пептиды активирующей мутации онкогена имеют IC50 по меньшей мере менее 5000 нМ, по меньшей мере менее 500 нМ, по меньшей мере менее 250 нМ, по меньшей мере менее 200 нМ, по меньшей мере менее 150 нМ, по меньшей мере менее 100 нМ, по меньшей мере менее 50 нМ, или меньше, согласно некоторым вариантам реализации. Как правило, пептиды с предсказанной IC50<50 нМ обычно считают связывающими пептидами с аффинностью от средней до высокой, и их выбирают для эмпирического тестирования аффинности с применением биохимических анализов связывания HLA.

Специфические для субъекта раковые антигены для персонализированной противораковой вакцины могут быть идентифицированы в образце от пациента. Например, указанный образец может представлять собой образец ткани или образец опухоли. Например, может быть изучен образец одной или более опухолевых клеток для определения присутствия специфических для субъекта раковых антигенов. Исследование образца опухоли может быть проведено с применением полногеномного, экзомного или транскриптомного анализа для идентификации специфических для субъекта раковых антигенов.

Как вариант, специфические для субъекта раковые антигены могут быть идентифицированы в экзосоме субъекта. Если антигены для вакцины идентифицированы в экзосоме субъекта, говорят, что такие антигены являются репрезентативными для экзосомных антигенов субъекта.

Экзосомы представляют собой небольшие микровезикулы, отщепляемые клетками, как правило, имеющие диаметр приблизительно 30-100 нм. В классическом случае экзосомы образуются путем впячивания внутрь и отшнуровывания от мембраны поздней эндосомы, что приводит к образованию мультивезикулярного тельца (MVB), заполненного небольшими везикулами с липидным бислоем, каждая из которых содержит образец цитоплазмы клетки пациента. Слияние MVB с мембраной клетки приводит к высвобождению указанных экзосом из клетки и их доставке в кровь, мочу, спинномозговую жидкость или другие биологические жидкости. Экзосомы могут быть выделены из любой из указанных биологических жидкостей для дальнейшего анализа.

Нуклеиновые кислоты в экзосомах играют роль биомаркеров опухолевых антигенов. Преимущество анализа экзосом для идентификации специфических для субъекта раковых антигенов заключается в том, что при указанном способе отпадает необходимость в проведении биопсии. Это может быть особенно благоприятным, если пациенту необходимо пройти несколько циклов терапии, включающей идентификацию раковых антигенов и вакцинацию.

В данной области техники был описан ряд способов выделения экзосом из биологического образца. Например, могут применяться следующие способы: дифференциальное центрифугирование, низкоскоростное центрифугирование, анионообменная хроматография и/или гель-проникающая хроматография, электрофорез в градиенте плотности сахарозы или электрофорез органелл, активируемая магнитным полем сортировка клеток (MACS), концентрирование ультрафильтрацией на наномембранах, выделение в градиенте перколла и применением микрофлюидных устройств. Примеры способов описаны, например, в патентной публикации США №2014/0212871.

Термин «биологический образец» относится к образцу, который содержит биологические материалы, такие как ДНК, РНК и белок. Согласно некоторым вариантам реализации предусмотрено, что указанный биологический образец может содержать биологическую жидкость от субъекта. Указанные биологические жидкости могут представлять собой жидкости, выделенные из любой части организма субъекта, предпочтительно, периферически локализованной, в том числе, но не ограничиваясь перечисленными, например, крови, плазмы, сыворотки, мочи, мокроты, цереброспинальной жидкости, спинномозговой жидкости, плевральной жидкости, аспираты из сосков молочной железы, лимфатической жидкости, жидкости дыхательного тракта, ЖКТ и мочеполового тракта, слезной жидкости, слюны, грудного молока, жидкости из лимфатической системы, спермы, спинномозговой жидкости, жидкости внутриорганной системы, асцитной жидкости, жидкости опухолевой кисты, амниотической жидкости и комбинаций перечисленного.

Согласно некоторым вариантам реализации может проводиться мониторинг прогрессирования рака для идентификации изменений экспрессируемых антигенов. Соответственно, согласно некоторым вариантам реализации указанный способ также включает идентификацию по меньшей мере через один месяц после введения противораковой мРНК-вакцины по меньшей мере 2 раковых антигенов из образца от субъекта для получения второго набора раковых антигенов, и введение указанному субъекту мРНК-вакцины, содержащей открытую рамку считывания, кодирующую указанный второй набор раковых антигенов указанному субъекту. мРНК-вакцину, содержащую открытую рамку считывания, кодирующую второй набор антигенов, согласно некоторым вариантам реализации вводят указанному субъекту через 2 месяца, 3 месяца, 4 месяца, 5 месяцев, 6 месяцев, 8 месяцев, 10 месяцев или через 1 год после введения мРНК-вакцины, содержащей открытую рамку считывания, кодирующую первый набор раковых антигенов. Согласно другим вариантам реализации мРНК-вакцину, содержащую открытую рамку считывания, кодирующую второй набор антигенов, вводят указанному субъекту через 1 ½ года, 2, 2 ½, 3, 3 ½, 4, 4 ½ года или через 5 лет после введения мРНК-вакцины, содержащей открытую рамку считывания, кодирующую указанный первый набор раковых антигенов.

Мутации «горячих точек» в качестве неоантигенов

При популяционном анализе рака определенные мутации встречаются у большего процента пациентов, чем ожидаемый при случайном распределении. Показано, что указанные «рекуррентные» мутации, или мутации «горячих точек» часто играют «ведущую» роль в опухоли, вызывая определенные изменения функции раковой клетки, важные для инициации, поддержания или метастазирования опухоли, и, соответственно, проходят отбор при эволюции опухоли. Наряду с выполнением важной роли для биологии и терапии опухолей рекуррентные мутации обеспечивают возможности для прецизионной медицины, когда популяцию пациентов стратифицируют в группы на основании большей вероятности ответа на конкретную терапию, в том числе, но не ограничиваясь указанным, нацеливание на собственно мутированный белок.

Значительный объем усилий и исследований рекуррентных мутаций был сосредоточен на несинонимичных (или «миссенс») однонуклеотидных вариантах (SNV), однако популяционный анализ показал, что различные более сложные (не-SNV) варианты классификаций, например, синонимичные (или «молчащие») варианты, варианты сайтов сплайсинга, мультинуклеотидные варианты, инсерции и делеции, могут также возникать с высокой частотой.

Ген p53 (официальное обозначение TP53) чаще какого-либо другого гена мутирован при раке у человека. Исследования в больших когортах показали, что положение в геноме большинства мутаций p53 уникально для одного или лишь немногих пациентов, и указанная мутация не может быть использована в качестве рекуррентных неоантигенов для терапевтических вакцин, разрабатываемых для специфической популяции пациентов. Тем не менее, неожиданным образом, для незначительного поднабора локусов p53 все же наблюдается паттерн «горячих точек», в которых с относительно высокой частотой мутируют несколько положений в гене. Удивительным образом, значительная часть указанных рекуррентно мутирующих областей находится возле границ экзон-интрон, разрушая канонические мотивы последовательностей нуклеотидов, распознаваемые механизмами сплайсинга мРНК. Мутация мотива сплайсинга может изменять итоговую последовательность мРНК, даже в тех случаях, когда изменения локальной последовательности аминокислот не предсказаны (т.е. при синонимичных или интронных мутациях). Соответственно, указанные мутации часто аннотируют как «некодирующие» при использовании обычных инструментов для аннотирования, и при дальнейшем анализе ими пренебрегают, несмотря на то, что они могут изменять сплайсинг мРНК непредсказуемым образом и оказывать серьезное функциональное воздействие на транслируемый белок. Если альтернативно сплайсированная изоформа продуцирует изменение последовательности внутри рамки (т.е. не продуцируется PTC), она может избегать истощения, обусловленного NMD и быть легко экспрессирована, процессирована и презентирована на поверхности клеток системой HLA. Кроме того, происходящий в результате мутаций альтернативный сплайсинг обычно является «скрытым», т.е. в нормальных тканях экспрессия таких последовательностей отсутствует и, соответственно, они могут быть распознаны T-клетками как несобственные неоантигены.

Согласно некоторым аспектам настоящего изобретения предложены последовательности пептидов неоантигенов, возникающие в результате определенных рекуррентных соматических раковых мутаций в p53, не ограничивающихся миссенс-SNV и часто приводящих к альтернативному сплайсингу, для применения в качестве мишеней терапевтической вакцинации. Согласно некоторым вариантам реализации указанная мутация, события сплайсинга мРНК, итоговые неоантигенные пептиды и/или HLA-рестриктированные эпитопы включают мутации в каноническом 5’-сайте сплайсинга возле кодона p.T125, индуцирующие сохранение интрона с пептидной последовательностью TAKSVTCTVSCPEGLASMRLQCLAVSPCISFVWNFGIPLHPLASCQCFFIVYPLNV (SEQ ID NO: 232), которая содержит эпитопы AVSPCISFVW (SEQ ID NO: 233) (HLA-B*57:01, HLA-B*58:01), HPLASCQCFF (SEQ ID NO: 234) (HLA-B*35:01, HLA-B*53:01), FVWNFGIPL (SEQ ID NO: 235) (HLA-A*02:01, HLA-A*02:06, HLA-B*35:01).

Согласно некоторым вариантам реализации указанная мутация, события сплайсинга мРНК, итоговые неоантигенные пептиды и/или HLA-рестриктированные эпитопы включают мутации в каноническом 5’-сайте сплайсинга возле кодона p.331, индуцирующих сохранение интрона с пептидной последовательностью EYFTLQVLSLGTSYQVESFQSNTQNAVFFLTVLPAIGAFAIRGQ (SEQ ID NO: 236), которая содержит эпитопы LQVLSLGTSY (SEQ ID NO: 237) (HLA-B*15:01), FQSNTQNAVF (SEQ ID NO: 238) (HLA-B*15:01).

Согласно некоторым вариантам реализации указанная мутация, события сплайсинга мРНК, итоговые неоантигенные пептиды и/или HLA-рестриктированные эпитопы включают мутации в каноническом 3’-сайте сплайсинга возле кодона p.126, индуцирующие 3’-сайт скрытого альтернативного экзонного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности AKSVTCTMFCQLAK (SEQ ID NO: 239), которая содержит эпитопы CTMFCQLAK (SEQ ID NO: 240) (HLA-A*11:01), KSVTCTMF (SEQ ID NO: 241) (HLA-B*58:01).

Согласно некоторым вариантам реализации указанная мутация, события сплайсинга мРНК, итоговые неоантигенные пептиды и/или HLA-рестриктированные эпитопы включают мутации в каноническом 5’-сайте сплайсинга возле кодона p.224, индуцирующие 5’-сайт скрытого альтернативного интронного сплайсинга, обеспечивающий продуцирование новой перекрывающей пептидной последовательности VPYEPPEVWLALTVPPSTAWAA (SEQ ID NO: 242), которая содержит эпитопы VPYEPPEVW (SEQ ID NO: 243) (HLA-B*53:01, HLA-B*51:01), LTVPPSTAW (SEQ ID NO: 244) (HLA-B*58:01, HLA-B*57:01)

В приведенных выше последовательностях положения кодонов транскрипта относятся к каноническому полноразмерному транскрипту p53 ENST00000269305 (SEQ ID NO: 245) из аннотации генома человека Ensembl v83.

Мутации, как правило, определяют на основании данных секвенирования ДНК пациента с получением неоэпитопов для известных из уровня техники пептидных вакцин. Экспрессия мРНК, однако, обеспечивает более прямой способ измерений в глобальном пространстве возможных неоэпитопов. Например, некоторые опухолеспецифические неоэпитопы могут возникать при изменениях в сплайсинге, инсерциях/делециях (инделях), приводящих к сдвигам рамки, использования альтернативных промоторов или эпигенетических модификаций, которые нелегко идентифицировать с использованием только данных секвенирования экзома. Целесообразно использование нереализованного потенциала идентификации указанных типов комплексных мутаций для неоантигенных вакцин, так как они увеличивают число эпитопов, способных связывать уникальные для пациента аллотипов HLA. Кроме того, комплексные варианты будут более иммуногенными и, вероятно, будут приводить к более эффективному иммунному ответу против опухолей ввиду их отличий от собственных белков по сравнению с вариантами, получаемыми в результате замены одной аминокислоты.

Согласно некоторым аспектам настоящим изобретением охвачен способ идентификации специфических для пациента комплексных мутаций и введения указанных мутаций в эффективные персонализированные мРНК-вакцины. Указанные способы включают применение коротких ридов RNA-Seq. Основной проблемой, связанной с использованием коротких ридов для RNA-seq, является тот факт, что благодаря альтернативному сплайсингу и другим механизмам из одного и того же геномного локуса может быть получено несколько изоформ транскрипта мРНК. Так как риды секвенирования значительно короче полноразмерного мРНК-транскрипта, становится трудно установить связь между набором ридов и соответствующей корректной изоформой в известной модели аннотации генов. В результате комплексные варианты, которые отличаются от известных аннотаций генов (что распространено при раке), может быть трудно обнаружить с применением стандартных способов. Однако настоящим изобретением предусмотрена идентификация коротких пептидов, а не точного состава экзонов полноразмерного транскрипта. Способы идентификации коротких пептидов, репрезентативных для указанных комплексных мутаций, включает способ подсчета коротких k-меров для предсказания неоэпитопов комплексных вариантов.

Типичный рид, полученный методом секвенирования нового поколения, содержит 150 пар оснований, которые, при захвате кодирующей области, может давать 50 кодонов, или 41 отдельный пептидный эпитоп длиной 9 кодонов (27 нуклеотидов). Соответственно, при использовании простой, масштабируемой вычислительной операции для подсчета всех 27-меров в образце RNA-seq, результаты могут быть сравнены с нормальной тканью из того же образца, или с предварительно созданной базой данных 27-меров из RNA-seq нормальных тканей (например, GTEx).

Может быть получена мРНК-вакцина, содержащая неоэпитопы, предсказанные на основании данных RNA-seq, при условии, что 1) подсчитаны все возможные 27-меры из всех ридов RNA-seq из образца опухоли, 2) открытую рамку считывания для каждого рида предсказывают путем выравнивания каждой части полного рида на транскриптом; и 3) число подсчитанных 27-меров сравнивают с соответствующим числом подсчитанных 27-меров из совпадающего нормального образца и/или базы данных нормальных тканей из того же типа клеток; и 4) использованы данные DNA-seq для той же опухоли для повышения достоверности предсказанных неоэпитопов, если в том же гене обнаруживается соматическая мутация. Что касается пункта (4), часто мутация может вызывать изменения транскрипции или сплайсинга, приводящие к изменению последовательности мРНК, которые невозможно прямо предсказать на основании собственно мутации. Например, может быть предсказано, что мутация в сайте сплайсинга будет вызывать пропуск экзона, но невозможно точно узнать, какой расположенный ниже экзон будет подставлен на его место механизмами сплайсинга.

Согласно одному варианту реализации настоящего изобретения предложена мРНК-вакцина, содержащая конкатемерную полиэпитопную конструкцию или набор индивидуальных конструкций эпитопов, содержащих открытую рамку считывания (ORF), кодирующую неоантигенные пептиды 1-4.

Согласно одному варианту реализации настоящего изобретения предложено избирательное введение вакцины, содержащей или кодирующей пептиды 1-4, на основании содержания в опухоли пациента любой из описанных выше мутаций.

Согласно одному варианту реализации настоящего изобретения предложено избирательное введение вакцины на основании двойного критерия, включающего 1) содержание в опухоли пациента любой из описанных выше мутаций и 2) содержание соответствующего аллеля HLA, который, как предсказано, будет связываться с итоговым неоантигеном, в HLA пациента нормального типа.

Было обнаружено, что мРНК-вакцины, описанные в настоящем документе, превосходят известные к настоящему времени вакцины в нескольких отношениях. Во-первых, доставка липидных наночастиц (ЛНЧ) превосходит другие составы для доставки, в том числе способы доставки на основе липосом или протаминов, описанные в опубликованных источниках, и не требует применения дополнительных адъювантов. Применение ЛНЧ обеспечивает эффективную доставку химически модифицированных или немодифицированных мРНК-вакцин. Как модифицированные, так и немодифицированные мРНК-вакцины в составах с ЛНЧ значительно превосходят стандартные вакцины. Согласно некоторым вариантам реализации мРНК-вакцины согласно настоящему изобретению превосходят стандартные вакцины по меньшей мере в 10 раз, 20 раз, 40 раз, 50 раз, 100 раз, 500 раз или 1000 раз.

Несмотря на усилия, направленные на получение функциональных РНК-вакцин, в том числе мРНК-вакцин и самореплицирующихся РНК-вакцин, терапевтическая эффективность указанных РНК-вакцин пока не полностью определена. Достаточно неожиданным образом авторы настоящего изобретения обнаружили, в соответствии с аспектами настоящего изобретения, класс составов для доставки мРНК-вакцины in vivo , которые обеспечивают значимо усиленный и во многих отношениях синергический иммунный ответ, включающий повышенное продуцирование антигенов и функциональных антител с нейтрализующей способностью. Указанные результаты могут быть достигнуты даже при введении значимо более низких доз мРНК по сравнению с дозами мРНК, применяемыми для других классов составов на основе липидов. При применении составов согласно настоящему изобретению был продемонстрирован неожиданный значимый иммунный ответ in vivo, достаточный для обеспечения эффективности функциональных мРНК-вакцин в качестве профилактических и терапевтических агентов. Кроме того, самореплицирующиеся РНК-вакцины задействуют пути вирусной репликации для доставки в клетку достаточного количества РНК для получения иммуногенного ответа. Составы согласно настоящему изобретению не требуют вирусной репликации для получения количества белка, достаточного для выраженного иммунного ответа. Соответственно, мРНК согласно настоящему изобретению не являются самореплицирующимися РНК и не включают компонентов, которые необходимы для вирусной репликации.

Согласно некоторым аспектам настоящим изобретением охвачено неожиданное открытие, заключающееся в том, что составы с липидными наночастицами (ЛНЧ) значимо усиливают эффективность мРНК-вакцин, в том числе химически модифицированных и немодифицированных мРНК-вакцин. Эффективность мРНК-вакцин в составах с ЛНЧ изучали in vivo с применением нескольких отдельных опухолевых антигенов. Наряду с обеспечением усиленного иммунного ответа составы согласно настоящему изобретению вызывают более быстрый иммунный ответ при использовании меньших доз антигена по сравнению с другими протестированными вакцинами. Также мРНК-ЛНЧ-составы согласно настоящему изобретению обеспечивают лучший в количественном и качественном отношении иммунный ответ, чем вакцины в составах с другими носителями. Кроме того, мРНК-ЛНЧ-составы согласно настоящему изобретению превосходят другие вакцины даже при использовании дозы мРНК, более низкой, чем в других вакцинах.

ЛНЧ, применяемые для исследований, описанных в настоящем документе, ранее использовались для доставки ми-РНК в различных моделях на животных, а также у человека. Исходя из наблюдений, сделанных в связи с доставкой ми-РНК в ЛНЧ-составах, тот факт, что ЛНЧ подходит для применения в вакцинах, является достаточно неожиданным. Было отмечено, что терапевтическая доставка ми-РНК в составах с ЛНЧ вызывает нежелательный воспалительный ответ, ассоциированный с транзиентным IgM-ответом, как правило, ведущим к снижению продуцирования антигенов и нарушению иммунного ответа. В отличие от наблюдаемых для ми-РНК результатов, ЛНЧ-мРНК-составы согласно настоящему изобретению, как продемонстрировано в настоящем документе, обеспечивают повышенные уровни IgG, достаточные для реализации профилактических и терапевтических способов, а не транзиентные IgM-ответы.

Нуклеиновые кислоты/Полинуклеотиды

Противораковые вакцины, предложенные согласно настоящему изобретению, содержат по меньшей мере один (один или более) полинуклеотид рибонуклеиновой кислоты (РНК), содержащей открытую рамку считывания, кодирующую по меньшей мере один раковый антигенный полипептид. Термин «нуклеиновая кислота» в самом широком смысле включает любое соединение и/или вещество, которое содержит полимер нуклеотидов. Указанные полимеры называются полинуклеотидами.

Нуклеиновые кислоты (также называемые полинуклеотидами) может представлять собой или может включать, например, рибонуклеиновые кислоты (РНК), дезоксирибонуклеиновые кислоты (ДНК), треозные нуклеиновые кислоты (ТНК), гликолевые нуклеиновые кислоты (ГНК), пептидные нуклеиновые кислоты (ПНК), закрытые нуклеиновые кислоты (ЗНК, в том числе ЗНК в β-D-рибо-конфигурации, α- ЗНК в α-L-рибо-конфигурации (диастереоизомер ЗНК), 2′-амино-ЗНК с 2'-амино-функционализацией и 2′-амино-α-ЗНК с 2'-амино-функционализацией), этиленовые нуклеиновые кислоты (ЭНК), циклогексенильные нуклеиновые кислоты (CeNA), или их химеры или комбинации.

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему описанию функционируют в качестве матричной РНК (мРНК). «Матричная РНК» (мРНК) относится к любому полинуклеотиду, который кодирует (по меньшей мере один) полипептид (встречающийся в природе, не встречающийся в природе или модифицированный полимер аминокислот) и может быть транслирован с получением кодируемого полипептида in vitro, in vivo, in situ или ex vivo.

Основные компоненты молекулы мРНК, как правило, включают по меньшей мере одну кодирующую область, нетранслируемую 5′-область (UTR), 3′ UTR, 5′-кэп и концевой поли-A-фрагмент. Полинуклеотиды согласно настоящему описанию могут функционировать в качестве мРНК, однако их можно отличить от мРНК дикого типа по признакам функционального и/или структурного дизайна, которые служат для преодоления существующих проблем эффективной экспрессии полипептидов при применением терапевтических средств на основе нуклеиновых кислот.

Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9 или 9-10 антигенных полипептидов. Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует по меньшей мере 10, 20, 30, 40, 50, 60, 70, 80, 90 или 100 антигенных полипептидов. Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует по меньшей мере 100 или по меньшей мере 200 антигенных полипептидов. Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует 1-10, 5-15, 10-20, 15-25, 20-30, 25-35, 30-40, 35-45, 40-50, 55-65, 60-70, 65-75, 70-80, 75-85, 80-90, 85-95, 90-100, 1-50, 1-100, 2-50 или 2-100 антигенных полипептидов.

Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9 или 9-10 пептидов активирующей мутации онкогена. Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует по меньшей мере 10, 20, 30, 40, 50, 60, 70, 80, 90 или 100 пептидов активирующей мутации онкогена. Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует по меньшей мере 100 или по меньшей мере 200 пептидов активирующей мутации онкогена. Согласно некоторым вариантам реализации РНК-полинуклеотид противораковой вакцины кодирует 1-10, 5-15, 10-20, 15-25, 20-30, 25-35, 30-40, 35-45, 40-50, 55-65, 60-70, 65-75, 70-80, 75-85, 80-90, 85-95, 90-100, 1-50, 1-100, 2-50 или 2-100 пептидов активирующей мутации онкогена.

Полинуклеотиды согласно настоящему описанию согласно некоторым вариантам реализации кодон-оптимизированы. Способы оптимизации кодонов известны в данной области техники и могут применяться согласно описанию в настоящем документе. Согласно некоторым вариантам реализации для достижения совпадающей частоты встречаемости кодонов в целевых организмах и организмах хозяев может применяться оптимизация кодонов для обеспечения правильной укладки; смещения содержания GC для повышения стабильности мРНК или снижения уровня вторичных структур; минимизации кодонов тандемных повторов или гомонуклеотидных трактов, которые могут нарушать конструкцию или экспрессию генов; кастомизации областей контроля транскрипции и трансляции; инсерции или удаления последовательностей миграции белков; удаления/добавления сайтов посттрансляционной модификации в кодируемый белок (например, сайтов гликозилирования); добавления, удаления или шаффлинга доменов белков; инсерции или удаления сайтов рестрикции; модификации сайтов связывания рибосом и сайтов разложения мРНК; коррекции скоростей трансляции для обеспечения правильной укладки различных доменов белка; или для снижения или элиминации проблемных вторичных структур, входящих в состав полинуклеотида. Инструменты, алгоритмы и сервисы для оптимизации кодонов известны в данной области техники - неограничивающие примеры включают сервис от GeneArt (Life Technologies), DNA2.0 (Менло-Парк, Калифорния) и/или авторские способы. Согласно некоторым вариантам реализации последовательность открытой рамки считывания (ORF) оптимизируют с применением алгоритмов оптимизации.

Согласно некоторым вариантам реализации кодон-оптимизированная последовательность менее чем на 95% идентична встречающейся в природе последовательности или последовательности дикого типа (например, встречающейся в природе мРНК-последовательности или мРНК-последовательности дикого типа, кодирующей представляющий интерес полипептид или белок (например, антигенный белок или полипептид)). Согласно некоторым вариантам реализации кодон-оптимизированная последовательность менее чем на 90% идентична встречающейся в природе последовательности или последовательности дикого типа (например, встречающейся в природе мРНК-последовательности или мРНК-последовательности дикого типа, кодирующей представляющий интерес полипептид или белок (например, антигенный белок или полипептид)). Согласно некоторым вариантам реализации кодон-оптимизированная последовательность менее чем на 85% идентична встречающейся в природе последовательности или последовательности дикого типа (например, встречающейся в природе мРНК-последовательности или мРНК-последовательности дикого типа, кодирующей представляющий интерес полипептид или белок (например, антигенный белок или полипептид)). Согласно некоторым вариантам реализации кодон-оптимизированная последовательность менее чем на 80% идентична встречающейся в природе последовательности или последовательности дикого типа (например, встречающейся в природе мРНК-последовательности или мРНК-последовательности дикого типа, кодирующей представляющий интерес полипептид или белок (например, антигенный белок или полипептид)). Согласно некоторым вариантам реализации кодон-оптимизированная последовательность менее чем на 75% идентична встречающейся в природе последовательности или последовательности дикого типа (например, встречающейся в природе мРНК-последовательности или мРНК-последовательности дикого типа, кодирующей представляющий интерес полипептид или белок (например, антигенный белок или полипептид)).

Согласно некоторым вариантам реализации кодон-оптимизированная последовательность на 65% - 85% (например, приблизительно на 67% - 85% или приблизительно на 67% - 80%) идентична встречающейся в природе последовательности или последовательности дикого типа (например, встречающейся в природе мРНК-последовательности или мРНК-последовательности дикого типа, кодирующей представляющий интерес полипептид или белок (например, антигенный белок или полипептид)). Согласно некоторым вариантам реализации кодон-оптимизированная последовательность на 65% и 75% или приблизительно 80% идентична встречающейся в природе последовательности или последовательности дикого типа (например, встречающейся в природе мРНК-последовательности или мРНК-последовательности дикого типа, кодирующей представляющий интерес полипептид или белок (например, антигенный белок или полипептид)).

Согласно некоторым вариантам реализации кодон-оптимизированная РНК может, например, представлять собой РНК, в которой повышены уровни G/C. Содержание G/C в молекулах нуклеиновой кислоты может влиять на стабильность РНК. РНК, содержащая повышенное количество остатков гуанина (G) и/или цитозина (C), может быть функционально более стабильной, чем нуклеиновые кислоты, содержащие большое количество нуклеотидов аденина (A) и тимина (T) или урацила (U). В WO02/098443 описана фармацевтическая композиция, содержащая мРНК, стабилизированную модификациями последовательности в транслируемой области. Ввиду вырожденности генетического кода указанные модификации работают путем замены существующих кодонов на способствующие большей стабильности РНК, не изменяя итоговую аминокислоту. Указанный подход ограничен кодирующими областями РНК.

Антигены/Антигенные полипептиды

Согласно некоторым вариантам реализации раковый полипептид (например, пептид активирующей мутации онкогена) длиннее 5 аминокислот и короче 50 аминокислот. Согласно некоторым вариантам реализации раковый полипептид длиннее 25 аминокислот и короче 50 аминокислот. Соответственно, полипептиды включают генные продукты, встречающийся в природе полипептиды, синтетические полипептиды, гомологи, ортологи, паралоги, фрагменты и другие эквиваленты, варианты и аналоги вышеперечисленного. Полипептид может представлять собой одиночную молекулу или мультимолекулярный комплекс, такой как димер, тример или тетрамер. Полипептиды могут также содержать одноцепочечные или многоцепочечные полипептиды, такие как антитела или инсулин, и могут быть ассоциированы или соединены. Чаще всего в многоцепочечных полипептидах образуются дисульфидные связи. Термин «полипептид» может также относиться к полимерам аминокислот, в которых по меньшей мере один остаток аминокислоты представляет собой искусственный химический аналог соответствующей встречающейся в природе аминокислоты.

Термин «вариант полипептида» относится к молекулам, последовательность аминокислот которых отличается от природной или референсной последовательности. Варианты последовательностей аминокислот могут включать замены, делеции и/или инсерции в определенных положениях в последовательности аминокислот по сравнению с природной или референсной последовательностью. Обычно варианты по меньшей мере на 50% идентичны природной или референсной последовательности. Согласно некоторым вариантам реализации варианты по меньшей мере на 80% или по меньшей мере на 90% идентичны природной или референсной последовательности.

Согласно некоторым вариантам реализации предложены «варианты-имитаторы». В настоящем документе термин «вариант-имитатор» представляет собой вариант, который содержит по меньшей мере одну аминокислоту, имитирующую активированную последовательность. Например, глутамат может служить имитатором фосфотреонина и/или фосфосерина. Как вариант, варианты-имитаторы могут приводить к дезактивации или образованию инактивированного продукта, содержащего указанный имитатор, например, фенилаланин может функционировать в качестве инактивирующей замены тирозина; или аланин может функционировать в качестве инактивирующей замены серина.

Термин «ортологи» относится к генам разных видов, возникшим из общего предкового гена в процессе видообразования. Обычно ортологи сохраняют одну и ту же функцию в ходе эволюции. Идентификация ортологов критически важна для достоверного предсказания функций генов в новых секвенируемых геномах.

«Аналоги» включают варианты полипептидов, различающиеся одним или более изменениями аминокислот, например, заменами, добавлениями или делециями остатков аминокислот, однако сохраняющие одно или более свойств исходного или стартового полипептида.

Согласно настоящему изобретению предложены несколько типов композиций на основе полинуклеотидов или полипептидов, в том числе их варианты и производные. Указанные включают, например, варианты и производные, полученные посредством замен, инсерций, делеций и ковалентных модификаций. Термин «производное» используют в качестве синонима термина «вариант», но обычно он относится к молекуле, которая была модифицирована и/или изменена любым способом относительно референсной молекулы или стартовой молекулы.

Соответственно, полинуклеотиды, кодирующие пептиды или полипептиды, содержащие замены, инсерции и/или добавления, делеции и ковалентные модификации относительно референсных последовательностей, в частности, последовательности полипептидов согласно описанию в настоящем документе, включены в объем настоящего изобретения. Например, к последовательностям пептидов могут быть добавлены метки последовательностей или аминокислоты, такие как один или более лизинов (например, на N-конце или C-конце). Метки последовательностей могут применяться для детекции, очищения или локализации пептидов. Лизины могут применяться для увеличения растворимости пептидов или для того, чтобы обеспечить биотинилирование. Как вариант, остатки аминокислот, локализованные в карбоксиконцевых и аминоконцевых областях последовательности аминокислот пептида или белка, могут необязательно быть делетированы с получением усеченных последовательностей. Определенные аминокислоты (например, C-концевые или N-концевые остатки) могут, как вариант, быть делетированы в зависимости от применения указанной последовательности, например, экспрессии указанной последовательности в виде части большей последовательности, растворимой или соединенной с твердой подложкой.

«Варианты с заменами» в отношении полипептидов представлены вариантами, из которых удален по меньшей мере один остаток аминокислоты природной или стартовой последовательности, вместо которого инсертирована другая аминокислота в том же положении. Замены могут быть одиночными, когда заменена только одна аминокислота в молекуле, или множественными, когда заменены две или большее количество аминокислот в одной и той же молекуле.

В настоящем документе термин «консервативная замена аминокислоты» относится к замене аминокислоты, которая в норме присутствует в последовательности, другой аминокислотой, имеющей аналогичный размер, заряд или полярность. Примеры консервативных замен включают замену неполярным (гидрофобным) остатком, таким как изолейцин, валин и лейцин, другого неполярного остатка. Сходным образом, примеры консервативных замен включают замену одним полярным (гидрофильным) остатком другого, например, замену аргинин/лизин, глутамин/аспарагин и глицин/серин. Кроме того, дополнительными примерами консервативных замен являются замена основным остатком, таким как лизин, аргинин или гистидин, другого основного остатка, или замена одним кислым остатком, таким как аспарагиновая кислота или глутаминовая кислота, другого кислого остатка. Примеры неконсервативных замен включают замену неполярным (гидрофобным) остатком аминокислоты, таким как изолейцин, валин, лейцин, аланин, метионин, полярного (гидрофильного) остатка, такого как цистеин, глутамин, глутаминовая кислота или лизин, и/или замену полярным остатком неполярного остатка.

«Признаки» в отношении полипептида или полинуклеотида определены как отдельные компоненты молекулы, основанные на последовательности аминокислот или нуклеотидов, соответственно. Признаки полипептидов, кодируемых полинуклеотидами, включают поверхностные проявления, локальные конформационные формы, укладку, петли, полупетли, домены, полудомены, сайты, концевые фрагменты или любую их комбинацию.

В настоящем документе в отношении полипептиды термин «домен» относится к мотиву полипептида, имеющему одну или более идентифицируемых структурных или функциональных характеристик или свойств (например, связывающую способность, функционирование в качестве сайта белок-белковых взаимодействий).

В настоящем документе в отношении полипептидов термин «сайт» применительно к вариантам реализации на основе аминокислот используют в качестве синонима терминов «остаток аминокислоты» и «боковая цепь аминокислоты». В настоящем документе в отношении полинуклеотидов термин «сайт» применительно к вариантам реализации на основе нуклеотидов применяют в качестве синонима термина «нуклеотид». Сайт соответствует положению в пептиде или полипептиде, или в полинуклеотиде, которое может быть модифицировано, подвергнуто манипуляциям, изменено, дериватизировано или может варьировать в молекулах на основе полипептидов или полинуклеотидов.

В настоящем документе термины «концы» или «конец» в отношении полипептидов или полинуклеотидов относится к завершающей части полипептида или полинуклеотида, соответственно. Такая завершающая часть не ограничена исключительно первым или последним сайтом полипептида или полинуклеотида, и может включать дополнительные аминокислоты или нуклеотиды в концевых областях. Молекулы на основе полипептидов могут быть охарактеризованы как имеющие и N-конец (оканчивающийся аминокислотой со свободной аминогруппой (NH2)), и C-конец (оканчивающийся аминокислотой со свободной карбоксильной группой (COOH)). Белки в некоторых случаях состоят из нескольких полипептидных цепей, объединенных дисульфидными связями или нековалентными силами (мультимеры, олигомеры). Указанные белки содержат несколько N- и C-концов. Как вариант, концы полипептидов могут быть модифицированы таким образом, чтобы они начинались или заканчивались, в зависимости от обстоятельств, неполипептидным фрагментом, таким как органический конъюгат.

Как понятно специалистам в данной области техники, предполагается, что фрагменты белков, функциональные домены белков и гомологичные белки также относятся к представляющим интерес полипептидам. Например, согласно настоящему изобретению предложен любой белковый фрагмент (то есть последовательность полипептида, по меньшей мере на один остаток аминокислоты короче референсной последовательности полипептида, но в других отношениях идентичную) референсного белка длиной 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 или более 100 аминокислот. Согласно другому примеру любой белок, который включает отрезок из 10, 20, 30, 40, 50 или 100 аминокислот, который на 40%, 50%, 60%, 70%, 80%, 90%, 95% или 100% идентичен любой из последовательностей, описанных в настоящем документе, может быть использован в соответствии с настоящим изобретением. Согласно некоторым вариантам реализации полипептид включает 2, 3, 4, 5, 6, 7, 8, 9, 10 или более мутаций, представленных в любой из последовательностей, приведенных или упоминаемых в настоящем документе. Согласно другому примеру любой белок, который включает отрезок из 20, 30, 40, 50 или 100 аминокислот, более чем на 80%, 90%, 95% или 100% идентичный любой из последовательностей, описанных в настоящем документе, при этом содержащий отрезок из 5, 10, 15, 20, 25 или 30 аминокислот, менее чем на 80%, 75%, 70%, 65% или 60% идентичных любой из последовательностей, описанных в настоящем документе, может быть использован в соответствии с настоящим изобретением.

Молекулы полипептидов или полинуклеотидов согласно настоящему описанию могут отличаться определенной степенью сходства или идентичности последовательностей последовательностям референсных молекул (например, референсных полипептидов или референсных полинуклеотидов), например, известных в данной области техники молекул (например, сконструированных или разработанных молекул, или молекул дикого типа). Термин «идентичность», как известно в данной области техники, относится к взаимосвязи между последовательностями из двух или более полипептидов или полинуклеотидов, определенной путем сравнения указанных последовательностей. В данной области техники идентичность также означает степень родства их последовательностей на основании оценки числа совпадений между нитями из двух или более остатков аминокислот или остатков нуклеиновых кислот. Идентичность представляет собой процент идентичных совпадений между меньшей из двух или более последовательностей с выравниваниями с учетом пропусков (при их наличии), определяемый при помощи конкретной математической модели или компьютерной программы (например, «алгоритмов»). Идентичность родственных пептидов может быть легко вычислена известными способами. «% идентичности» в отношении последовательностей полипептидов или полинуклеотидов определен как процент остатков (остатков аминокислот или остатков нуклеиновой кислоты) в кандидатной последовательности аминокислот или нуклеиновой кислоты, идентичных остаткам в последовательности аминокислот или последовательности нуклеиновой кислоты второй последовательности после выравнивания указанных последовательностей и введения пропусков, при необходимости, для достижения максимального процента идентичности. Способы и компьютерные программы для выравнивания хорошо известны в данной области техники. Следует понимать, что идентичность зависит от расчета процента идентичности, но ее значение может отличаться из-за пропусков и штрафов, введенных в расчет. Обычно варианты конкретного полинуклеотида или полипептида по меньшей мере на 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, но менее чем на 100% идентичны последовательностям указанного конкретного полинуклеотида или полипептида по оценке с применением программ для выравнивания последовательностей и параметров, описанных в настоящем документе и известных специалистам в данной области техники. Такие инструменты для выравнивания включают программы из пакета BLAST (Stephen F. Altschul, et al (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402). Другая популярная методика локального выравнивания основана на алгоритме Смита-Уотермана (Smith, T.F. & Waterman, M.S. (1981) “Identification of common molecular subsequences.” J. Mol. Biol. 147:195-197). Методика общего глобального выравнивание, основанная на динамическом программировании, представлена алгоритмом Нидлмана-Вунша (Needleman, S.B. & Wunsch, C.D. (1970) “A general method applicable to the search for similarities in the amino acid sequences of two proteins.” J. Mol. Biol. 48:443-453). В последнее время был разработан алгоритм быстрого глобального оптимального выравнивания последовательностей («Fast Optimal Global Sequence Alignment Algorithm», FOGSAA), подразумевающий более быстрое выполнение глобального выравнивания последовательностей нуклеотидов и белков по сравнению с другими способами оптимального глобального выравнивания, в том числе алгоритмом Нидлмана-Вунша. Другие инструменты описаны в настоящем документе, в частности, представлены в определении «идентичности» ниже.

В настоящем документе термин «гомология» относится к общему сходству молекул полимеров, например, молекул нуклеиновой кислоты (например, молекул ДНК и/или молекул РНК) и/или молекул полипептидов. Молекулы полимеров (например, молекулы нуклеиновых кислот (например, молекулы ДНК и/или молекулы РНК) и/или молекулы полипептидов) с пороговым уровнем сходства или идентичности, определенным путем выравнивания совпадающих остатков, называют гомологичными. Гомология представляет собой качественный термин для описания взаимосвязи молекул, и может быть основана на количественном сходстве или идентичности. Сходство или идентичность представляет собой количественный термин, определяющий степень совпадения двух сравниваемых последовательностей. Согласно некоторым вариантам реализации молекулы полимеров считают «гомологичными» друг другу, если их последовательности по меньшей мере на 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% или 99% идентичны или сходны. Термин «гомологичный» всегда относится к сравнению по меньшей мере двух последовательностей (последовательностей полинуклеотидов или полипептидов). Две последовательности полинуклеотидов считают гомологичными, если полипептиды, которые они кодируют, по меньшей мере на 50%, 60%, 70%, 80%, 90%, 95% или даже 99% идентичны на протяжении по меньшей мере одного отрезка длиной по меньшей мере 20 аминокислот. Согласно некоторым вариантам реализации гомологичные последовательности полинуклеотидов характеризуются способностью кодировать отрезок, содержащий по меньшей мере 4-5 однозначно указанных аминокислот. Гомологию последовательностей полинуклеотидов менее чем 60 нуклеотидов длиной определяют по способности кодировать отрезок, содержащий по меньшей мере 4-5 однозначно указанных аминокислот. Две последовательности белка считают гомологичными, если указанные белки по меньшей мере на 50%, 60%, 70%, 80%, или 90% идентичны на протяжении по меньшей мере одного отрезка длиной по меньшей мере 20 аминокислот.

Гомология подразумевает, что сравниваемые последовательностей дивергировали в ходе эволюции из общего источника. Термин «гомолог» относится к первой последовательности аминокислот или последовательности нуклеиновой кислоты (например, гена (ДНК или РНК) или последовательность белка), которая связана происхождением от общей предковой последовательности с второй последовательностью аминокислот или последовательностью нуклеиновой кислоты. Термин «гомолог» может относиться к взаимосвязи между генами и/или белками, разделенными событием видообразования, или к взаимосвязи между генами и/или белками, разделенными событием генетической дупликации. «Ортологи» представляют собой гены (или белки) разных видов, возникшие из общего предкового гена (или белка) в результате видообразования. Как правило, ортологи сохраняют одну и ту же функцию в ходе эволюции. «Паралоги» представляют собой родственные гены (или белки), образовавшиеся в результате дупликации в геноме. Ортологи сохраняют одну и ту же функцию в ходе эволюции, тогда как паралоги приобретают новые функции, хотя указанные функции и могут быть связаны с исходной.

Термин «идентичность» относится к общему сходству молекул полимеров, например, молекул полинуклеотидов (например, молекул ДНК и/или молекул РНК) и/или молекул полипептидов. Расчет процента идентичности двух последовательностей полинуклеиновой кислоты, например, может быть выполнен путем выравнивания указанных двух последовательностей для оптимального сравнения (например, для целей сравнения могут быть введены пропуски в одной или обеих из указанных первой и второй последовательностях нуклеиновых кислот для оптимального выравнивания, а неидентичные последовательности могут быть проигнорированы). Согласно некоторым вариантам реализации длина последовательности, выравниваемой с целью сравнения, составляет по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 60%, по меньшей мере 70%, по меньшей мере 80%, по меньшей мере 90%, по меньшей мере 95% или 100% от длины референсной последовательности. Затем сравнивают нуклеотиды в соответствующих положениях нуклеотидов. Если некоторое положение в первой последовательности занято таким же нуклеотидом, что и соответствующее положение во второй последовательности, то молекулы в указанном положении идентичны. Процент идентичности двух последовательностей представляет собой функцию от числа идентичных положений в указанных последовательностях, с учетом числа пропусков и длины каждого пропуска, который необходимо ввести для оптимального выравнивания указанных двух последовательностей. Сравнение последовательностей и определение процента идентичности двух последовательностей может осуществляться с применением математического алгоритма. Например, процент идентичности двух последовательностей нуклеиновых кислот может быть определен с применением таких способов, как описанные в источниках: Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., и Griffin, H. G., eds., Humana Press, New Jersey, 1994; и Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; каждый из которых включен в настоящий документ посредством ссылки. Например, процент идентичности двух последовательностей нуклеиновых кислот может быть определен с использованием алгоритма Миллера-Маерса (Mayers and Miller, CABIOS, 1989, 4:11-17), который был встроен в программу ALIGN (версия 2.0), с таблицей весов замен остатков PAM120, штрафом за продление пропуска, равным 12, и штрафом за пропуск в последовательности, равным 4. Процент идентичности двух последовательностей нуклеиновых кислот может, как вариант, быть определен с использованием программы GAP из пакета программного обеспечения GCG с матрицей NWSgapdna.CMP. Широко применяемые способы определения процента идентичности последовательностей включают, не ограничиваясь указанным, описанные в источнике: Carillo, H., and Lipman, D., SIAM J Applied Math., 48:1073 (1988); включенном в настоящий документ посредством ссылки. Методики определения идентичности закодированы в общедоступных компьютерных программах. Примеры компьютерного программного обеспечения для определения гомологии двух последовательностей включают, не ограничиваясь перечисленными, программный пакет GCG, Devereux, J., et al., Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN и FASTA, Altschul, S. F. et al., J. Molec. Biol., 215, 403 (1990)).

Химические модификации

Модифицированные последовательности нуклеотидов, кодирующие антигенные полипептиды с эпитопами

РНК-вакцины (например, мРНК-вакцины) согласно настоящему описанию содержат, согласно некоторым вариантам реализации, по меньшей мере один полинуклеотид рибонуклеиновой кислоты (РНК), содержащий открытую рамку считывания, кодирующую по меньшей мере один антигенный полипептид респираторно-синцитиального вируса (RSV), причем указанная РНК содержит по меньшей мере одну химическую модификацию.

Термины «химическая модификация» и «химически модифицированный» относятся к модификации аденозиновых (A), гуанозиновых (G), уридиновых (U), тимидиновых (T) или цитидиновых (C) рибонуклеозидов или дезоксирибонуклеозидов применительно по меньшей мере к чему-либо одному из их положения, паттерна, процента или популяции. Обычно указанные термины не относятся к модификациям рибонуклеотидов во встречающихся в природе 5′-концевых кэпирующих фрагментах мРНК.

Модификации полинуклеотидов включают, без ограничения, описанные в настоящем документе, в том числе содержащие химические модификации, однако однозначным образом не ограничиваясь ими. Полинуклеотиды (например, РНК-полинуклеотиды, такие как мРНК-полинуклеотиды) могут содержать встречающиеся в природе модификации, не встречающиеся в природе модификации, или комбинацию встречающихся в природе и не встречающихся в природе модификаций. Полинуклеотиды может включать любую подходящую модификацию, например, сахара, нуклеинового основания или межнуклеозидной связи (например, соединяющего фосфата, фосфодиэфирной связи или фосфодиэфирного остова).

Применительно к полипептиду термин «модификация» относится к модификации канонического набора из 20 аминокислот. Полипептиды, предложенные согласно настоящему изобретению, также считают «модифицированными», если они содержат замены аминокислот, инсерции аминокислот или комбинацию замен и инсерций аминокислот.

Согласно некоторым вариантам реализации полинуклеотиды (например, РНК-полинуклеотиды, такие как мРНК-полинуклеотиды) содержат разнообразные модификации (более одной модификации). Согласно некоторым вариантам реализации конкретная область полинуклеотида содержит одну, две или более (необязательно разных) модификаций нуклеозидов или нуклеотидов. Согласно некоторым вариантам реализации наблюдается пониженное разложение введенного в клетку или организм модифицированного РНК-полинуклеотида (например, модифицированного мРНК-полинуклеотида) в указанной клетке или организме, соответственно, относительно немодифицированного полинуклеотида. Согласно некоторым вариантам реализации модифицированный РНК-полинуклеотид (например, модифицированный мРНК-полинуклеотид), введенный в клетку или организм, может демонстрировать пониженную иммуногенность в указанной клетке или организме, соответственно (например, пониженный врожденный ответ).

Согласно некоторым вариантам реализации полинуклеотиды (например, РНК-полинуклеотиды, такие как мРНК-полинуклеотиды) содержат не встречающиеся в природе модифицированные нуклеотиды, введенные во время синтеза или после синтеза указанных полинуклеотидов для обеспечения требуемых функций или свойств. Указанные модификации могут присутствовать в межнуклеотидных связях, пуриновых или пиримидиновых основаниях, или в сахарах. Указанная модификация может быть введена путем химического синтеза или с применением фермента полимеразы на конце цепи или где-либо еще в пределах цепи. Любая из областей полинуклеотида может быть химически модифицирована.

Согласно некоторым вариантам реализации полинуклеотид (например, РНК, например, мРНК) согласно настоящему изобретению включает химически модифицированное нуклеиновое основание. Настоящим изобретением охвачены модифицированные полинуклеотиды, содержащие полинуклеотид, описанный в настоящем документе (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую один или более полипептидов раковых эпитопов). Указанные модифицированные полинуклеотиды могут быть химически модифицированы и/или структурно модифицированы. Если полинуклеотиды согласно настоящему изобретению химически и/или структурно модифицированы, указанные полинуклеотиды могут называться «модифицированными полинуклеотидами».

Согласно настоящему изобретению предложены модифицированные нуклеозиды и нуклеотиды полинуклеотида (например, РНК-полинуклеотидов, таких как мРНК-полинуклеотиды), кодирующего один или более полипептидов раковых эпитопов. «Нуклеозид» относится к соединению, содержащему молекулу сахара (например, пентозу или рибозу) или ее производное в комбинации с органическим основанием (например, пуриновым или пиримидиновым) или его производным (также называемым в настоящем документе «нуклеиновым основанием»). «Нуклеотид» относится к нуклеозиду, включающему фосфатную группу. Модифицированные нуклеотиды могут быть синтезированы любым подходящим способом, таким как, например, химический, ферментативный или рекомбинантный, с включением одного или более модифицированных или не встречающихся в природе нуклеозидов. Полинуклеотиды могут содержать область или области соединенных нуклеозидов. Такие области могут содержать вариабельные связи в остове. Указанные связи могут быть представлены стандартными фосфодиэфирными связями, в этом случае указанные полинуклеотиды содержат области нуклеотидов.

Модифицированные полинуклеотиды согласно описанию в настоящем документе могут содержать разнообразные модификации. Согласно некоторым вариантам реализации указанный модифицированные полинуклеотиды содержат одну, две или более (необязательно разных) модификаций нуклеозидов или нуклеотидов. Согласно некоторым вариантам реализации модифицированный полинуклеотид, введенный в клетку, может демонстрировать одно или более требуемых свойств, например, улучшенную экспрессию белка, пониженную иммуногенность или пониженное разложение в указанной клетке, по сравнению с немодифицированным полинуклеотидом.

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую один или более полипептидов раковых эпитопов) структурно модифицирован. В настоящем документе «структурная» модификация представляет собой модификацию, при которой два или более соединенных нуклеозида инсертированы, делетированы, дуплицированы, инвертированы или рандомизированы в полинуклеотиде без значимой химической модификации самих нуклеотидов. Поскольку для осуществления структурной модификации химические связи в обязательном порядке разрушают и преобразуют, структурные модификации имеют химическую природу и, соответственно, представляют собой химические модификации. При этом структурные модификации приводят к образованию другой последовательности нуклеотидов. Например, полинуклеотид «ATCG» может быть химически модифицирован с получением «AT-5meC-G». Тот же полинуклеотид может быть структурно модифицирован с получением «ATCCCG» из «ATCG». В указанном случае был инсертирован динуклеотид «CC», что привело к структурной модификации полинуклеотида.

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению химически модифицированы. В настоящем документе в отношении полинуклеотида термины «химические модификация» или, в соответствующих случаях, «химически модифицированный» относятся к модификации аденозиновых (A), гуанозиновых (G), уридиновых (U) или цитидиновых (C) рибо- или дезоксирибонуклеозидов применительно к чему-либо одному или более из их положения, паттерна, процента или популяции. Обычно в настоящем документе указанные термины не относятся к модификациям рибонуклеотидов во встречающихся в природе 5′-концевых кэпирующих фрагментах мРНК.

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению могут содержать однородную химическую модификацию всех или любых нуклеозидов одного типа, или совокупность модификаций, полученных путем обычного нисходящего титрования одной и той же стартовой модификации всех или любых нуклеозидов одного типа, или измеряемый процент химической модификации всех или любых нуклеозидов одного типа, но со случайным включением, например, все уридины заменены на аналог уридина, например, псевдоуридин или 5-метоксиуридин. Согласно другому варианту реализации указанные полинуклеотиды могут содержать однородную химическую модификацию двух, трех или четырех типов нуклеозидов по всей длине полинуклеотида (например, все уридины и все цитозины, и т.п., модифицированы одинаковым образом).

Спаривание оснований модифицированных нуклеотидов предусматривает не только стандартные пары оснований аденозин-тимин, аденозин-урацил, или гуанозин-цитозин, но также и пары оснований, образуемые нуклеотидами и/или модифицированными нуклеотидами, содержащими нестандартные или модифицированные основания, где расположение доноров водородной связи и акцепторов водородной связи обеспечивает образование водородной связи между нестандартным основанием и стандартным основанием, или между двумя комплементарными основаниями с нестандартной структурой, такими как, например, в полинуклеотидах, содержащих по меньшей мере одну химическую модификацию. Одним примером такого нестандартного спаривания оснований является спаривание оснований модифицированного нуклеотида инозина и аденина, цитозина или урацила. Любая комбинация основания/сахара или линкера может быть включена в полинуклеотиды согласно настоящему описанию.

Специалисту будет понятно, что, если не указано иное, в последовательностях полинуклеотидов, представленных в настоящей заявке, указаны «T» в случае репрезентативной последовательности ДНК, но в случае последовательности, представляющей РНК, «T» будут заменены на «U».

Модификации полинуклеотидов (например, РНК-полинуклеотидов, таких как мРНК-полинуклеотиды), в том числе, но не ограничиваясь перечисленными, химические модификации, подходящие для композиций, способов и синтетических процессов согласно настоящему описанию, включают, не ограничиваясь перечисленными: однородно модифицированные нуклеотиды, нуклеозиды и нуклеиновые основания: 2-метилтио-N6-(цис-гидроксиизопентенил)аденозин; 2-метилтио-N6-метиладенозин; 2-метилтио-N6-треонилкарбамоиладенозин; N6-глицинилкарбамоиладенозин; N6-изопентениладенозин; N6-метиладенозин; N6-треонилкарбамоиладенозин; 1,2′-O-диметиладенозин; 1-метиладенозин; 2′-O-метиладенозин; 2′-O-рибозиладенозин(фосфат); 2-метиладенозин; 2-метилтио-N6 изопентениладенозин; 2-метилтио-N6-гидроксинорвалил карбамоиладенозин; 2'-O-метиладенозин; 2'-O-рибозиладенозин(фосфат); изопентениладенозин; N6-(цис-гидроксиизопентенил)аденозин; N6, 2′-O-диметиладенозин; N6,2'-O-диметиладенозин; N6, N6,2′-O-триметиладенозин; N6,N6-диметиладенозин; N6-ацетиладенозин; N6-гидроксинорвалилкарбамоиладенозин; N6-метил-N6-треонилкарбамоиладенозин; 2-метиладенозин; 2-метилтио-N6-изопентениладенозин; 7-деаза-аденозин; N1-метиладенозин; N6, N6 (диметил)аденин; N6-цис-гидрокси-изопентенил-аденозин; α-тио-аденозин; 2 (амино)аденин; 2 (аминопропил)аденин; 2 (метилтио) N6 (изопентенил)аденин; 2-(алкил)аденин; 2-(аминоалкил)аденин; 2-(аминопропил)аденин; 2-(галоген)аденин; 2-(галоген)аденин; 2-(пропил)аденин; 2'-амино-2'-дезокси-АТФ; 2'-азидо-2'-дезокси-АТФ; 2'-дезокси-2'-a-аминоаденозин-ТФ; 2'-дезокси-2'-a-азидоаденозин-ТФ; 6 (алкил)аденин; 6 (метил)аденин; 6-(алкил)аденин; 6-(метил)аденин; 7 (деаза)аденин; 8 (алкенил)аденин; 8 (алкинил)аденин; 8 (амино)аденин; 8 (тиоалкил)аденин; 8-(алкенил)аденин; 8-(алкил)аденин; 8-(алкинил)аденин; 8-(амино)аденин; 8-(галоген)аденин; 8-(гидроксил)аденин; 8-(тиоалкил)аденин; 8-(тиол)аденин; 8-азидо-аденозин; азааденин; деазааденин; N6 (метил)аденин; N6-(изопентил)аденин; 7-деаза-8-аза-аденозин; 7-метиладенин; 1-деазааденозин-ТФ; 2'фтор-N6-Bz-дезоксиаденозин-ТФ; 2'-OMe-2-амино-АТФ; 2'O-метил-N6-Bz-дезоксиаденозин-ТФ; 2'-a-этиниладенозин-ТФ; 2-аминоаденин; 2-аминоаденозин-ТФ; 2-амино-АТФ; 2'-a-трифторметиладенозин-ТФ; 2-азидоаденозин-ТФ; 2'-b-этиниладенозин-ТФ; 2-бромаденозин-ТФ; 2'-b-трифторметиладенозин-ТФ; 2-хлораденозин-ТФ; 2'-дезокси-2',2'-дифтораденозин-ТФ; 2'-дезокси-2'-a-меркаптоаденозин-ТФ; 2'-дезокси-2'-a-тиометоксиаденозин-ТФ; 2'-дезокси-2'-b-аминоаденозин-ТФ; 2'-дезокси-2'-b-азидоаденозин-ТФ; 2'-дезокси-2'-b-бромаденозин-ТФ; 2'-дезокси-2'-b-хлораденозин-ТФ; 2'-дезокси-2'-b-фтораденозин-ТФ; 2'-дезокси-2'-b-иодоаденозин-ТФ; 2'-дезокси-2'-b-меркаптоаденозин-ТФ; 2'-дезокси-2'-b-тиометоксиаденозин-ТФ; 2-фтораденозин-ТФ; 2-иодоаденозин-ТФ; 2-меркаптоаденозин-ТФ; 2-метоксиаденин; 2-метилтиоаденин; 2-трифторметиладенозин-ТФ; 3-деаза-3-бромаденозин-ТФ; 3-деаза-3-хлораденозин-ТФ; 3-деаза-3-фтораденозин-ТФ; 3-деаза-3-иодоаденозин-ТФ; 3-деазааденозин-ТФ; 4'-азидоаденозин-ТФ; 4'-карбоциклический аденозин-ТФ; 4'-этиниладенозин-ТФ; 5'-гомоаденозин-ТФ; 8-аза-АТФ; 8-бром-аденозин-ТФ; 8-трифторметиладенозин-ТФ; 9-деазааденозин-ТФ; 2-аминопурин; 7-деаза-2,6-диаминопурин; 7-деаза-8-аза-2,6-диаминопурин; 7-деаза-8-аза-2-аминопурин; 2,6-диаминопурин; 7-деаза-8-аза-аденин, 7-деаза-2-аминопурин; 2-тиоцитидин; 3-метилцитидин; 5-формилцитидин; 5-гидроксиметилцитидин; 5-метилцитидин; N4-ацетилцитидин; 2′-O-метилцитидин; 2'-O-метилцитидин; 5,2′-O-диметилцитидин; 5-формил-2′-O-метилцитидин; лизидин; N4,2′-O-диметилцитидин; N4-ацетил-2′-O-метилцитидин; N4-метилцитидин; N4, N4-диметил-2'-OMe-цитидин-ТФ; 4-метилцитидин; 5-аза-цитидин; псевдоизоцитидин; пирролоцитидин; α-тиоцитидин; 2-(тио)цитозин; 2'-амино-2'-дезокси-ЦТФ; 2'-азидо-2'-дезокси-ЦТФ; 2'-дезокси-2'-a-аминоцитидин-ТФ; 2'-дезокси-2'-a-азидоцитидин-ТФ; 3 (деаза) 5 (аза)цитозин; 3 (метил)цитозин; 3-(алкил)цитозин; 3-(деаза) 5 (аза)цитозин; 3-(метил)цитидин; 4,2'-O-диметилцитидин; 5 (галоген)цитозин; 5 (метил)цитозин; 5 (пропинил)цитозин; 5 (трифторметил)цитозин; 5-(алкил)цитозин; 5-(алкинил)цитозин; 5-(галоген)цитозин; 5-(пропинил)цитозин; 5-(трифторметил)цитозин; 5-бромцитидин; 5-иодоцитидин; 5-пропинилцитозин; 6-(азо)цитозин; 6-азацитидин; азацитозин; деазацитозин; N4 (ацетил)цитозин; 1-метил-1-деазапсевдоизоцитидин; 1-метилпсевдоизоцитидин; 2-метокси-5-метилцитидин; 2-метоксицитидин; 2-тио-5-метилцитидин; 4-метокси-1-метилпсевдоизоцитидин; 4-метоксипсевдоизоцитидин; 4-тио-1-метил-1-деазапсевдоизоцитидин; 4-тио-1-метилпсевдоизоцитидин; 4-тиопсевдоизоцитидин; 5-азазебуларин; 5-метилзебуларин; пирролопсевдоизоцитидин; зебуларин; (E)-5-(2-бромвинил)цитидин-ТФ; 2,2'-ангидроцитидин-ТФ гидрохлорид; 2'-фтор-N4-Bz-цитидин-ТФ; 2'-фтор-N4-Ацетил-цитидин-ТФ; 2'-O-метил-N4-ацетилцитидин-ТФ; 2'O-метил-N4-Bz-цитидин-ТФ; 2'-a-этинилцитидин-ТФ; 2'-a-трифторметилцитидин-ТФ; 2'-b-этинилцитидин-ТФ; 2'-b-трифторметилцитидин-ТФ; 2'-дезокси-2',2'-дифторцитидин-ТФ; 2'-дезокси-2'-a-меркаптоцитидин-ТФ; 2'-дезокси-2'-a-тиометоксицитидин-ТФ; 2'-дезокси-2'-b-аминоцитидин-ТФ; 2'-дезокси-2'-b-азидоцитидин-ТФ; 2'-дезокси-2'-b-бромцитидин-ТФ; 2'-дезокси-2'-b-хлорцитидин-ТФ; 2'-дезокси-2'-b-фторцитидин-ТФ; 2'-дезокси-2'-b-иодоцитидин-ТФ; 2'-дезокси-2'-b-меркаптоцитидин-ТФ; 2'-дезокси-2'-b-тиометоксицитидин-ТФ; 2'-O-метил-5-(1-пропинил)цитидин-ТФ; 3'-этинилцитидин-ТФ; 4'-азидоцитидин-ТФ; 4'-карбоциклический цитидин-ТФ; 4'-этинилцитидин-ТФ; 5-(1-пропинил)арацитидин-ТФ; 5-(2-хлорфенил)-2-тиоцитидин-ТФ; 5-(4-аминофенил)-2-тиоцитидин-ТФ; 5-аминоаллил-ЦТФ; 5-цианоцитидин-ТФ; 5-этиниларацитидин-ТФ; 5-этинилцитидин-ТФ; 5'-гомоцитидин-ТФ; 5-метоксицитидин-ТФ; 5-трифторметилцитидин-ТФ; N4-аминоцитидин-ТФ; N4-бензоилцитидин-ТФ; псевдоизоцитидин; 7-метилгуанозин; N2,2′-O-диметилгуанозин; N2-метилгуанозин; виозин; 1,2′-O-диметилгуанозин; 1-метилгуанозин; 2′-O-метилгуанозин; 2′-O-рибозилгуанозин (фосфат); 2'-O-метилгуанозин; 2'-O-рибозилгуанозин(фосфат); 7-аминометил-7-деазагуанозин; 7-циано-7-деазагуанозин; архаэозин; метилвиозин; N2,7-диметилгуанозин; N2,N2,2′-O-триметилгуанозин; N2,N2,7-триметилгуанозин; N2,N2-диметилгуанозин; N2,7,2'-O-триметилгуанозин; 6-тиогуанозин; 7-деазагуанозин; 8-оксогуанозин; N1-метилгуанозин; α-тиогуанозин; 2 (пропил)гуанин; 2-(алкил)гуанин; 2'-амино-2'-дезокси-ГТФ; 2'-азидо-2'-дезокси-ГТФ; 2'-дезокси-2'-a-аминогуанозин-ТФ; 2'-дезокси-2'-a-азидогуанозин-ТФ; 6 (метил)гуанин; 6-(алкил)гуанин; 6-(метил)гуанин; 6-метилгуанозин; 7 (алкил)гуанин; 7 (деаза)гуанин; 7 (метил)гуанин; 7-(алкил)гуанин; 7-(деаза)гуанин; 7-(метил)гуанин; 8 (алкил)гуанин; 8 (алкинил)гуанин; 8 (галоген)гуанин; 8 (тиоалкил)гуанин; 8-(алкенил)гуанин; 8-(алкил)гуанин; 8-(алкинил)гуанин; 8-(амино)гуанин; 8-(галоген)гуанин; 8-(гидроксил)гуанин; 8-(тиоалкил)гуанин; 8-(тиол)гуанин; азагуанин; деазагуанин; N (метил)гуанин; N-(метил)гуанин; 1-метил-6-тиогуанозин; 6-метоксигуанозин; 6-тио-7-деаза-8-азагуанозин; 6-тио-7-деазагуанозин; 6-тио-7-метилгуанозин; 7-деаза-8-азагуанозин; 7-метил-8-оксогуанозин; N2,N2-диметил-6-тиогуанозин; N2-метил-6-тиогуанозин; 1-Me-ГТФ; 2'фтор-N2-изобутилгуанозин-ТФ; 2'O-метил-N2-изобутилгуанозин-ТФ; 2'-a-этинилгуанозин-ТФ; 2'-a-трифторметилгуанозин-ТФ; 2'-b-этинилгуанозин-ТФ; 2'-b-трифторметилгуанозин-ТФ; 2'-дезокси-2',2'-дифторгуанозин-ТФ; 2'-дезокси-2'-a-меркаптогуанозин-ТФ; 2'-дезокси-2'-a-тиометоксигуанозин-ТФ; 2'-дезокси-2'-b-аминогуанозин-ТФ; 2'-дезокси-2'-b-азидогуанозин-ТФ; 2'-дезокси-2'-b-бромгуанозин-ТФ; 2'-дезокси-2'-b-хлоргуанозин-ТФ; 2'-дезокси-2'-b-фторгуанозин-ТФ; 2'-дезокси-2'-b-иодогуанозин-ТФ; 2'-дезокси-2'-b-меркаптогуанозин-ТФ; 2'-дезокси-2'-b-тиометоксигуанозин-ТФ; 4'-азидогуанозин-ТФ; 4'-карбоциклический гуанозин-ТФ; 4'-этинилгуанозин-ТФ; 5'-гомогуанозин-ТФ; 8-бромгуанозин-ТФ; 9-деазагуанозин-ТФ; N2-изобутилгуанозин-ТФ; 1-метилинозин; инозин; 1,2′-O-диметилинозин; 2′-O-метилинозин; 7-метилинозин; 2'-O-метилинозин; эпоксиквеозин; галактозилквеозин; маннозилквеозин; квеозин; аллиламинотимидин; азатимидин; деазатимидин; дезокситимидин; 2'-O-метилуридин; 2-тиоуридин; 3-метилуридин; 5-карбоксиметилуридин; 5-гидроксиуридин; 5-метилуридин; 5-тауринометил-2-тиоуридин; 5-тауринометилуридин; дигидроуридин; псевдоуридин; (3-(3-амино-3-карбоксипропил)уридин; 1-метил-3-(3-амино-5-карбоксипропил)псевдоуридин; 1-метилпсевдоуридин; 1-этилпсевдоуридин; 2′-O-метилуридин; 2'-O-метилпсевдоуридин; 2'-O-метилуридин; 2-тио-2′-O-метилуридин; 3-(3-амино-3-карбоксипропил)уридин; 3,2′-O-диметилуридин; 3-метилпсевдо-уридин-ТФ; 4-тиоуридин; 5-(карбоксигидроксиметил)уридин; сложный метиловый эфир 5-(карбоксигидроксиметил)уридина; 5,2′-O-диметилуридин; 5,6-дигидроуридин; 5-аминометил-2-тиоуридин; 5-карбамоилметил-2′-O-метилуридин; 5-карбамоилметилуридин; 5-карбоксигидроксиметилуридин; сложный метиловый эфир 5-карбоксигидроксиметилуридина; 5-карбоксиметиламинометил-2′-O-метилуридин; 5-карбоксиметиламинометил-2-тиоуридин; 5-карбоксиметиламинометил-2-тиоуридин; 5-карбоксиметиламинометилуридин; 5-карбоксиметиламинометилуридин; 5-карбамоилметилуридин-ТФ; 5-метоксикарбонилметил-2′-O-метилуридин; 5-метоксикарбонилметил-2-тиоуридин; 5-метоксикарбонилметилуридин; 5-метилуридин,), 5-метоксиуридин; 5-метил-2-тиоуридин; 5-метиламинометил-2-селеноуридин; 5-метиламинометил-2-тиоуридин; 5-метиламинометилуридин; 5-метилдигидроуридин; 5-оксиуксусная кислота-уридин-ТФ; сложный метиловый эфир 5-оксиуксусной кислоты-уридин-ТФ; N1-метилпсевдоурацил; N1-этилпсевдоурацил; уридин-5-оксиуксусную кислоту; сложный метиловый эфир уридин-5-оксиуксусной кислоты; 3-(3-амино-3-карбоксипропил)-уридин-ТФ; 5-(изо-пентениламинометил)- 2-тиоуридин-ТФ; 5-(изо-пентениламинометил)-2'-O-метилуридин-ТФ; 5-(изопентениламинометил)уридин-ТФ; 5-пропинилурацил; α-тиоуридин; 1 (аминоалкиламинокарбонилэтиленил)-2(тио)-псевдоурацил; 1 (аминоалкиламинокарбонилэтиленил)-2,4-(дитио)псевдоурацил; 1 (аминоалкиламинокарбонилэтиленил)-4 (тио)псевдоурацил; 1 (аминоалкиламинокарбонилэтиленил)-псевдоурацил; 1 (аминокарбонилэтиленил)-2(тио)-псевдоурацил; 1 (аминокарбонилэтиленил)-2,4-(дитио)псевдоурацил; 1 (аминокарбонилэтиленил)-4 (тио)псевдоурацил; 1 (аминокарбонилэтиленил)-псевдоурацил; однозамещенный 2(тио)-псевдоурацил; однозамещенный 2,4-(дитио)псевдоурацил; однозамещенный 4 (тио)псевдоурацил; однозамещенный псевдоурацил; 1-(аминоалкиламинокарбонилэтиленил)-2-(тио)-псевдоурацил; 1-метил-3-(3-амино-3-карбоксипропил)псевдоуридин-ТФ; 1-метил-3-(3-амино-3-карбоксипропил)псевдо-УТФ; 1-метилпсевдо-УТФ; 1-этилпсевдо-УТФ; 2 (тио)псевдоурацил; 2' дезоксиуридин; 2’-фторуридин; 2-(тио)урацил; 2,4-(дитио)псевдоурацил; 2' метил, 2’амино, 2'азидо, 2'-фторгуанозин; 2'-амино-2'-дезокси-УТФ; 2'-азидо-2'-дезокси-УТФ; 2'-азидо-дезоксиуридин-ТФ; 2'-O-метилпсевдоуридин; 2′ дезокси уридин; 2′-фторуридин; 2'-дезокси-2'-a-аминоуридин-ТФ; 2'-дезокси-2'-a-азидоуридин-ТФ; 2-метилпсевдоуридин; 3 (3 амино-3-карбоксипропил)урацил; 4 (тио)псевдоурацил; 4-(тио)псевдоурацил; 4-(тио)урацил; 4-тиоурацил; 5 (1,3-диазол-1-алкил)урацил; 5 (2-аминопропил)урацил; 5 (аминоалкил)урацил; 5 (диметиламиноалкил)урацил; 5 (гуанидиналкил)урацил; 5 (метоксикарбонилметил)-2-(тио)урацил; 5 (метоксикарбонил-метил)урацил; 5 (метил) 2 (тио)урацил; 5 (метил) 2,4 (дитио)урацил; 5 (метил) 4 (тио)урацил; 5 (метиламинометил)-2 (тио)урацил; 5 (метиламинометил)-2,4 (дитио)урацил; 5 (метиламинометил)-4 (тио)урацил; 5 (пропинил)урацил; 5 (трифторметил)урацил; 5-(2-аминопропил)урацил; 5-(алкил)-2-(тио)псевдоурацил; 5-(алкил)-2,4 (дитио)псевдоурацил; 5-(алкил)-4 (тио)псевдоурацил; 5-(алкил)псевдоурацил; 5-(алкил)урацил; 5-(алкинил)урацил; 5-(аллиламино)урацил; 5-(цианоалкил)урацил; 5-(диалкиламиноалкил)урацил; 5-(диметиламиноалкил)урацил; 5-(гуанидиналкил)урацил; 5-(галоген)урацил; 5-(1,3-диазол-1-алкил)урацил; 5-(метокси)урацил; 5-(метоксикарбонилметил)-2-(тио)урацил; 5-(метоксикарбонил-метил)урацил; 5-(метил) 2(тио)урацил; 5-(метил) 2,4 (дитио )урацил; 5-(метил) 4 (тио)урацил; 5-(метил)-2-(тио)псевдоурацил; 5-(метил)-2,4 (дитио)псевдоурацил; 5-(метил)-4 (тио)псевдоурацил; 5-(метил)псевдоурацил; 5-(метиламинометил)-2 (тио)урацил; 5-(метиламинометил)-2,4(дитио)урацил; 5-(метиламинометил)-4-(тио)урацил; 5-(пропинил)урацил; 5-(трифторметил)урацил; 5-аминоаллилуридин; 5-бромуридин; 5-иодоуридин; 5-урацил; 6 (азо)урацил; 6-(азо)урацил; 6-азауридин; аллиламиноурацил; азаурацил; деазаурацил; N3 (метил)урацил; псевдо-УТФ-1-2-этановую кислоту; псевдоурацил; 4-тиопсевдо-УТФ; 1-карбоксиметилпсевдоуридин; 1-метил-1-деазапсевдоуридин; 1-пропинилуридин; 1-тауринометил-1-метилуридин; 1-тауринометил4-тиоуридин; 1-тауринометилпсевдоуридин; 2-метокси-4-тиопсевдоуридин; 2-тио-1-метил-1-деазапсевдоуридин; 2-тио-1-метилпсевдоуридин; 2-тио-5-азауридин; 2-тиодигидропсевдоуридин; 2-тиодигидроуридин; 2-тиопсевдоуридин; 4-метокси-2-тиопсевдоуридин; 4-метоксипсевдоуридин; 4-тио-1-метилпсевдоуридин; 4-тиопсевдоуридин; 5-азауридин; дигидропсевдоуридин; (±)1-(2-гидроксипропил)псевдоуридин-ТФ; (2R)-1-(2-гидроксипропил)псевдоуридин-ТФ; (2S)-1-(2-гидроксипропил)псевдоуридин-ТФ; (E)-5-(2-бромвинил)арауридин-ТФ; (E)-5-(2-бромвинил)уридин-ТФ; (Z)-5-(2-бромвинил)арауридин-ТФ; (Z)-5-(2-бромвинил)уридин-ТФ; 1-(2,2,2-трифторэтил)-псевдо-УТФ; 1-(2,2,3,3,3-пентафторпропил)псевдоуридин-ТФ; 1-(2,2-диэтоксиэтил)псевдоуридин-ТФ; 1-(2,4,6-триметилбензил)псевдоуридин-ТФ; 1-(2,4,6-триметилбензил)псевдо-УТФ; 1-(2,4,6-триметилфенил)псевдо-УТФ; 1-(2-амино-2-карбоксиэтил)псевдо-УТФ; 1-(2-аминоэтил)псевдо-УТФ; 1-(2-гидроксиэтил)псевдоуридин-ТФ; 1-(2-метоксиэтил)псевдоуридин-ТФ; 1-(3,4-бис-трифторметоксибензил)псевдоуридин-ТФ; 1-(3,4-диметоксибензил)псевдоуридин-ТФ; 1-(3-амино-3-карбоксипропил)псевдо-УТФ; 1-(3-аминопропил)псевдо-УТФ; 1-(3-циклопропилпроп-2-инил)псевдоуридин-ТФ; 1-(4-амино-4-карбоксибутил)псевдо-УТФ; 1-(4-аминобензил)псевдо-УТФ; 1-(4-аминобутил)псевдо-УТФ; 1-(4-аминофенил)псевдо-УТФ; 1-(4-азидобензил)псевдоуридин-ТФ; 1-(4-бромбензил)псевдоуридин-ТФ; 1-(4-хлорбензил)псевдоуридин-ТФ; 1-(4-фторбензил)псевдоуридин-ТФ; 1-(4-иодобензил)псевдоуридин-ТФ; 1-(4-метансульфонилбензил)псевдоуридин-ТФ; 1-(4-метоксибензил)псевдоуридин-ТФ; 1-(4-метоксибензил)псевдо-УТФ; 1-(4-метокси-фенил)псевдо-УТФ; 1-(4-метилбензил)псевдоуридин-ТФ; 1-(4-метилбензил)псевдо-УТФ; 1-(4-нитробензил)псевдоуридин-ТФ; 1-(4-нитробензил)псевдо-УТФ; 1(4-нитро-фенил)псевдо-УТФ; 1-(4-тиометоксибензил)псевдоуридин-ТФ; 1-(4-трифторметоксибензил)псевдоуридин-ТФ; 1-(4-трифторметилбензил)псевдоуридин-ТФ; 1-(5-аминопентил)псевдо-УТФ; 1-(6-аминогексил)псевдо-УТФ; 1,6-диметилпсевдо-УТФ; 1-[3-(2-{2-[2-(2-аминоэтокси)-этокси]-этокси}-этокси)-пропионил]псевдоуридин-ТФ; 1-{3-[2-(2-аминоэтокси)-этокси]-пропионил} псевдоуридин-ТФ; 1-ацетилпсевдоуридин-ТФ; 1-алкил-6-(1-пропинил)-псевдо-УТФ; 1-алкил-6-(2-пропинил)-псевдо-УТФ; 1-алкил-6-аллилпсевдо-УТФ; 1-алкил-6-этинилпсевдо-УТФ; 1-алкил-6-гомоаллилпсевдо-УТФ; 1-алкил-6-винилпсевдо-УТФ; 1-аллилпсевдоуридин-ТФ; 1-аминометилпсевдо-УТФ; 1-бензоилпсевдоуридин-ТФ; 1-бензилоксиметилпсевдоуридин-ТФ; 1-бензилпсевдо-УТФ; 1-биотинил-ПЭГ2-псевдоуридин-ТФ; 1-биотинилпсевдоуридин-ТФ; 1-бутилпсевдо-УТФ; 1-цианометилпсевдоуридин-ТФ; 1-циклобутилметилпсевдо-УТФ; 1-циклобутилпсевдо-УТФ; 1-циклогептилметилпсевдо-УТФ; 1-циклогептилпсевдо-УТФ; 1-циклогексилметилпсевдо-УТФ; 1-циклогексилпсевдо-УТФ; 1-циклооктилметилпсевдо-УТФ; 1-циклооктилпсевдо-УТФ; 1-циклопентилметилпсевдо-УТФ; 1-циклопентилпсевдо-УТФ; 1-циклопропилметилпсевдо-УТФ; 1-циклопропилпсевдо-УТФ; 1-этилпсевдо-УТФ; 1-гексилпсевдо-УТФ; 1-гомоаллилпсевдоуридин-ТФ; 1-гидроксиметилпсевдоуридин-ТФ; 1-изопропилпсевдо-УТФ; 1-Me-2-тиопсевдо-УТФ; 1-Me-4-тиопсевдо-УТФ; 1-Me-альфа-тиопсевдо-УТФ; 1-метансульфонилметилпсевдоуридин-ТФ; 1-метоксиметилпсевдоуридин-ТФ; 1-метил-6-(2,2,2-трифторэтил)псевдо-УТФ; 1-метил-6-(4-морфолино)-псевдо-УТФ; 1-метил-6-(4-тиоморфолино)-псевдо-УТФ; 1-метил-6-(замещенный фенил)псевдо-УТФ; 1-метил-6-аминопсевдо-УТФ; 1-метил-6-азидопсевдо-УТФ; 1-метил-6-бромпсевдо-УТФ; 1-метил-6-бутилпсевдо-УТФ; 1-метил-6-хлорпсевдо-УТФ; 1-метил-6-цианопсевдо-УТФ; 1-метил-6-диметиламинопсевдо-УТФ; 1-метил-6-этоксипсевдо-УТФ; 1-метил-6-этилкарбоксилатпсевдо-УТФ; 1-метил-6-этилпсевдо-УТФ; 1-метил-6-фторпсевдо-УТФ; 1-метил-6-формилпсевдо-УТФ; 1-метил-6-гидроксиаминопсевдо-УТФ; 1-метил-6-гидроксипсевдо-УТФ; 1-метил-6-иодопсевдо-УТФ; 1-метил-6-изопропилпсевдо-УТФ; 1-метил-6-метоксипсевдо-УТФ; 1-метил-6-метиламинопсевдо-УТФ; 1-метил-6-фенилпсевдо-УТФ; 1-метил-6-пропилпсевдо-УТФ; 1-метил-6-трет-бутилпсевдо-УТФ; 1-метил-6-трифторметоксипсевдо-УТФ; 1-метил-6-трифторметилпсевдо-УТФ; 1-морфолинометилпсевдоуридин-ТФ; 1-пентилпсевдо-УТФ; 1-фенилпсевдо-УТФ; 1-пивалоилпсевдоуридин-ТФ; 1-пропаргилпсевдоуридин-ТФ; 1-пропилпсевдо-УТФ; 1-пропинилпсевдоуридин; 1-п-толилпсевдо-УТФ; 1-трет-бутилпсевдо-УТФ; 1-тиометоксиметилпсевдоуридин-ТФ; 1-тиоморфолинометилпсевдоуридин-ТФ; 1-трифторацетилпсевдоуридин-ТФ; 1-трифторметилпсевдо-УТФ; 1-винилпсевдоуридин-ТФ; 2,2'-ангидроуридин-ТФ; 2'-бром-дезоксиуридин ТФ; 2'-F-5-метил-2'-дезокси-УТФ; 2'-OMe-5-Me-УТФ; 2'-OMe-псевдо-УТФ; 2'-a-этинилуридин ТФ; 2'-a-трифторметилуридин-ТФ; 2'-b-этинилуридин ТФ; 2'-b-трифторметилуридин-ТФ; 2'-дезокси-2',2'-дифторуридин ТФ; 2'-дезокси-2'-a-меркаптоуридин ТФ; 2'-дезокси-2'-a-тиометоксиуридин-ТФ; 2'-дезокси-2'-b-аминоуридин ТФ; 2'-дезокси-2'-b-азидоуридин ТФ; 2'-дезокси-2'-b-бромуридин ТФ; 2'-дезокси-2'-b-хлоруридин ТФ; 2'-дезокси-2'-b-фторуридин ТФ; 2'-дезокси-2'-b-иодоуридин ТФ; 2'-дезокси-2'-b-меркаптоуридин ТФ; 2'-дезокси-2'-b-тиометоксиуридин-ТФ; 2-метокси-4-тиоуридин; 2-метоксиуридин; 2'-O-метил-5-(1-пропинил)уридин-ТФ; 3-алкилпсевдо-УТФ; 4'-азидоуридин ТФ; 4'-карбоциклический уридин-ТФ; 4'-этинилуридин ТФ; 5-(1-пропинил)арауридин-ТФ; 5-(2-фуранил)уридин-ТФ; 5-цианоуридин ТФ; 5-диметиламиноуридин ТФ; 5'-гомоуридин-ТФ; 5-иодо-2'-фтордезоксиуридин ТФ; 5-фенилэтинилуридин ТФ; 5-тридейтерометил-6-дейтероуридин ТФ; 5-трифторметилуридин-ТФ; 5-виниларауридин ТФ; 6-(2,2,2-трифторэтил)-псевдо-УТФ; 6-(4-морфолино)-псевдо-УТФ; 6-(4-тиоморфолино)-псевдо-УТФ; 6-(замещенный фенил)-псевдо-УТФ; 6-аминопсевдо-УТФ; 6-азидопсевдо-УТФ; 6-бромпсевдо-УТФ; 6-бутилпсевдо-УТФ; 6-хлорпсевдо-УТФ; 6-цианопсевдо-УТФ; 6-диметиламинопсевдо-УТФ; 6-этоксипсевдо-УТФ; 6-этилкарбоксилатпсевдо-УТФ; 6-этилпсевдо-УТФ; 6-фторпсевдо-УТФ; 6-формилпсевдо-УТФ; 6-гидроксиаминопсевдо-УТФ; 6-гидроксипсевдо-УТФ; 6-иодопсевдо-УТФ; 6-изопропилпсевдо-УТФ; 6-метоксипсевдо-УТФ; 6-метиламинопсевдо-УТФ; 6-метилпсевдо-УТФ; 6-фенилпсевдо-УТФ; 6-фенилпсевдо-УТФ; 6-пропилпсевдо-УТФ; 6-трет-бутилпсевдо-УТФ; 6-трифторметоксипсевдо-УТФ; 6-трифторметилпсевдо-УТФ; альфа-тиопсевдо-УТФ; псевдоуридин-1-(4-метилбензенсульфоновая кислота)-ТФ; псевдоуридин 1-(4-метилбензойная кислота) ТФ; псевдоуридин-ТФ 1-[3-(2-этокси)]пропионовую кислоту; псевдоуридин-ТФ 1-[3-{2-(2-[2-(2-этокси)-этокси]-этокси)-этокси}]пропионовую кислоту; псевдоуридин-ТФ 1-[3-{2-(2-[2-{2(2-этокси)-этокси}-этокси]-этокси)-этокси}]пропионовую кислоту; псевдоуридин-ТФ 1-[3-{2-(2-[2-этокси ]-этокси)-этокси}]пропионовую кислоту; псевдоуридин-ТФ 1-[3-{2-(2-этокси)-этокси}] пропионовую кислоту; псевдоуридин-ТФ 1-метилфосфоновую кислоту; псевдоуридин-ТФ-сложный диэтилэфир 1-метилфосфоновой кислоты; псевдо-УТФ-N1-3-пропионовую кислоту; псевдо-УТФ-N1-4-бутановую кислоту; псевдо-УТФ-N1-5-пентановую кислоту; псевдо-УТФ-N1-6-гексановую кислоту; псевдо-УТФ-N1-7-гептановую кислоту; псевдо-УТФ-N1-метил-п-бензойную кислоту; псевдо-УТФ-N1-п-бензойную кислоту; вибутозин; гидроксивибутозин; изовиозин; пероксивибутозин; недомодифицированный гидроксивибутозин; 4-деметилвиозин; 2,6-(диамино)пурин;1-(аза)-2-(тио)-3-(аза)-феноксазин-1-ил: 1,3-(диаза)-2-(оксо)-фенотиазин-1-ил;1,3-(диаза)-2-(оксо)-феноксазин-1-ил;1,3,5-(триаза)-2,6-(диокса)-нафталин; 2 (амино)пурин; 2,4,5-(триметил)фенил; 2' метил, 2’амино, 2'азидо, 2'фторцитидин; 2' метил, 2’амино, 2'азидо, 2'фтораденин; 2'метил, 2’амино, 2'азидо, 2'фторуридин; 2'-амино-2'-дезоксирибозу; 2-амино-6-хлорпурин; 2-азаинозинил; 2'-азидо-2'-дезоксирибозу; 2'фтор-2'-дезоксирибозу; 2'-фтормодифицированные основания; 2'-O-метилрибозу; 2-оксо-7-аминопиридопиримидин-3-ил; 2-оксо-пиридопиримидин-3-ил; 2-пиридинон; 3 нитропиррол; 3-(метил)-7-(пропинил)изокарбостирилил; 3-(метил)изокарбостирилил; 4-(фтор)-6-(метил)бензимидазол; 4-(метил)бензимидазол; 4-(метил)индолил; 4,6-(диметил)индолил; 5 нитроиндол; 5-замещенные пиримидины; 5-(метил)изокарбостирилил; 5-нитроиндол; 6-(аза)пиримидин; 6-(азо)тимин; 6-(метил)-7-(аза)индолил; 6-хлорпурин; 6-фенилпирролопиримидин-2-он-3-ил; 7-(аминоалкилгидрокси)-1-(аза)-2-(тио)-3-(аза)-фенотиазин-1-ил; 7-(аминоалкилгидрокси)-1-(аза)-2-(тио)-3-(аза)-феноксазин-1-ил; 7-(аминоалкилгидрокси)-1,3-(диаза)-2-(оксо)-феноксазин-1-ил; 7-(аминоалкилгидрокси)-1,3-(диаза)-2-(оксо)-фенотиазин-1-ил; 7-(аминоалкилгидрокси)-1,3-(диаза)-2-(оксо)-феноксазин-1-ил; 7-(аза)индолил; 7-(гуанидиналкилгидрокси)-1-(аза)-2-(тио)-3-(аза)-феноксазин-ил; 7-(гуанидиналкилгидрокси)-1-(аза)-2-(тио)-3-(аза)-фенотиазин-1-ил; 7-(гуанидиналкилгидрокси)-1-(аза)-2-(тио)-3-(аза)-феноксазин-1-ил; 7-(гуанидиналкилгидрокси)-1,3-(диаза)-2-(оксо)-феноксазин-1-ил; 7-(гуанидиналкил-гидрокси)-1,3-(диаза)-2-(оксо)-фенотиазин-1-ил; 7-(гуанидиналкилгидрокси)-1,3-(диаза)-2-(оксо)-феноксазин-1-ил; 7-(пропинил)изокарбостирилил; 7-(пропинил)изокарбостирилил, пропинил-7-(аза)индолил; 7-деаза-инозинил; 7-замещенный 1-(аза)-2-(тио)-3-(аза)-феноксазин-1-ил; 7-замещенный 1,3-(диаза)-2-(оксо)-феноксазин-1-ил; 9-(метил)-имидизопиридинил; аминоиндолил; антраценил; бис-орто-(аминоалкилгидрокси)-6-фенилпирролопиримидин-2-он-3-ил; бис-ортозамещенный-6-фенилпирролопиримидин-2-он-3-ил; дифтортолил; гипоксантин; имидизопиридинил; инозинил; изокарбостирилил; изогуанизин; N2-замещенные пурины; N6-метил-2-аминопурин; N6-замещенные пурины; N-алкилированное производное; нафталенил; нитробензимидазолил; нитроимидазолил; нитроиндазолил; нитропиразолил; небуларин; O6-замещенные пурины; O-алкилированное производное; орто-(аминоалкилгидрокси)-6-фенилпирролопиримидин-2-он-3-ил; орто-замещенный-6-фенилпирролопиримидин-2-он-3-ил; оксоформицин ТФ; пара-(аминоалкилгидрокси)-6-фенилпирролопиримидин-2-он-3-ил; пара-замещенный-6-фенилпирролопиримидин-2-он-3-ил; пентаценил; фенантраценил; фенил; пропинил-7-(аза)индолил; пиренил; пиридопиримидин-3-ил; пиридопиримидин-3-ил, 2-оксо-7-амино-пиридопиримидин-3-ил; пирролопиримидин-2-он-3-ил; пирролопиримидинил; пирролопиризинил; стилбензил; замещенные 1,2,4-триазолы; тетраценил; туберцидин; ксантин; ксантозин-5'-TP; 2-тиозебуларин; 5-аза-2-тиозебуларин; 7-деаза-2-аминопурин; пиридин-4-он рибонуклеозид; 2-аминорибозид-TP; формицин A ТФ; формицин B ТФ; пирролозин ТФ; 2'-OH-ара-аденозин-ТФ; 2'-OH-арацитидин-ТФ; 2'-OH-арауридин-ТФ; 2'-OH-арагуанозин-ТФ; 5-(2-карбометоксивинил)уридин-ТФ; и N6-(19-амино-пентаоксанонадецил)аденозин-ТФ.

Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) включает комбинацию по меньшей мере двух (например, 2, 3, 4 или более) из вышеупомянутых модифицированных нуклеиновых оснований.

Согласно некоторым вариантам реализации указанная мРНК содержит по меньшей мере один химически модифицированный нуклеозид. Согласно некоторым вариантам реализации указанный по меньшей мере один химически модифицированный нуклеозид выбран из группы, состоящей из псевдоуридина (ψ), 2-тиоуридина (s2U), 4'-тиоуридина, 5-метилцитозина, 2-тио-1-метил-1-деазапсевдоуридина, 2-тио-1-метилпсевдоуридина, 2-тио-5-азауридина, 2-тиодигидропсевдоуридина, 2-тиодигидроуридина, 2-тиопсевдоуридина, 4-метокси-2-тиопсевдоуридина, 4-метоксипсевдоуридина, 4-тио-1-метилпсевдоуридина, 4-тиопсевдоуридина, 5-азауридина, дигидропсевдоуридина, 5-метилуридина, 5-метоксиуридина, 2'-O-метилуридина, 1-метилпсевдоуридина (m1ψ), 1-этилпсевдоуридина (e1ψ), 5-метоксиуридина (mo5U), 5-метилцитидина (m5C), α-тиогуанозина, α-тиоаденозина, 5-цианоуридина, 4'-тиоуридина 7-деазааденина, 1-метиладенозина (m1A), 2-метиладенина (m2A), N6-метиладенозина (m6A) и 2,6-диаминопурина, (I), 1-метилинозина (m1I), виозина (imG), метилвиозина (mimG), 7-деазагуанозина, 7-циано-7-деазагуанозина (preQ0), 7-аминометил-7-деазагуанозина (preQ1), 7-метилгуанозина (m7G), 1-метилгуанозина (m1G), 8-оксогуанозина, 7-метил-8-оксогуанозина, 2,8-диметиладенозина, 2-геранилтиоуридина, 2-лизидина, 2-селеноуридина, 3-(3-амино-3-карбоксипропил)-5,6-дигидроуридина, 3-(3-амино-3-карбоксипропил)псевдоуридина, 3-метилпсевдоуридина, сложного метилового эфира 5-(карбоксигидроксиметил)-2′-O-метилуридина, 5-аминометил-2-геранилтиоуридина, 5-аминометил-2-селеноуридина, 5-аминометилуридина, 5-карбамоилгидроксиметилуридина, 5-карбамоилметил-2-тиоуридина, 5-карбоксиметил-2-тиоуридина, 5-карбоксиметиламинометил-2-геранилтиоуридина, 5-карбоксиметиламинометил-2-селеноуридина, 5-цианометилуридина, 5-гидроксицитидина, 5-метиламинометил-2-геранилтиоуридина, 7-аминокарбоксипропилдеметилвиозина, 7-аминокарбоксипропилвиозина, сложного метилового эфира 7-аминокарбоксипропилвиозина, 8-метиладенозина, N4, N4-диметилцитидина, N6-формиладенозина, N6-гидроксиметиладенозина, агматидина, циклического N6-треонилкарбамоиладенозина, глутамилквеозина, метилированного недомодифицированного гидроксивибутозина, N4,N4,2′-O-триметилцитидина, геранилированного 5-метиламинометил-2-тиоуридина, геранилированного 5-карбоксиметиламинометил-2-тиоуридина, Q-основания, пре-Q0-основания, пре-Q1-основания; и двух или более их комбинаций. Согласно некоторым вариантам реализации указанный по меньшей мере один химически модифицированный нуклеозид выбран из группы, состоящей из псевдоуридина, 1-метилпсевдоуридина, 1-этилпсевдоуридина, 5-метилцитозина, 5-метоксиуридина и их комбинации. Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) включает комбинацию по меньшей мере двух (например, 2, 3, 4 или более) из вышеупомянутых модифицированных нуклеиновых оснований.

Согласно некоторым вариантам реализации указанная мРНК представляет собой урацил-модифицированную последовательность, содержащую ORF, кодирующую один или более полипептидов раковых эпитопов, причем указанная мРНК содержит химически модифицированное нуклеиновое основание, например, 5-метоксиурацил. Согласно определенным аспектам настоящего изобретения, если 5-метоксиурациловое основание присоединяется к сахару рибозе, как в полинуклеотидах, итоговый модифицированный нуклеозид или нуклеотид называют 5-метоксиуридином. Согласно некоторым вариантам реализации урацил в полинуклеотиде по меньшей мере приблизительно на 25%, по меньшей мере приблизительно на 30%, по меньшей мере приблизительно на 40%, по меньшей мере приблизительно на 50%, по меньшей мере приблизительно на 60%, по меньшей мере приблизительно на 70%, по меньшей мере приблизительно на 80%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 99%, или приблизительно на 100% представлен 5-метоксиурацилом. Согласно одному варианту реализации урацил в полинуклеотиде по меньшей мере на 95% представлен 5- метоксиурацилом. Согласно другому варианту реализации урацил в полинуклеотиде на 100% представлен 5-метоксиурацилом.

Согласно вариантам реализации, где урацил в полинуклеотиде по меньшей мере на 95% представлен 5-метоксиурацилом, общее содержание урацила может быть скорректировано так, чтобы мРНК обеспечивала подходящие уровни экспрессии белка, при этом незначительно индуцируя или не индуцируя иммунный ответ. Согласно некоторым вариантам реализации содержание урацила в ORF составляет от приблизительно 105% до приблизительно 145%, от приблизительно 105% до приблизительно 140%, от приблизительно 110% до приблизительно 140%, от приблизительно 110% до приблизительно 145%, от приблизительно 115% до приблизительно 135%, от приблизительно 105% до приблизительно 135%, от приблизительно 110% до приблизительно 135%, от приблизительно 115% до приблизительно 145%; или от приблизительно 115% до приблизительно 140% от теоретического минимального содержания урацила в соответствующей ORF дикого типа (%Utm). Согласно другим вариантам реализации содержание урацила в ORF составляет от приблизительно 117% до приблизительно 134%, или от 118% до 132% от %UTM. Согласно некоторым вариантам реализации содержание урацила в ORF, кодирующей один или более полипептидов раковых эпитопов, составляет приблизительно 115%, приблизительно 120%, приблизительно 125%, приблизительно 130%, приблизительно 135%, приблизительно 140%, приблизительно 145% или приблизительно 150% от %Utm. В данном контексте термин «урацил» может относиться к 5-метоксиурацилу и/или встречающемуся в природе урацилу.

Согласно некоторым вариантам реализации содержание урацила в ORF мРНК, кодирующей один или более полипептидов раковых эпитопов согласно настоящему изобретению, составляет менее чем приблизительно 50%, приблизительно 40%, приблизительно 30%, приблизительно 20%, приблизительно 15% или приблизительно 12% от общего содержания нуклеиновых оснований в указанной ORF. Согласно некоторым вариантам реализации содержание урацила в ORF составляет от приблизительно 12% до приблизительно 25% от общего содержания нуклеиновых оснований в указанной ORF. Согласно другим вариантам реализации содержание урацила в ORF составляет от приблизительно 15% до приблизительно 17% от общего содержания нуклеиновых оснований в указанной ORF. Согласно одному варианту реализации содержание урацила в ORF мРНК, кодирующей один или более полипептидов раковых эпитопов, составляет менее чем приблизительно 20% от общего содержания нуклеиновых оснований в указанной открытой рамке считывания. В данном контексте термин «урацил» может относиться к 5-метоксиурацилу и/или встречающемуся в природе урацилу.

Согласно дополнительным вариантам реализации ORF мРНК, кодирующей один или более полипептидов раковых эпитопов согласно настоящему изобретению, включает 5-метоксиурацил и содержание урацила в ней скорректировано так, что она содержит меньше пар урацила (UU), и/или триплетов урацила (UUU), и/или квадруплетов урацила (UUUU), чем соответствующая последовательность нуклеотидов дикого типа, кодирующая указанные один или более полипептидов раковых эпитопов. Согласно некоторым вариантам реализации ORF мРНК, кодирующей один или более полипептидов раковых эпитопов согласно настоящему изобретению, не содержит пар урацила, и/или триплетов урацила, и/или квадруплетов урацила. Согласно некоторым вариантам реализации число пар урацила, и/или триплетов урацила, и/или квадруплетов урацила опускается ниже определенного порога, например, не более чем 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 или 20 случаев встречаемости в ORF мРНК, кодирующей один или более полипептидов раковых эпитопов. Согласно конкретному варианту реализации ORF мРНК, кодирующей один или более полипептидов раковых эпитопов согласно настоящему изобретению, содержит менее чем 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 нефенилаланиновых пар и/или триплетов урацила. Согласно другому варианту реализации ORF мРНК, кодирующей один или более полипептидов раковых эпитопов, не содержит нефенилаланиновых пар и/или триплетов урацила.

Согласно дополнительным вариантам реализации ORF мРНК, кодирующей один или более полипептидов раковых эпитопов согласно настоящему изобретению, включает 5-метоксиурацил, и содержание урацила в ней скорректировано скорректировано так, что она содержит меньше богатых урацилом кластеров, чем соответствующая последовательность нуклеотидов дикого типа, кодирующая указанные один или более полипептидов раковых эпитопов. Согласно некоторым вариантам реализации ORF мРНК, кодирующей один или более полипептидов раковых эпитопов согласно настоящему изобретению, содержит богатые урацилом кластеры, более короткие, чем соответствующие богатые урацилом кластеры в соответствующий последовательности нуклеотидов дикого типа, кодирующей указанные один или более полипептидов раковых эпитопов.

Согласно дополнительным вариантам реализации используют альтернативные кодоны, характеризующиеся меньшей частотой встречаемости. По меньшей мере приблизительно 5%, по меньшей мере приблизительно 10%, по меньшей мере приблизительно 15%, по меньшей мере приблизительно 20%, по меньшей мере приблизительно 25%, по меньшей мере приблизительно 30%, по меньшей мере приблизительно 35%, по меньшей мере приблизительно 40%, по меньшей мере приблизительно 45%, по меньшей мере приблизительно 50%, по меньшей мере приблизительно 55%, по меньшей мере приблизительно 60%, по меньшей мере приблизительно 65%, по меньшей мере приблизительно 70%, по меньшей мере приблизительно 75%, по меньшей мере приблизительно 80%, по меньшей мере приблизительно 85%, по меньшей мере приблизительно 90%, по меньшей мере приблизительно 95%, по меньшей мере приблизительно 99% или 100% кодонов в кодирующей один или более полипептидов раковых эпитопов ORF содержащей 5-метоксиурацил мРНК заменены на альтернативные кодоны, при этом частота встречаемости каждого альтернативного кодона ниже частоты встречаемости замененного кодона в синонимичном наборе кодонов. Также в указанной ORF скорректировано содержание урацила согласно описанию выше. Согласно некоторым вариантам реализации по меньшей мере один кодон в ORF мРНК, кодирующей один или более полипептидов раковых эпитопов, заменен на альтернативный кодон, характеризующийся меньшей частотой встречаемости, чем частота встречаемости замененного кодона в синонимичном наборе кодонов.

Согласно некоторым вариантам реализации при введении в клетку млекопитающего ORF из содержащей 5-метоксиурацил мРНК, со скорректированным содержанием урацила, кодирующей один или более полипептидов раковых эпитопов, наблюдаются уровни экспрессии указанного одного или более полипептидов раковых эпитопов, более высокие по сравнению с уровнями экспрессии одного или более полипептидов раковых эпитопов с соответствующей мРНК дикого типа. Согласно другим вариантам реализации уровни экспрессии одного или более полипептидов раковых эпитопов при введении в клетку млекопитающего повышаются относительно уровней экспрессии с соответствующей мРНК, содержащей по меньшей мере 95% 5-метоксиурацила, содержание урацила в которой составляет приблизительно 160%, приблизительно 170%, приблизительно 180%, приблизительно 190% или приблизительно 200% от теоретического минимума. Согласно другим дополнительным вариантам реализации уровни экспрессии одного или более полипептидов раковых эпитопов при введении в клетку млекопитающего повышаются относительно уровней экспрессии с соответствующей мРНК, в которой по меньшей мере приблизительно 50%, по меньшей мере приблизительно 60%, по меньшей мере приблизительно 70%, по меньшей мере приблизительно 80%, по меньшей мере приблизительно 90% или приблизительно 100% остатков урацила представлены 1-метилпсевдоурацилом или псевдоурацилом. Согласно некоторым вариантам реализации клетка млекопитающего представляет собой клетку мыши, клетку крысы или клетку кролика. Согласно другим вариантам реализации клетка млекопитающего представляет собой клетку обезьяны или клетку человека. Согласно некоторым вариантам реализации указанная клетка человека представляет собой клетку HeLa, фибробластную клетку BJ или мононуклеарную клетку периферической крови (МКПК). Согласно некоторым вариантам реализации один или более полипептидов раковых эпитопов экспрессируется при введении мРНК в клетку млекопитающего in vivo. Согласно некоторым вариантам реализации указанную мРНК вводят мышам, кроликам, крысам, обезьянам или человеку. Согласно одному варианту реализации мыши представляют собой мышей с выключенными генами. Согласно некоторым вариантам реализации указанную мРНК вводят мышам в количестве, составляющем приблизительно 0,01 мг/кг, приблизительно 0,05 мг/кг, приблизительно 0,1 мг/кг, или приблизительно 0,15 мг/кг. Согласно некоторым вариантам реализации указанную мРНК вводят внутривенно или внутримышечно. Согласно другим вариантам реализации указанный один или более полипептидов раковых эпитопов экспрессируется при введении мРНК в клетку млекопитающего in vitro. Согласно некоторым вариантам реализации экспрессия увеличивается по меньшей мере приблизительно 2-кратно, по меньшей мере приблизительно 5-кратно, по меньшей мере приблизительно 10-кратно, по меньшей мере приблизительно 50-кратно, по меньшей мере приблизительно 500-кратно, по меньшей мере приблизительно 1500-кратно или по меньшей мере приблизительно 3000-кратно. Согласно другим вариантам реализации экспрессия увеличивается по меньшей мере приблизительно на 10%, приблизительно на 20%, приблизительно на 30%, приблизительно на 40%, приблизительно на 50%, 60%, приблизительно на 70%, приблизительно на 80%, приблизительно на 90% или приблизительно на 100%.

Согласно некоторым вариантам реализации наблюдается повышенная стабильность кодирующей один или более полипептидов раковых эпитопов ORF со скорректированным содержанием урацила из содержащей 5-метоксиурацил мРНК. Согласно некоторым вариантам реализации наблюдается повышенная стабильность указанной мРНК в клетке относительно стабильности соответствующей мРНК дикого типа в таких же условиях. Согласно некоторым вариантам реализации наблюдается повышенная стабильность указанной мРНК, в том числе устойчивость к нуклеазам, термическая стабильность и/или повышенная стабилизация вторичной структуры. Согласно некоторым вариантам реализации наблюдаемую повышенную стабильность мРНК измеряют путем определения времени полужизни мРНК (например, в образце плазмы, клеток или ткани) и/или определения площади под кривой (AUC) для экспрессии белка с указанной мРНК на протяжении периода времени (например, in vitro или in vivo). мРНК идентифицируют как имеющую повышенную стабильность, если время полужизни и/или AUC превышает время полужизни и/или AUC для соответствующей мРНК дикого типа в таких же условиях.

Согласно некоторым вариантам реализации мРНК согласно настоящему изобретению индуцирует детектируемо меньший иммунный ответ (например, врожденный или приобретенный) по сравнению с иммунным ответом, индуцируемым соответствующей мРНК дикого типа в таких же условиях. Согласно другим вариантам реализации указанный мРНК согласно настоящему описанию индуцирует детектируемо меньший иммунный ответ (например, врожденный или приобретенный) по сравнению с иммунным ответом, индуцируемым мРНК, которая кодирует один или более полипептидов раковых эпитопов, но не содержит 5-метоксиурацил, в таких же условиях, или по сравнению с иммунным ответом, индуцируемым мРНК, которая кодирует один или более полипептидов раковых эпитопов и который содержит 5-метоксиурацил, но без скорректированного содержания урацила, в таких же условиях. Врожденный иммунный ответ может проявляться в виде повышенной экспрессии провоспалительных цитокинов, активации внутриклеточных рецепторов распознавания паттернов (PRR) (RIG-I, MDA5 и т.п.), клеточной смерти и/или терминации или снижения трансляции белков. Согласно некоторым вариантам реализации снижение врожденного иммунного ответа может быть измерено по уровню экспрессии или активность интерферонов типа 1 (например, ИФН-α, ИФН-β, ИФН-κ, ИФН-δ, ИФН-ε, ИФН-τ, ИФН-ω и ИФН-ζ) или экспрессии регулируемых интерферонами генов, таких как Toll-подобные рецепторы (например, TLR7 и TLR8), и/или по уменьшению клеточной смерти после одного или более введений мРНК согласно настоящему изобретению в клетку.

Согласно некоторым вариантам реализации экспрессия интерферонов типа 1 клеткой млекопитающего в ответ на мРНК согласно настоящему описанию снижена по меньшей мере на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99,9% или более 99,9% относительно экспрессии с соответствующей мРНК дикого типа, относительно экспрессии с мРНК, которая кодирует один или более полипептидов раковых эпитопов, но не содержит 5-метоксиурацила, или с мРНК, которая кодирует один или более полипептидов раковых эпитопов и содержит 5-метоксиурацил, но без скорректированного содержания урацила. Согласно некоторым вариантам реализации указанный интерферон представляет собой ИФН-β. Согласно некоторым вариантам реализации частота клеточной смерти, вызываемой введением мРНК согласно настоящему описанию в клетку млекопитающего, на 10%, 25%, 50%, 75%, 85%, 90%, 95% или более чем на 95% ниже частоты клеточной смерти, наблюдаемой при введении соответствующей мРНК дикого типа, мРНК, которая кодирует один или более полипептидов раковых эпитопов, но не содержит 5-метоксиурацила, или мРНК, которая кодирует один или более полипептидов раковых эпитопов и содержит 5-метоксиурацил, но без скорректированного содержания урацила. Согласно некоторым вариантам реализации указанная клетка млекопитающего представляет собой фибробласт BJ. Согласно другим вариантам реализации указанная клетка млекопитающего представляет собой спленоцит. Согласно некоторым вариантам реализации указанная клетка млекопитающего представляет собой клетку мыши или крысы. Согласно другим вариантам реализации указанная клетка млекопитающего представляет собой клетку человека. Согласно одному варианту реализации мРНК согласно настоящему описанию по существу не индуцирует врожденный иммунный ответ в клетке млекопитающего, в которую вводят указанную мРНК.

Согласно некоторым вариантам реализации указанный полинуклеотид представляет собой мРНК, которая содержит ORF, которая кодирует один или более полипептидов раковых эпитопов, при этом в указанной мРНК по меньшей мере приблизительно 95% урацила представлено 5-метоксиурацилом, причем содержание урацила в указанной ORF составляет от приблизительно 115% до приблизительно 135% от теоретического минимального содержания урацила в соответствующей ORF дикого типа, и содержание урацила в ORF, кодирующей один или более полипептидов раковых эпитопов, составляет менее чем приблизительно 23% от общего содержания нуклеиновых оснований в указанной ORF. Согласно некоторым вариантам реализации ORF, которая кодирует один или более полипептидов раковых эпитопов, дополнительно модифицирована для снижения содержания G/C в указанной ORF (абсолютного или относительного) по меньшей мере приблизительно на 40% по сравнению с соответствующей ORF дикого типа. Согласно другим дополнительным вариантам реализации ORF, кодирующая один или более полипептидов раковых эпитопов, содержит менее 20 нефенилаланиновых пар и/или триплетов урацила. Согласно некоторым вариантам реализации по меньшей мере один кодон в ORF мРНК, кодирующей один или более полипептидов раковых эпитопов, дополнительно заменяют на альтернативный кодон, характеризующийся меньшей частотой использования по сравнению с частотой использования заменяемого кодона в синонимичном наборе кодонов. Согласно некоторым вариантам реализации экспрессия одного или более полипептидов раковых эпитопов, кодируемых мРНК, содержащей ORF, отличающейся тем, что в указанной мРНК по меньшей мере приблизительно 95% урацила представлено 5-метоксиурацилом, и тем, что содержание урацила в ORF составляет от приблизительно 115% до приблизительно 135% от теоретического минимального содержания урацила в соответствующей ORF дикого типа, повышается по меньшей мере приблизительно 10-кратно по сравнению с экспрессией одного или более полипептидов раковых эпитопов с соответствующей мРНК дикого типа. Согласно некоторым вариантам реализации указанная мРНК содержит открытую ORF, отличающуюся тем, что по меньшей мере приблизительно 95% урацила в мРНК представлено 5-метоксиурацилом, тем, что содержание урацила в указанной ORF составляет от приблизительно 115% до приблизительно 135% от теоретического минимального содержания урацила в соответствующей ORF дикого типа, и тем, что указанная мРНК по существу не индуцирует врожденного иммунного ответа в клетке млекопитающего, в которую вводят указанную мРНК.

Согласно некоторым вариантам реализации указанная химическая модификация относится к нуклеиновым основаниям в полинуклеотидах (например, в РНК-полинуклеотиде, таком как мРНК-полинуклеотид). Согласно некоторым вариантам реализации модифицированные нуклеиновые основания в полинуклеотиде (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) выбраны из группы, состоящей из 1-метилпсевдоуридина (m1ψ), 1-этилпсевдоуридина (e1ψ), 5-метоксиуридина (mo5U), 5-метилцитидина (m5C), псевдоуридина (ψ), α-тиогуанозина и α-тиоаденозина. Согласно некоторым вариантам реализации указанный полинуклеотид включает комбинацию по меньшей мере двух (например, 2, 3, 4 или более) из вышеупомянутых модифицированных нуклеиновых оснований.

Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит псевдоуридин (ψ) и 5-метилцитидин (m5C). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 1-метилпсевдоуридин (m1ψ). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 1-этилпсевдоуридин (e1ψ). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 1-метилпсевдоуридин (m1ψ) и 5-метилцитидин (m5C). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 1-этилпсевдоуридин (e1ψ) и 5-метилцитидин (m5C). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 2-тиоуридин (s2U). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 2-тиоуридин и 5-метилцитидин (m5C). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит метоксиуридин (mo5U). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 5-метоксиуридин (mo5U) и 5-метилцитидин (m5C). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 2'-O-метилуридин. Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 2'-O-метилуридин и 5-метилцитидин (m5C). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит N6-метиладенозин (m6A). Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит N6-метиладенозин (m6A) и 5-метилцитидин (m5C).

Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) однородно модифицирован (например, полностью модифицирован, модифицирован по всей длине последовательности) применительно к конкретной модификации. Например, полинуклеотид может быть однородно модифицирован 5-метилцитидином (m5C), что означает, что все остатки цитозина в указанной последовательности мРНК заменены на 5-метилцитидин (m5C). В другом примере полинуклеотид может быть однородно модифицирован 1-метилпсевдоуридином, что означает, что все остатки уридина в указанной последовательности мРНК заменены на 1-метилпсевдоуридин. Аналогичным образом, полинуклеотид может быть однородно модифицирован применительно к любому типу нуклеозидных остатков, присутствующих в указанной последовательности, путем замены на модифицированный остаток, такой как любые из представленных выше.

Согласно некоторым вариантам реализации химически модифицированные нуклеозиды в открытой рамке считывания выбраны из группы, состоящей из уридина, аденина, цитозина, гуанина и любой их комбинации.

Согласно некоторым вариантам реализации модифицированное нуклеиновое основание представляет собой модифицированный цитозин. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный цитозин, включают N4-ацетилцитидин (ac4C), 5-метилцитидин (m5C), 5-галогенцитидин (например, 5-иодо-цитидин), 5-гидроксиметилцитидин (hm5C), 1-метилпсевдоизоцитидин, 2-тиоцитидин (s2C) и 2-тио-5-метилцитидин.

Согласно некоторым вариантам реализации модифицированное нуклеиновое основание представляет собой модифицированный уридин. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный уридин, включают 1-метилпсевдоуридин (m1ψ), 1-этилпсевдоуридин (e1ψ), 5-метоксиуридин, 2-тиоуридин, 5-цианоуридин, 2’-O-метилуридин и 4'-тиоуридин.

Согласно некоторым вариантам реализации модифицированное нуклеиновое основание представляет собой модифицированный аденин. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный аденин включают 7-деаза-аденин, 1-метиладенозин (m1A), 2-метиладенин (m2A), N6-метиладенозин (m6A) и 2,6-диаминопурин.

Согласно некоторым вариантам реализации модифицированное нуклеиновое основание представляет собой модифицированный гуанин. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный гуанин, включают инозин (I), 1-метилинозин (m1I), виозин (imG), метилвиозин (mimG), 7-деазагуанозин, 7-циано-7-деазагуанозин (preQ0), 7-аминометил-7-деазагуанозин (preQ1), 7-метилгуанозин (m7G), 1-метилгуанозин (m1G), 8-оксогуанозин, 7-метил-8-оксогуанозин.

Согласно некоторым вариантам реализации модифицированные нуклеиновые основания в полинуклеотиде (например, РНК-полинуклеотиде, таком как мРНК-полинуклеотид) представлены 5-метоксиуридином.

Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) включает комбинацию по меньшей мере двух (например, 2, 3, 4 или более) модифицированных нуклеиновых оснований.

Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) содержит 5-метоксиуридин (5mo5U) и 5-метилцитидин (m5C).

Согласно некоторым вариантам реализации указанный полинуклеотид (например, РНК-полинуклеотид, такой как мРНК-полинуклеотид) однородно модифицирован (например, полностью модифицирован, модифицирован вдоль всей последовательности) применительно к конкретной модификации. Например, полинуклеотид может быть однородно модифицирован 5-метоксиуридином, что означает, что по существу все остатки уридина в указанной последовательности мРНК заменены на 5-метоксиуридин. Аналогичным образом, полинуклеотид может быть однородно модифицирован применительно к любому типу нуклеозидного остатка, присутствующего в указанной последовательности, путем замены на модифицированный остаток, такой как любой из представленных выше.

Согласно некоторым вариантам реализации указанное модифицированное нуклеиновое основание представляет собой модифицированный цитозин.

Согласно некоторым вариантам реализации модифицированное нуклеиновое основание представляет собой модифицированный урацил. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный урацил, включают 5-метоксиурацил.

Согласно некоторым вариантам реализации модифицированное нуклеиновое основание представляет собой модифицированный аденин.

Согласно некоторым вариантам реализации модифицированное нуклеиновое основание представляет собой модифицированный гуанин.

Согласно некоторым вариантам реализации указанные полинуклеотиды могут включать любой подходящий линкер между нуклеозидами. Такие линкеры, в том числе модификации остова, подходящие для применения в композиции согласно настоящему описанию, включают, не ограничиваясь перечисленными, следующие: 3'-алкиленфосфонаты, 3'-аминофосфорамидат, алкен-содержащие остовы, аминоалкилфосфорамидаты, сложные аминоалкилфосфотриэфиры, боранофосфаты, -CH2-O-N(CH3)-CH2-, -CH2-N(CH3)-N(CH3)-CH2-, -CH2-NH-CH2-, хиральные фосфонаты, хиральный фосфотиоаты, формацетильные и тиоформацетильные остовы, метиленовые (метилимино), метиленформацетильные и тиоформацетильные остовы, метилениминовые и метиленгидразиновые остовы, морфолиновые связи, -N(CH3)-CH2-CH2-, олигонуклеозиды с гетероатомными межнуклеозидными связями, фосфинаты, фосфорамидаты, фосфородитиоаты, фосфотиоатные межнуклеозидные связи, фосфотиоаты, сложные фосфотриэфиры, пептид-нуклеиновая кислота (PNA), силоксановые остовы, сульфаматные остовы, сульфидные, сульфоксидные и сульфоновые остовы, сульфонатные и сульфонамидные остовы, тионоалкилфосфонаты, сложные тионоалкилфосфотриэфиры и тионофосфорамидаты.

Модифицированные нуклеозиды и нуклеотиды (например, молекулы - «строительные блоки»), которые могут быть включены в полинуклеотид (например, РНК или мРНК согласно описанию в настоящем документе), могут быть модифицированы по сахару рибонуклеиновой кислоты. Например, 2′ гидроксильная группа (OH) может быть модифицирована или заменена на ряд других заместителей. Примеры замен по 2′-положению включают, не ограничиваясь перечисленными, H, галоген, необязательно замещенный C1-6 алкил; необязательно замещенный C1-6 алкокси; необязательно замещенный C6-10 арилокси; необязательно замещенный C3-8 циклоалкил; необязательно замещенный C3-8 циклоалкокси; необязательно замещенный C6-10 арилокси; необязательно замещенный C6-10 арил-C1-6 алкокси, необязательно замещенный C1-12 (гетероциклил)окси; сахар (например, рибозу, пентозу или любой сахар, описанный в настоящем документе); полиэтиленгликоль (ПЭГ), -O(CH2CH2O)nCH2CH2OR, где R представляет собой H или необязательно замещенный алкил, и n представляет собой целое число от 0 до 20 (например, от 0 до 4, от 0 до 8, от 0 до 10, от 0 до 16, от 1 до 4, от 1 до 8, от 1 до 10, от 1 до 16, от 1 до 20, от 2 до 4, от 2 до 8, от 2 до 10, от 2 до 16, от 2 до 20, от 4 до 8, от 4 до 10, от 4 до 16; и от 4 до 20); «закрытые» нуклеиновые кислоты (LNA), где 2′-гидроксил соединен C1-6 алкиленовым или C1-6 гетероалкиленовым мостиком с 4'-углеродом того же сахара рибозы, при этом примеры мостиков включают метиленовые, пропиленовые, простые эфирные или аминогруппы; аминоалкил согласно определению в настоящем документе; аминоалкокси, согласно определению в настоящем документе; аминогруппу согласно определению в настоящем документе; и аминокислоту согласно определению в настоящем документе.

Обычно РНК включает группу сахара рибозы, который представляет собой 5-членное кольцо, содержащее кислород. Неограничивающие примеры модифицированных нуклеотидов включают замену кислорода в рибозе (например, на S, Se или алкилен, такой как метилен или этилен); добавление двойной связи (например, для замены рибозы циклопентенилом или циклогексенилом); сужение кольца рибозы (например, с образованием 4-членного кольца циклобутана или окситана); расширение кольца рибозы (например, с образованием 6- или 7-членного кольца с дополнительным атомом углерода или гетероатома, например, для ангидрогексита, альтрита, маннита, циклогексанила, циклогексенила, и морфолиновой группы, также имеющей фосфорамидатный остов); полициклические формы (например, трициклические; и «раскрытые» формы, такие как гликолевая нуклеиновая кислота (GNA) (например, R-GNA или S-GNA, где рибоза заменена на гликолевые единицы, присоединяемые к фосфодиэфирным связи), треозо-нуклеиновая кислота (TNA, где рибоза заменена на α-L-треофуранозил-(3′→2′)), и пептидная нуклеиновая кислота (PNA, где 2-амино-этилглициновыми связями заменены рибоза и фосфодиэфирный остов). Группа сахара может также содержать один или более атомов углерода в стереохимической конфигурации, противоположной конфигурации соответствующего атома углерода в рибозе. Соответственно, молекула полинуклеотида может включать нуклеотиды, содержащие, например, арабинозу в качестве сахара. Такие модификации сахаров описаны в международных патентных публикациях WO2013052523 и WO2014093924, содержание каждой из которых включено в настоящий документ полностью посредством ссылки.

Полинуклеотиды согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую один или более полипептидов раковых эпитопов, или его функциональный фрагмент или вариант) могут включать комбинацию модификаций сахара, нуклеинового основания и/или межнуклеозидной связи. Указанные комбинации могут включать любую одну или более из модификаций, описанных в настоящем документе.

Полинуклеотиды согласно настоящему описанию могут быть частично или полностью модифицированы вдоль всей длины молекулы. Например, один или более нуклеотидов, или все нуклеотиды, или определенный тип нуклеотида (например, пурин или пиримидин, или любой один или более из A, G, U, C, или все перечисленные нуклеотиды) могут быть однородно модифицированы в полинуклеотиде согласно настоящему изобретению, или в определенной заранее заданной области его последовательности (например, в мРНК, включающей или исключающей концевой поли-A-фрагмент). Согласно некоторым вариантам реализации все нуклеотиды X в полинуклеотиде согласно настоящему описанию (или в определенной заранее заданной области его последовательности) представляют собой модифицированные нуклеотиды, где X может представлять собой любой из нуклеотидов A, G, U, C, или любую из комбинаций A+G, A+U, A+C, G+U, G+C, U+C, A+G+U, A+G+C, G+U+C или A+G+C.

Указанный полинуклеотид может содержать от приблизительно 1% до приблизительно 100% модифицированных нуклеотидов (либо относительно общего содержания нуклеотидов, либо в отношении относительно содержания одного или более типов нуклеотида, т.е. любого одного или более из A, G, U или C) или любой промежуточный процент (например, от 1% до 20%, от 1% до 25%, от 1% до 50%, от 1% до 60%, от 1% до 70%, от 1% до 80%, от 1% до 90%, от 1% до 95%, от 10% до 20%, от 10% до 25%, от 10% до 50%, от 10% до 60%, от 10% до 70%, от 10% до 80%, от 10% до 90%, от 10% до 95%, от 10% до 100%, от 20% до 25%, от 20% до 50%, от 20% до 60%, от 20% до 70%, от 20% до 80%, от 20% до 90%, от 20% до 95%, от 20% до 100%, от 50% до 60%, от 50% до 70%, от 50% до 80%, от 50% до 90%, от 50% до 95%, от 50% до 100%, от 70% до 80%, от 70% до 90%, от 70% до 95%, от 70% до 100%, от 80% до 90%, от 80% до 95%, от 80% до 100%, от 90% до 95%, от 90% до 100%; и от 95% до 100%). Понятно, что любой оставшийся процент обеспечивает наличие немодифицированных A, G, U или C.

Указанные полинуклеотиды могут содержать минимум 1% и максимум 100% модифицированных нуклеотидов, или любой промежуточный процент, например, по меньшей мере 5% модифицированных нуклеотидов, по меньшей мере 10% модифицированных нуклеотидов, по меньшей мере 25% модифицированных нуклеотидов, по меньшей мере 50% модифицированных нуклеотидов, по меньшей мере 80% модифицированных нуклеотидов или по меньшей мере 90% модифицированных нуклеотидов. Например, указанные полинуклеотиды могут содержать модифицированный пиримидин, такой как модифицированный урацил или цитозин. Согласно некоторым вариантам реализации по меньшей мере 5%, по меньшей мере 10%, по меньшей мере 25%, по меньшей мере 50%, по меньшей мере 80%, по меньшей мере 90% или 100% урацила в полинуклеотиде заменены на модифицированный урацил (например, 5-замещенный урацил). Указанный модифицированный урацил может быть заменен соединением с одной уникальной структурой, или может быть заменен совокупностью соединений с различной структурой (например, 2, 3, 4 или более уникальными структурами). Согласно некоторым вариантам реализации по меньшей мере 5%, по меньшей мере 10%, по меньшей мере 25%, по меньшей мере 50%, по меньшей мере 80%, по меньшей мере 90% или 100% цитозина в полинуклеотиде заменены на модифицированный цитозин (например, 5-замещенный цитозин). Указанный модифицированный цитозин может быть заменен соединением с одной уникальной структурой, или может быть заменен совокупностью соединений с различной структурой (например, 2, 3, 4 или более уникальными структурами).

Соответственно, согласно некоторым вариантам реализации указанные РНК-вакцины содержат 5′UTR-элемент, необязательно кодон-оптимизированную открытую рамку считывания и 3′UTR-элемент, поли(A)-последовательность и/или сигнал полиаденилирования, причем указанная РНК химически не модифицирована.

Согласно некоторым вариантам реализации указанное модифицированное нуклеиновое основание представляет собой модифицированный урацил. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный урацил, включают псевдоуридин (ψ), рибонуклеозид пиридин-4-он, 5-азауридин, 6-азауридин, 2-тио-5-азауридин, 2-тиоуридин (s2U), 4-тиоуридин (s4U), 4-тиопсевдоуридин, 2-тиопсевдоуридин, 5-гидроксиуридин (ho5U), 5-аминоаллилуридин, 5-галогенуридин (например, 5-йодуридин или 5-бромуридин), 3-метилуридин (m3U), 5-метоксиуридин (mo5U), уридин-5-оксиуксусная кислота (cmo5U), сложный метиловый эфир уридин-5-оксиуксусной кислоты (mcmo5U), 5-карбоксиметилуридин (cm5U), 1-карбоксиметилпсевдоуридин, 5-карбоксигидроксиметилуридин (chm5U), 5- сложный метиловый эфир карбоксигидроксиметилуридина (mchm5U), 5-метоксикарбонилметилуридин (mcm5U), 5-метоксикарбонилметил-2-тиоуридин (mcm5s2U), 5-аминометил-2-тиоуридин (nm5s2U), 5-метиламинометилуридин (mnm5U), 5-метиламинометил-2-тиоуридин (mnm5s2U), 5-метиламинометил-2-seleno-уридин (mnm5se2U), 5-карбамоилметилуридин (ncm5U), 5-карбоксиметиламинометилуридин (cmnm5U), 5-карбоксиметиламинометил-2-тиоуридин (cmnm5s2U), 5-пропинилуридин, 1-пропинилпсевдоуридин, 5-тауринометилуридин (τm5U), 1-тауринометилпсевдоуридин, 5-тауринометил-2-тиоуридин(τm5s2U), 1-тауринометил-4-тиопсевдоуридин, 5-метилуридин (m5U, т.е. содержащий нуклеиновое основание дезокситимин), 1-метилпсевдоуридин (m1ψ), 1-этилпсевдоуридин (e1ψ), 5-метил-2-тиоуридин (m5s2U), 1-метил-4-тиопсевдоуридин (m1s4ψ), 4-тио-1-метилпсевдоуридин, 3-метилпсевдоуридин (m3ψ), 2-тио-1-метилпсевдоуридин, 1-метил-1-деазапсевдоуридин, 2-тио-1-метил-1-деазапсевдоуридин, дигидроуридин (D), дигидропсевдоуридин, 5,6-дигидроуридин, 5-метилдигидроуридин (m5D), 2-тиодигидроуридин, 2-тиодигидропсевдоуридин, 2-метоксиуридин, 2-метокси-4-тиоуридин, 4-метоксипсевдоуридин, 4-метокси-2-тиопсевдоуридин, N1-метилпсевдоуридин, 3-(3-амино-3-карбоксипропил)уридин (acp3U), 1-метил-3-(3-амино-3-карбоксипропил)псевдоуридин (acp3 ψ), 5-(изопентениламинометил)уридин (inm5U), 5-(изопентениламинометил)-2-тиоуридин (inm5s2U), α-тиоуридин, 2′-O-метилуридин (Um), 5,2′-O-диметилуридин (m5Um), 2′-O-метилпсевдоуридин (ψm), 2-тио-2′-O-метилуридин (s2Um), 5-метоксикарбонилметил-2′-O-метилуридин (mcm5Um), 5-карбамоилметил-2′-O-метилуридин (ncm5Um), 5-карбоксиметиламинометил-2′-O-метилуридин (cmnm5Um), 3,2′-O-диметилуридин (m3Um) и 5-(изопентениламинометил)-2′-O-метилуридин (inm5Um), 1-тиоуридин, дезокситимидин, 2’-F-арауридин, 2’-F-уридин, 2’-OH-арауридин, 5-(2-карбометоксивинил)уридин и 5-[3-(1-E-пропениламино)]уридин.

Согласно некоторым вариантам реализации указанное модифицированное нуклеиновое основание представляет собой модифицированный цитозин. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный цитозин, включают 5-азацитидин, 6-азацитидин, псевдоизоцитидин, 3-метилцитидин (m3C), N4-ацетилцитидин (ac4C), 5-формилцитидин (f5C), N4-метилцитидин (m4C), 5-метилцитидин (m5C), 5-галоцитидин (например, 5-йодцитидин), 5-гидроксиметилцитидин (hm5C), 1-метилпсевдоизоцитидин, пирролоцитидин, пирроло-псевдоизоцитидин, 2-тиоцитидин (s2C), 2-тио-5-метилцитидин, 4-тиопсевдоизоцитидин, 4-тио-1-метилпсевдоизоцитидин, 4-тио-1-метил-1-деазапсевдоизоцитидин, 1-метил-1-деазапсевдоизоцитидин, зебуларин, 5-аза-зебуларин, 5-метилзебуларин, 5-аза-2-тиозебуларин, 2-тиозебуларин, 2-метоксицитидин, 2-метокси-5-метилцитидин, 4-метоксипсевдоизоцитидин, 4-метокси-1-метилпсевдоизоцитидин, лизидин (k2C), α-тиоцитидин, 2′-O-метилцитидин (Cm), 5,2′-O-диметилцитидин (m5Cm), N4-ацетил-2′-O-метилцитидин (ac4Cm), N4,2′-O-диметилцитидин (m4Cm), 5-формил-2′-O-метилцитидин (f5Cm), N4,N4,2′-O-триметилцитидин (m42Cm), 1-тио-цитидин, 2’-F-арацитидин, 2’-F-цитидин и 2’-OH-арацитидин.

Согласно некоторым вариантам реализации указанное модифицированное нуклеиновое основание представляет собой модифицированный аденин. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный аденин, включают 2-аминопурин, 2, 6-диаминопурин, 2-амино-6-галоген-пурин (например, 2-амино-6-хлорпурин), 6-галогенпурин (например, 6-хлорпурин), 2-амино-6-метилпурин, 8-азидоаденозин, 7-деаза-аденин, 7-деаза-8-аза-аденин, 7-деаза-2-аминопурин, 7-деаза-8-аза-2-аминопурин, 7-деаза-2,6-диаминопурин, 7-деаза-8-аза-2,6-диаминопурин, 1-метиладенозин (m1A), 2-метиладенин (m2A), N6-метиладенозин (m6A), 2-метилтио-N6-метиладенозин (ms2m6A), N6-изопентениладенозин (i6A), 2-метилтио-N6-изопентениладенозин (ms2i6A), N6-(цис-гидроксиизопентенил)аденозин (io6A), 2-метилтио-N6-(цис-гидроксиизопентенил)аденозин (ms2io6A), N6-глицинилкарбамоиладенозин (g6A), N6-треонилкарбамоиладенозин (t6A), N6-метил-N6-треонилкарбамоиладенозин (m6t6A), 2-метилтио-N6-треонилкарбамоиладенозин (ms2g6A), N6,N6-диметиладенозин (m62A), N6-гидроксинорвалилкарбамоиладенозин (hn6A), 2-метилтио-N6-гидроксинорвалилкарбамоиладенозин (ms2hn6A), N6-ацетиладенозин (ac6A), 7-метиладенин, 2-метилтиоаденин, 2-метоксиаденин, α-тиоаденозин, 2′-O-метиладенозин (Am), N6,2′-O-диметиладенозин (m6Am), N6,N6,2′-O-триметиладенозин (m62Am), 1,2′-O-диметиладенозин (m1Am), 2′-O-рибозиладенозин (фосфат) (Ar(p)), 2-амино-N6-метилпурин, 1-тиоаденозин, 8-азидоаденозин, 2’-F-ара-аденозин, 2’-F-аденозин, 2’-OH-ара-аденозин и N6-(19-аминопентаоксанонадецил)-аденозин.

Согласно некоторым вариантам реализации указанное модифицированное нуклеиновое основание представляет собой модифицированный гуанин. Примеры нуклеиновых оснований и нуклеозидов, содержащих модифицированный гуанин, включают инозин (I), 1-метилинозин (m1I), виозин (imG), метилвиозин (mimG), 4-деметилвиозин (imG-14), изовиозин (imG2), вибутозин (yW), пероксивибутозин (o2yW), гидроксивибутозин (OhyW), недомодифицированный гидроксивибутозин (OhyW*), 7-деазагуанозин, квеозин (Q), эпоксиквеозин (oQ), галактозилквеозин (galQ), маннозилквеозин (manQ), 7-циано-7-деазагуанозин (preQ0), 7-аминометил-7-деазагуанозин (preQ1), архаэозин (G+), 7-деаза-8-азагуанозин, 6-тиогуанозин, 6-тио-7-деазагуанозин, 6-тио-7-деаза-8-азагуанозин, 7-метилгуанозин (m7G), 6-тио-7-метилгуанозин, 7-метилинозин, 6-метоксигуанозин, 1-метилгуанозин (m1G), N2-метилгуанозин (m2G), N2,N2-диметилгуанозин (m22G), N2,7-диметилгуанозин (m2,7G), N2, N2,7-диметилгуанозин (m2,2,7G), 8-оксогуанозин, 7-метил-8-оксогуанозин, 1-метил-6-тиогуанозин, N2-метил-6-тиогуанозин, N2,N2-диметил-6-тиогуанозин, α-тиогуанозин, 2′-O-метилгуанозин (Gm), N2-метил-2′-O-метилгуанозин (m2Gm), N2,N2-диметил-2′-O-метилгуанозин (m22Gm), 1-метил-2′-O-метилгуанозин (m1Gm), N2,7-диметил-2′-O-метилгуанозин (m2,7Gm), 2′-O-метил-инозин (Im), 1,2′-O-диметилинозин (m1Im), 2′-O-рибозилгуанозин (фосфат) (Gr(p)), 1-тиогуанозин, O6-метилгуанозин, 2’-F-ара-гуанозин и 2’-F-гуанозин.

Транскрипция РНК (например, мРНК) in vitro

Противораковые вакцины согласно настоящему описанию содержат по меньшей мере один РНК-полинуклеотид, такой как мРНК (например, модифицированный мРНК). мРНК, например, транскрибируют in vitro с матричной ДНК, называемой «матрицей для транскрипции in vitro». Согласно некоторым вариантам реализации матрица для транскрипции in vitro кодирует нетранслируемую 5′ (UTR) область, содержит открытую рамку считывания и кодирует 3′ UTR и концевой поли-A-фрагмент. Конкретные состав и длина последовательности нуклеиновой кислоты матрицы для транскрипции in vitro зависит от мРНК, кодируемой указанной матрицей.

Согласно некоторым вариантам реализации полинуклеотид включает 200- 3000 нуклеотидов. Например, полинуклеотид может включать 200-500, 200-1000, 200-1500, 200-3000, 500-1000, 500-1500, 500-2000, 500-3000, 1000-1500, 1000-2000, 1000-3000, 1500-3000 или 2000-3000 нуклеотидов).

Согласно другим аспектам настоящее изобретение относится к способу получения противораковой мРНК-вакцины способами IVT. Способы транскрипции in vitro (IVT) позволяют осуществлять направляемый матрицей синтез молекул РНК практически с любой последовательностью. Размер молекул РНК, которые могут быть синтезированы с применением способов IVT, варьирует от коротких олигонуклеотидов до длинных полимеров нуклеиновых кислот, содержащих несколько тысяч оснований. Способы IVT позволяют осуществлять синтез значительных количеств РНК- транскриптов (например, от микрограммов до миллиграммов) (Beckert et al., Synthesis of RNA by in vitro transcription, Methods Mol Biol. 703:29-41(2011); Rio et al. RNA: A Laboratory Manual. Cold Spring Harbor: Cold Spring Harbor Laboratory Press, 2011, 205-220.; Cooper, Geoffery M. The Cell: A Molecular Approach. 4th ed. Washington D.C.: ASM Press, 2007. 262-299). Обычно при IVT задействуют ДНК-матрицу с последовательностью промотора, расположенной в 5’-направлении от представляющей интерес последовательности. Наиболее распространены последовательности промоторов, происходящие из бактериофагов (например, последовательность промотора T7, T3 или SP6), но могут быть допустимы и многие другие последовательности промоторов, включая разработанные de novo. Транскрипция ДНК-матрицы, как правило, достигается наилучшим образом при применении РНК- полимеразы, соответствующей специфической последовательности промотора бактериофага. Примеры РНК-полимераз включают в том числе, но не ограничиваясь перечисленным, РНК-полимеразу T7, РНК-полимеразу T3 или РНК-полимеразу SP6. Инициация IVT обычно происходит на дцДНК, но продолжаться она может на одной цепи.

Следует понимать, что мРНК-вакцины согласно настоящему описанию, например, мРНК, кодирующие раковый антиген или, например, пептид активирующей мутации онкогена, могут быть получены с применением любого подходящего способа синтеза. Например, согласно некоторым вариантам реализации мРНК-вакцины согласно настоящему описанию получают с применением IVT с одиночной нижней цепи ДНК в качестве матрицы и комплементарного олигонуклеотида, который служит в качестве промотора. Указанная одиночная нижняя цепь ДНК может функционировать в качестве ДНК-матрицы для транскрипции РНК in vitro и может быть получена, например, из плазмиды, ПЦР- продукта или путем химического синтеза. Согласно некоторым вариантам реализации указанная одиночная нижняя цепь ДНК линеаризована из кольцевой матрицы. Указанная одиночная нижняя цепь ДНК-матрицы обычно включает последовательность промотора, например, последовательность промотора бактериофага, для облегчения IVT. Способы получения РНК с применением одиночной нижней цепи ДНК и промоторной верхней цепи комплементарного олигонуклеотида известны в данной области техники. Пример способа включает, не ограничиваясь перечисленным, отжиг нижней цепи ДНК-матрицы с промоторной верхней цепью комплементарного олигонуклеотида (например, комплементарного олигонуклеотида промотора T7, комплементарного олигонуклеотида промотора T3 или комплементарного олигонуклеотида промотора SP6), с последующим проведением IVT с применением РНК-полимеразы, соответствующей указанной последовательности промотора, например, РНК-полимеразы T7, РНК-полимеразы T3 или РНК-полимеразы SP6.

Способы IVT могут также быть реализованы с использованием двуцепочечной ДНК-матрицы. Например, согласно некоторым вариантам реализации указанную двуцепочечную ДНК-матрицу получают путем продолжения комплементарного олигонуклеотида с получением комплементарной цепи ДНК, используя методики достройки цепи, доступные в данной области техники. Согласно некоторым вариантам реализации одиночную нижнюю цепь ДНК-матрицы, содержащую последовательность промотора, и последовательность, кодирующую один или более представляющий интерес эпитопов, отжигают с промоторной верхней цепью комплементарного олигонуклеотида и подвергают ПЦР-подобному процессу для достройки верхней цепи с получением двуцепочечной ДНК-матрицы. В альтернативном или дополнительном варианте верхнюю цепь ДНК, содержащую последовательность, комплементарную промоторной последовательности нижней цепи и комплементарную последовательности, кодирующей один или более представляющих интерес эпитопов, отжигают с нижней цепью промоторного олигонуклеотида и подвергают ПЦР-подобному процессу для достройки нижней цепи с получением двуцепочечной ДНК-матрицы. Согласно некоторым вариантам реализации количество ПЦР-подобных циклов варьирует от 1 до 20, например, от 3 до 10 циклов. Согласно некоторым вариантам реализации двуцепочечную ДНК-матрицу синтезируют полностью или частично с применением способов химического синтеза. Двуцепочечная ДНК-матрица может быть подвергнута транскрипции in vitro согласно описанию в настоящем документе.

Согласно другому аспекту мРНК-вакцины согласно настоящему описанию, например, мРНК, кодирующие раковый антиген или эпитоп, могут быть получены с использованием двух цепей ДНК, комплементарных на протяжении перекрывающейся части их последовательностей, образующих одноцепочечные выступающие концы (т.е. «липкие концы») при отжиге комплементарных частей. Указанные одноцепочечные выступающие концы могут быть сделаны двуцепочечными при достройке с применением другой цепи в качестве матрицы, с получением таким образом двуцепочечной ДНК. В некоторых случаях указанный способ достройки праймера может позволять включать ORF большего размера в последовательность ДНК-матрицы, например, по сравнению с размерами при включении в последовательности ДНК-матрицы, полученные способами синтеза верхней цепи ДНК. В способе достройки праймера часть 3′-конца первой цепи (в направлении 5′′-3′) комплементарна части 3′-конца второй цепи (в направлении 3′-5′). Согласно некоторым таким вариантам реализации одиночная первая цепь ДНК может включать последовательность промотора (например, T7, T3 или SP6), необязательно, 5′-UTR, и некоторую часть ORF или всю ORF (например, часть 5′-конца ORF). Согласно некоторым вариантам реализации одиночная вторая цепь ДНК может включать последовательности, комплементарные некоторой части ORF или всей ORF (например, часть, комплементарную 3′-концу ORF), и, необязательно, 3′-UTR, стоп-последовательность и/или концевой поли(A)-фрагмент. Способы получения РНК с применением двух синтетических цепей ДНК может включать отжиг указанных двух цепей с перекрывающимися комплементарными частями и последующую достройку праймера с использованием одного или более ПЦР-подобных циклов для достройки цепей с получением двуцепочечной ДНК-матрицы. Согласно некоторым вариантам реализации число ПЦР-подобных циклов варьирует от 1 до 20 циклов, например, от 3 до 10 циклов. Такая двуцепочечная ДНК может быть подвергнута транскрипции in vitro согласно описанию в настоящем документе.

Согласно другому аспекту мРНК-вакцины согласно настоящему описанию, например, мРНК, кодирующие раковый антиген или эпитоп, могут быть получены с применением синтетических двуцепочечных линейных молекул ДНК, таких как gBlocks® (Integrated DNA Technologies, Коралвилль, Айова), в качестве двуцепочечной ДНК-матрицы. Преимущество таких синтетических двуцепочечных линейных молекул ДНК заключается в том, что они обеспечивают более длинную матрицу для получения мРНК. Например, размер gBlocks® может варьировать от 45 до 1000 (например, от 125 до 750) нуклеотидов. Согласно некоторым вариантам реализации синтетическая двуцепочечная линейная ДНК-матрица включает полноразмерную 5′-UTR, полноразмерную 3′-UTR, или и то, и другое. Полноразмерная 5′-UTR может иметь длину до 100 нуклеотидов, например, приблизительно 40-60 нуклеотидов. Полноразмерная 3′-UTR может иметь длину до 300 нуклеотидов, например, приблизительно 100-150 нуклеотидов.

Для облегчения получения более длинных конструкций две или более двуцепочечных линейных молекул ДНК и/или генных фрагментов, разработанных с перекрывающимися последовательностями на 3′-цепях, могут быть собраны с применением способов, известных в данной области техники. Например, способ Gibson Assembly™ (Synthetic Genomics, Inc., Ла-Хойя, Калифорния) может быть реализован с применением мезофильной экзонуклеазы, который отщепляет основания от 5′-конца двуцепочечных фрагментов ДНК, с последующим отжигом вновь образованных комплементарных одноцепочечных 3′-концов, полимераза-зависимой достройки для заполнения каких-либо одноцепочечных пропусков и, наконец, ковалентного соединения сегментов ДНК ДНК-лигазой.

Согласно другому аспекту мРНК-вакцины согласно настоящему описанию, например, мРНК, кодирующие раковый антиген или эпитоп, могут быть получены путем химического синтеза РНК. Способы, например, включают отжиг первого полинуклеотида, содержащего открытую рамку считывания, кодирующую указанный полипептид, и второго полинуклеотида, содержащего 5′-UTR, с комплементарным полинуклеотидом, конъюгированным с твердой подложкой. Затем 3′-конец указанного второго полинуклеотида лигируют с 5′-концом указанного первого полинуклеотида в подходящих условиях. Подходящие условия включают применение ДНК-лигазы. Реакция лигирования дает первый продукт лигирования. Затем 5′-конец третьего полинуклеотида, содержащий 3′-UTR, лигируют с 3′-концом указанного первого продукта лигирования в подходящих условиях. Подходящие условия для второй реакции лигирования включают РНК-лигазу. Второй продукт лигирования дает вторая реакция лигирования. Указанный второй продукт лигирования высвобождают с твердой подложки с получением мРНК, кодирующей представляющий интерес полипептид. Согласно некоторым вариантам реализации размер указанной мРНК составляет от 30 до 1000 нуклеотидов.

мРНК, кодирующая представляющий интерес полипептид, может также быть получена путем связывания первого полинуклеотида, содержащего открытую рамку считывания, кодирующую указанный полипептид, с вторым полинуклеотидом, содержащим 3′-UTR, и комплементарным полинуклеотидом, конъюгированным с твердой подложкой. 5′-конец указанного второго полинуклеотида лигируют с 3′-концом указанного первого полинуклеотида в подходящих условиях. Подходящие условия включают ДНК-лигазу. Указанный способ обеспечивает получение первого продукта лигирования. Третий полинуклеотид, содержащий 5′-UTR, лигируют с первым продуктом лигирования в подходящих условиях, получая второй продукт лигирования. Подходящие условия включают РНК-лигазу, такую как РНК-лигазу T4. Указанный второй продукт лигирования высвобождается с твердой подложки, с получением мРНК, кодирующей представляющий интерес полипептид.

Согласно некоторым вариантам реализации указанный первый полинуклеотид содержит 5′-трифосфат и 3′-OH. Согласно другим вариантам реализации указанный второй полинуклеотид содержит 3′-OH. Согласно другим дополнительным вариантам реализации указанный третий полинуклеотид содержит 5′-трифосфат и 3′-OH. Указанный второй полинуклеотид может также включать 5′-кэп-структуру. Указанный способ может также включать дополнительный этап лигирования четвертого полинуклеотида, содержащего поли-A-область, с 3′-концом третьего полинуклеотида. Указанный четвертый полинуклеотид может содержать 5′-трифосфат.

Указанный способ может включать или не включать очищение обращенно-фазовым методом. Указанный способ может также включать этап промывания, отличающийся тем, что твердую подложку промывают для удаления непрореагировавших полинуклеотидов. Твердая подложка может представлять собой, например, смолу для захвата. Согласно некоторым вариантам реализации указанный способ включает (dT)-очищение.

В соответствии с настоящим изобретением ДНК-матрица, кодирующая мРНК-вакцины согласно настоящему описанию, включает открытую рамку считывания (ORF), кодирующую один или более раковых эпитопов. Согласно некоторым вариантам реализации ДНК-матрица включает ORF размером до 1000 нуклеотидов, например, приблизительно 10-350, 30-300 нуклеотидов или приблизительно 50-250 нуклеотидов. Согласно некоторым вариантам реализации реализации ДНК-матрица включает ORF размером приблизительно 150 нуклеотидов. Согласно некоторым вариантам реализации реализации ДНК-матрица включает ORF размером приблизительно 200 нуклеотидов.

Согласно некоторым вариантам реализации IVT-транскрипты очищают от компонентов реакционной IVT-смеси после протекания реакции. Например, неочищенная IVT-смесь может быть обработана не содержащей РНКаз ДНКазой для расщепления оригинальной матрицы. мРНК может быть очищена с применением способов, известных в данной области техники, включающих, не ограничиваясь перечисленным, осаждение с применением органического растворителя или колоночного способа очищения. Доступны коммерческие наборы для очищения РНК, например, набор MEGACLEAR™ Kit (Ambion, Остин, Техас). мРНК может быть количественно определена с применением способов, известных в данной области техники, в том числе, но не ограничиваясь перечисленными, коммерчески доступных инструментов, например, NanoDrop. Очищенная мРНК может быть проанализирована, например, с применением электрофореза на агарозном геле для подтверждения надлежащего размера РНК и/или для подтверждения того, что не произошло разложения РНК.

Нетранслируемые области (UTR)

Нетранслируемые области (UTR) представляют собой участки нуклеиновых кислот полинуклеотида перед стартовым кодоном (5'UTR) и после стоп-кодона (3'UTR), которые не транслируются. Согласно некоторым вариантам реализации полинуклеотид (например, рибонуклеиновая кислота (РНК), например, матричная РНК (мРНК)) согласно настоящему изобретению, содержащий открытую рамку считывания (ORF), кодирующую один или более раковый антиген или эпитоп, дополнительно содержит UTR (например, 5′UTR или ее функциональный фрагмент, 3′UTR или ее функциональный фрагмент, или их комбинацию).

UTR может быть гомологичной или гетерологичной в отношении кодирующей области полинуклеотида. Согласно некоторым вариантам реализации UTR гомологична ORF, кодирующей один или более полипептидов раковых эпитопов. Согласно некоторым вариантам реализации UTR гетерологична ORF, кодирующей один или более полипептидов раковых эпитопов. Согласно некоторым вариантам реализации указанный полинуклеотид содержит две или более 5′UTR или их функциональных фрагментов, каждая из которых имеет одну и ту же или разные последовательности нуклеотидов. Согласно некоторым вариантам реализации указанный полинуклеотид содержит две или более 3′UTR или их функциональных фрагментов, каждая из которых имеет одну и ту же или разные последовательности нуклеотидов.

Согласно некоторым вариантам реализации оптимизируют последовательность 5′UTR или ее функционального фрагмента, 3′ UTR или ее функционального фрагмента, или любой их комбинации.

Согласно некоторым вариантам реализации 5′UTR или ее функциональный фрагмент, 3′ UTR или ее функциональный фрагмент, или любая их комбинация содержат по меньшей мере одно химически модифицированное нуклеиновое основание, например, 5-метоксиурацил.

UTR могут иметь признаки, которые обеспечивают регуляторную роль, например, повышенную или пониженную стабильность, локализацию и/или эффективность трансляции. Полинуклеотид, содержащий UTR, может быть введен в клетку, ткань или организм, и один или более регуляторных признаков может быть измерен с применением рутинных способов. Согласно некоторым вариантам реализации функциональному фрагменту 5'UTR или 3'UTR свойственны один или более регуляторных признаков полноразмерной 5'UTR или 3' UTR, соответственно.

Природные 5′UTR отличают признаки, играющие роль при инициации трансляции. Они несут сигнатуры, такие как последовательности Козак, которые, как общеизвестно, вовлечены в процесс, в ходе которого рибосома инициирует трансляцию многих генов. Последовательности Козак содержат консенсусную последовательность CCR(A/G)CCAUGG (SEQ ID NO: 246), где R представляет собой пурин (аденин или гуанин) на расстоянии трех оснований в 5’-направлении от стартового кодона (AUG), за которым следует еще один «G». Также известно, что 5′UTR образуют вторичные структуры, которые вовлечены в связывание фактора удлинения.

Путем конструирования признаков, обычно обнаруживаемых в высокоэкспрессируемых генах специфических целевых органов, можно повышать стабильность и продуцирование белка полинуклеотида. Например, введение 5′UTR экспрессируемой в печени мРНК, такой как мРНК альбумина, сывороточного амилоида A, аполипопротеина A/B/E, трансферрина, альфа-фетопротеина, эритропоэтина или фактора VIII, может усиливать экспрессию полинуклеотидов в линиях печеночных клеток или печени. Сходным образом, использование 5′UTR из других тканеспецифических мРНК для улучшения экспрессии в указанной ткани возможно для мышц (например, из MyoD, миозина, миоглобина, миогенина, геркулина), эндотелиальных клеток (например, Tie-1, CD36), миелоидных клеток (например, C/EBP, AML1, Г-КСФ, ГМ-КСФ, CD11b, MSR, Fr-1, i-NOS), лейкоцитов (например, CD45, CD18), жировой ткани (например, CD36, GLUT4, ACRP30, адипонектина) и клеток легочного эпителия (например, SP-A/B/C/D).

Согласно некоторым вариантам реализации UTR выбраны из семейства транскриптов белков, обладающих общей функцией, структурой, признаком или свойством. Например, кодируемый полипептид может принадлежать к семейству белков (т.е. белков, обладающих общими по меньшей мере одной функцией, структурой, признаком, локализацией, происхождением или паттерном экспрессии), экспрессируемых в конкретной клетке, ткани, или в определенное время в ходе развития. UTR из любого из генов или мРНК может быть заменена на любую другую UTR из того же или другого семейства белков с получением нового полинуклеотида.

Согласно некоторым вариантам реализации указанные 5’UTR и 3’UTR могут быть гетерологичными. Согласно некоторым вариантам реализации 5'UTR может происходить не из того вида, из которого происходит 3'UTR. Согласно некоторым вариантам реализации 3'UTR может происходить не из того вида, из которого происходит 5'UTR.

В совместной международной заявке на патент № PCT/US 2014/021522 (публикация WO/2014/164253, включенная в настоящий документ полностью посредством ссылки) приведен перечень примеров UTR, которые могут быть использованы в полинуклеотиде согласно настоящему изобретению в качестве фланкирующих ORF областей.

Примеры UTR для применения согласно настоящему изобретению включают, не ограничиваясь перечисленными, одну или более 5′UTR и/или 3′UTR, происходящих из последовательности нуклеиновой кислоты: глобина, такого как α- или β-глобин (например, глобина Xenopus, мыши, кролика или человека); сильного сигнала инициации трансляции Козак; CYBA (например, α-полипептида цитохрома b-245 человека); альбумина (например, альбумина 7 человека); HSD17B4 ((17-β)-гидроксистероид-дегидрогеназы); вируса (например, вируса гравировки табака (TEV), вируса венесуэльского энцефалита лошадей (VEEV), вируса Денге, цитомегаловируса (CMV) (например, немедленно-раннего промотора CMV 1 (IE1)), вируса гепатита (например, вируса гепатита B), вируса Синдбис или вируса желтой карликовости ячменя PAV); белка теплового шока (например, hsp70); фактора инициации трансляции (например, elF4G); транспортера глюкозы (например, hGLUT1 (транспортера глюкозы 1 человека)); актина (например, α-актина или β-актина человека); ГАФДГ; тубулина; гистона; фермента цикла лимонной кислоты; топоизомеразы (например, 5′UTR гена TOP без 5′-мотива TOP (олигопиримидинового тракта)); рибосомального белка Large 32 (L32); рибосомального белка (например, рибосомального белка человека или мыши, такого как, например, rps9); АТФ-синтазы (например, ATP5A1 или β-субъединицы митохондриальной H+-АТФ-синтазы); гормона роста e (например, бычьего (bGH) или человеческого (hGH)); фактора удлинения (например, фактора удлинения 1 α1 (EEF1A1)); марганецзависимой супероксиддисмутазы (MnSOD); энхансерного фактора миоцитов 2A (MEF2A); β-F1-АТФазы, креатинкиназы, миоглобина, гранулоцитарного колониестимулирующего фактора (Г-КСФ); коллагена (например, коллагена типа I, альфа 2 (Col1A2), коллагена типа I, альфа 1 (Col1A1), коллагена типа VI, альфа 2 (Col6A2), коллагена типа VI, альфа 1 (Col6A1)); рибофорина (например, рибофорина I (RPNI)); связанного с рецептором липопротеинов низкой плотности белка (например, LRP1); кардиотрофин-подобного цитокинового фактора (например, Nnt1); кальретикулина (Calr); проколлаген-лизин-2-оксоглутарат-5-диоксигеназы 1 (Plod1); и нуклеобиндина (например, Nucb1).

Другие примеры 5' и 3' UTR включают, не ограничиваясь перечисленными, описанные в источниках: Karikó et al., Mol. Ther. 2008 16(11):1833-1840; Karikó et al., Mol. Ther. 2012 20(5):948-953; Karikó et al., Nucleic Acids Res. 2011 39(21):e142; Strong et al., Gene Therapy 1997 4:624-627; Hansson et al., J. Biol. Chem. 2015 290(9):5661-5672; Yu et al., Vaccine 2007 25(10):1701-1711; Cafri et al., Mol. Ther. 2015 23(8):1391-1400; Andries et al., Mol. Pharm. 2012 9(8):2136-2145; Crowley et al., Gene Ther. 2015 Jun 30, doi:10.1038/gt.2015.68; Ramunas et al., FASEB J. 2015 29(5):1930-1939; Wang et al., Curr. Gene Ther. 2015 15(4):428-435; Holtkamp et al., Blood 2006 108(13):4009-4017; Kormann et al., Nat. Biotechnol. 2011 29(2):154-157; Poleganov et al., Hum. Gen. Ther. 2015 26(11):751-766; Warren et al., Cell Stem Cell 2010 7(5):618-630; Mandal and Rossi, Nat. Protoc. 2013 8(3):568-582; Holcik and Liebhaber, PNAS 1997 94(6):2410-2414; Ferizi et al., Lab Chip. 2015 15(17):3561-3571; Thess et al., Mol. Ther. 2015 23(9):1456-1464; Boros et al., PLoS One 2015 10(6):e0131141; Boros et al., J. Photochem. Photobiol. B. 2013 129:93-99; Andries et al., J. Control. Release 2015 217:337-344; Zinckgraf et al., Vaccine 2003 21(15):1640-9; Garneau et al., J. Virol. 2008 82(2):880-892; Holden and Harris, Virology 2004 329(1):119-133; Chiu et al., J. Virol. 2005 79(13):8303-8315; Wang et al., EMBO J. 1997 16(13):4107-4116; Al-Zoghaibi et al., Gene 2007 391(1-2):130-9; Vivinus et al., Eur. J. Biochem. 2001 268(7):1908-1917; Gan and Rhoads, J. Biol. Chem. 1996 271(2):623-626; Boado et al., J. Neurochem. 1996 67(4):1335-1343; Knirsch and Clerch, Biochem. Biophys. Res. Commun. 2000 272(1):164-168; Chung et al., Biochemistry 1998 37(46):16298-16306; Izquierdo and Cuevza, Biochem. J. 2000 346 Pt 3:849-855; Dwyer et al., J. Neurochem. 1996 66(2):449-458; Black et al., Mol. Cell. Biol. 1997 17(5):2756-2763; Izquierdo and Cuevza, Mol. Cell. Biol. 1997 17(9):5255-5268; US 8278036; US 8748089; US 8835108; US 9012219; US 2010/0129877; US 2011/0065103; US 2011/0086904; US 2012/0195936; US 2014/020675; US 2013/0195967; US 2014/029490; US 2014/0206753; WO 2007/036366; WO 2011/015347; WO 2012/072096; WO 2013/143555; WO 2014/071963; WO 2013/185067; WO 2013/182623; WO 2014/089486; WO 2013/185069; WO 2014/144196; WO 2014/152659; 2014/152673; WO 2014/152940; WO 2014/152774; WO 2014/153052; WO 2014/152966, WO 2014/152513; WO 2015/101414; WO 2015/101415; WO 2015/062738; и WO 2015/024667; содержание каждого из которых включено в настоящий документ полностью посредством ссылки.

Согласно некоторым вариантам реализации указанная 5’UTR выбрана из группы, состоящей из 5’UTR β-глобина; 5′UTR, содержащей сильный сигнал инициации трансляции Козак; 5'UTR цитохрома b-245, α-полипептида (CYBA); 5'UTR (17-β)-гидроксистероид-дегидрогеназы (HSD17B4); 5'UTR вируса гравировки табака (TEV); 5'UTR вируса венесуэльского энцефалита лошадей (TEEV); 5'-проксимальной открытой рамки считывания РНК вируса краснухи (RV), кодирующей неструктурные белки; 5'UTR вируса Денге (DEN); 5'UTR белка теплового шока 70 (Hsp70); 5'UTR eIF4G; 5'UTR GLUT1; их функциональных фрагментов и любой комбинации перечисленного.

Согласно некоторым вариантам реализации указанная 3'UTR выбрана из группы, состоящей из 3’UTR β-глобина; 3'UTR CYBA; 3'UTR альбумина; 3'UTR гормона роста (GH); 3'UTR VEEV; 3'UTR вируса гепатита B (HBV); 3′UTR α-глобина; 3'UTR DEN; 3'UTR вируса желтой карликовости ячменя PAV (BYDV-PAV); 3'UTR фактора удлинения 1 α1 (EEF1A1); 3'UTR марганецзависимой супероксиддисмутазы (MnSOD); 3'UTR β-субъединицы митохондриальной H(+)-АТФ-синтазы (β-мРНК); 3'UTR GLUT1; 3'UTR MEF2A; 3'UTR β-F1-АТФазы; их функциональных фрагментов и любой комбинации перечисленного.

Другие примеры UTR включают, не ограничиваясь перечисленными, одну или более из UTR, в том числе любую комбинацию UTR, описанных в WO2014/164253, содержание которого включено в настоящий документ полностью посредством ссылки. В таблице 21 в предварительной заявке на патент США №61/775509 и в таблице 22 в предварительной заявке на патент США № 61/829372, содержание которых включено в настоящий документ полностью посредством ссылок, приведен перечень стартовых сайтов и стоп-сайтов 5'UTR и 3'UTR. В таблице 21 каждая 5′UTR (от 5′-UTR-005 до 5′-UTR 68511) идентифицирована по стартовому сайту и стоп-сайту, соотнесенных с природным транскриптом или транскриптом дикого типа (гомологичным) (ENST; идентификатор, используемый в базе данных ENSEMBL).

UTR дикого типа, происходящая из любого гена или мРНК, может быть включена в полинуклеотиды согласно настоящему изобретению. Согласно некоторым вариантам реализации UTR может быть изменена относительно UTR дикого типа или природной UTR с получением варианта UTR, например, путем изменения ориентации или локализации UTR относительно ORF; или путем включения дополнительных нуклеотидов, делеции нуклеотидов, перестановки или транспозиции нуклеотидов. Согласно некоторым вариантам реализации могут быть использованы варианты 5′ или 3′ UTR, например, мутанты UTR дикого типа или варианты, в которых к концу UTR добавлены или из конца UTR удалены один или более нуклеотидов.

Кроме того, одна или более синтетических UTR могут применяться в комбинации с одной или более несинтетических UTR. См., например, источники: Mandal and Rossi, Nat. Protoc. 2013 8(3):568-82 и описание последовательностей, доступное по ссылке www.addgene.org/Derrick_Rossi/, содержание каждого из которых включено в настоящий документ полностью посредством ссылки. UTR или их части могут быть размещены в той же ориентации, что и транскрипт, из которого они были выбраны, или их ориентация или локализация могут быть изменены. Таким образом, 5′ и/или 3′ UTR может быть инвертирована, укорочена, удлинена или скомбинирована с одной или более другими 5′ UTR или 3′ UTR.

Согласно некоторым вариантам реализации указанный полинуклеотид содержит несколько UTR, например, двойную, тройную или четверную 5’UTR или 3’UTR. Например, двойная UTR содержит две копии одной UTR, расположенные последовательно или по существу последовательно. Например, может быть использована двойная 3′UTR бета-глобина (см. US2010/0129877, содержание которого включено в настоящий документ полностью посредством ссылки).

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению содержат 5'UTR и/или 3'UTR, выбранную из любых UTR согласно описанию в настоящем документе. Согласно некоторым вариантам реализации указанная 5’UTR и/или указанная 3’ UTR включают:

Название SEQ ID NO:
5'UTR-001 («Левая» UTR) 247
5'UTR-002 («Левая» UTR) 248
5'UTR-003 («Левая» UTR) 249
5'UTR-004 («Левая» UTR) 250
5'UTR-005 («Левая» UTR) 251
5'UTR-006 («Левая» UTR) 252
5'UTR-007 («Левая» UTR) 253
5'UTR-008 («Левая» UTR) 254
5'UTR-009 («Левая» UTR) 255
5'UTR-010 («Левая» UTR) 256
5'UTR-011 («Левая» UTR) 257
5'UTR-012 («Левая» UTR) 258
5'UTR-013 («Левая» UTR) 259
5'UTR-014 («Левая» UTR) 260
5'UTR-015 («Левая» UTR) 261
5'UTR-016 («Левая» UTR) 262
5'UTR-017 («Левая» UTR) 263
5'UTR-018 («Левая» UTR) 264
142-3p 5'UTR-001 («Левая» UTR, включающая сайт связывания miR142-3p) 265
142-3p 5'UTR-002 («Левая» UTR, включающая сайт связывания miR142-3p) 266
142-3p 5'UTR-003 («Левая» UTR, включающая сайт связывания miR142-3p) 267
142-3p 5'UTR-004 («Левая» UTR, включающая сайт связывания miR142-3p) 268
142-3p 5'UTR-005 («Левая» UTR, включающая сайт связывания miR142-3p) 269
142-3p 5'UTR-006 («Левая» UTR, включающая сайт связывания miR142-3p) 270
142-3p 5'UTR-007 («Левая» UTR, включающая сайт связывания miR142-3p) 271
3'UTR включает: 3'UTR-001 (UTR Креатинкиназы) 272
3'UTR-002 (Миоглобин UTR) 273
3'UTR-003 (UTR α-актина) 274
3'UTR-004 (UTR альбумина) 275
3'UTR-005 (UTR α-глобина) 276
3'UTR-006 (UTR Г-КСФ) 277
3'UTR-007 (Col1a2; UTR коллагена типа I альфа 2) 278
3'UTR-008 (Col6a2; UTR коллагена типа VI альфа 2) 279
3'UTR-009 (RPN1; UTR рибофорина I) 280
3'UTR-010 (LRP1; UTR связанного с рецептором липопротеинов низкой плотности белка 1) 281
3'UTR-011 (Nnt1; UTR кардиотрофин-подобного цитокинового фактора 1) 282
3'UTR-012 (Col6a1; UTR коллагена типа VI альфа 1) 283
3'UTR-013 (Calr; UTR кальретикулина) 284
3'UTR-014 (Col1a1; UTR коллагена типа I альфа 1) 285
3'UTR-015 (Plod1; UTR проколлаген-лизин, 2-оксоглутарат-5-диоксигеназы 1) 286
3'UTR-016 (Nucb1; UTR нуклеобиндина 1) 287
3'UTR-017 (α-глобин) 288
3'UTR-018 289
3’ UTR с сайтом связывания miR 142-3p 290
3’ UTR с сайтом связывания miR 126-3p 291
3’ UTR с сайтами связывания miR 142-3p и miR 126-3p 292
3’ UTR с 3 сайтами связывания miR 142-3p 293
3’UTR с сайтом связывания miR 142-5p 294
3’UTR с 3 сайтами связывания miR 142-5p 295
3’UTR с 2 сайтами связывания miR 142-5p и 1 miR 142-3p сайт связывания 296
3'UTR с сайтом связывания miR 142-3p, инсерция P1 297
3'UTR с сайтом связывания miR 142-3p, инсерция P2 298
3'UTR с сайтом связывания miR 142-3p, инсерция P3 299
3’UTR с сайтом связывания miR 155-5p 300
3’ UTR с 3 сайтами связывания miR 155-5p 301
3’UTR с 2 сайтами связывания miR 155-5p и 1 сайтом связывания miR 142-3p 302

Согласно некоторым вариантам реализации последовательность 5’UTR и/или 3'UTR согласно настоящему изобретению включает последовательность нуклеотидов, по меньшей мере приблизительно на 60%, по меньшей мере приблизительно на 70%, по меньшей мере приблизительно на 80%, по меньшей мере приблизительно на 90%, по меньшей мере приблизительно на 95%, по меньшей мере приблизительно на 96%, по меньшей мере приблизительно на 97%, по меньшей мере приблизительно на 98%, по меньшей мере приблизительно на 99% или приблизительно на 100% идентичную последовательности, выбранной из группы, состоящей из последовательностей 5'UTR, содержащих любую из SEQ ID NO: 247-271, и/или последовательностей 3'UTR, содержащих любую из SEQ ID NO: 272-302, и любой их комбинации.

Полинуклеотиды согласно настоящему изобретению могут содержать комбинации признаков. Например, ORF может быть фланкирована 5′UTR, которая содержит сильный сигнал инициации трансляции Козак, и/или 3′UTR, содержащей олиго(dT)- последовательность, для матричного добавления концевого поли-A-фрагмента. 5′UTR может содержать первый полинуклеотидный фрагмент и второй полинуклеотидный фрагмент из одной и/или разных UTR (см., например, US 2010/0293625, включенную в настоящий документ полностью посредством ссылки).

В объем настоящего изобретения также входят представленные в виде паттернов UTR. В настоящем документе «представленные в виде паттернов UTR’’ включают повторяющийся или чередующийся паттерн, такой как ABABAB или AABBAABBAABB или ABCABCABC, или их варианты, повторяющиеся один раз, два раза или более 3 раз. В указанных паттернах каждому из символов A, B, или C соответствуют разные последовательности нуклеиновых кислот UTR.

Другие, не являющиеся UTR последовательности могут применяться в качестве областей или подобластей в полинуклеотидах согласно настоящему изобретению. Например, в полинуклеотиды согласно настоящему изобретению могут быть включены интроны или части последовательностей интронов. Включение интронных последовательностей может увеличивать продуцирование белка, а также уровни экспрессии полинуклеотида. Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению включает участок внутренней посадки рибосомы (IRES) вместо UTR или наряду с UTR (см., например, источник: Yakubov et al., Biochem. Biophys. Res. Commun. 2010 394(1):189-193, содержание которого включено в настоящий документ полностью посредством ссылки). Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению включает 5′- и/или 3′- последовательность, ассоциированную с 5′- и/или 3′-концами геномной РНК вируса краснухи (RV), соответственно, или их делетированные производные, в том числе 5′-проксимальная открытая рамка считывания РНК RV, кодирующая неструктурные белки (например, см. источник: Pogue et al., J. Virol. 67(12):7106-7117, содержание которого включено в настоящий документ полностью посредством ссылки). Последовательности вирусных капсидов могут также применяться в качестве энхансеров трансляции, например, 5′-часть капсидной последовательности (например, РНК капсида вируса леса Семлики и вируса Синдбис, согласно описанию в источниках: Sjöberg et al., Biotechnology (NY) 1994 12(11):1127-1131, и Frolov and Schlesinger J. Virol. 1996 70(2):1182-1190, содержание каждого из которых включено в настоящий документ полностью посредством ссылки). Согласно некоторым вариантам реализации указанный полинуклеотид содержит IRES вместо последовательности 5’UTR. Согласно некоторым вариантам реализации указанный полинуклеотид содержит ORF и последовательность вирусного капсида. Согласно некоторым вариантам реализации указанный полинуклеотид содержит синтетическую 5'UTR в комбинации с несинтетической 3'UTR.

Согласно некоторым вариантам реализации UTR может также включать по меньшей мере один трансляционный энхансерный полинуклеотид, трансляционный энхансерный элемент или трансляционные энхансерные элементы (в совокупности, «ТЭЭ»), представляющие собой последовательности нуклеиновых кислот, которые повышают количество полипептида или белка, продуцируемого полинуклеотидом. Согласно неограничивающему примеру ТЭЭ могут включать ТЭЭ, описанные в US2009/0226470, включенном в настоящий документ полностью посредством ссылки, и другие, известные в данной области техники. Согласно неограничивающему примеру ТЭЭ может быть локализован между транскрипционным промотором и стартовым кодоном. Согласно некоторым вариантам реализации указанная 5’UTR содержит ТЭЭ.

Согласно одному аспекту ТЭЭ представляет собой консервативный элемент UTR, который может способствовать трансляционной активности нуклеиновой кислоты, например, не ограничиваясь перечисленным, кэп-зависимой или кэп-независимой трансляции. Было показано, что указанные последовательности консервативны у 14 видов, включая человека. См., например, источник: Panek et al., "An evolutionary conserved pattern of 18S rRNA sequence complementarity to mRNA 5′UTRs and its implications for eukaryotic gene translation regulation," Nucleic Acids Research 2013, doi:10.1093/nar/gkt548, включенный в настоящий документ полностью посредством ссылки.

Согласно одному неограничивающему примеру ТЭЭ включает последовательность ТЭЭ в лидерной 5′-последовательности белка гомеодомена Gtx. См. источник: Chappell et al., PNAS 2004 101:9590-9594, включенный в настоящий документ полностью посредством ссылки.

Согласно другому неограничивающему примеру ТЭЭ включает ТЭЭ, содержащий одну или более из последовательностей SEQ ID NO: 1-35 из US 2009/0226470, US 2013/0177581 и WO 2009/075886; SEQ ID NO: 1-5 и 7-645 из WO 2012/009644; и SEQ ID NO: 1 WO 1999/024595, US 6310197 и US 6849405; содержание каждого из которых включено в настоящий документ полностью посредством ссылки.

Согласно некоторым вариантам реализации указанный ТЭЭ представляет собой участок внутренней посадки рибосомы (IRES), HCV-IRES или элемент IRES, такой как, не ограничиваясь перечисленным, описанные в источниках: US7468275, US2007/0048776, US2011/0124100, WO2007/025008, и WO2001/055369; содержание каждого из которых включены в настоящий документ полностью посредством ссылки. Элементы IRES может включать, не ограничиваясь перечисленным, последовательности Gtx (например, Gtx9-nt, Gtx8-nt, Gtx7-nt) согласно описанию в источниках: Chappell et al., PNAS 2004 101:9590-9594, Zhou et al., PNAS 2005 102:6273-6278, US2007/0048776, US2011/0124100 и WO2007/025008; содержание каждого из которых включено в настоящий документ полностью посредством ссылки.

Термины «трансляционный энхансерный полинуклеотид» или «последовательность трансляционного энхансерного полинуклеотида» относятся к полинуклеотиду, который включает один или более из ТЭЭ, предложенных согласно настоящему изобретению и/или известных в данной области техники (см., например, источники: US 6310197, US 6849405, US 7456273, US 7183395, US 2009/0226470, US 2007/0048776, US 2011/0124100, US 2009/0093049, US 2013/0177581, WO 2009/075886, WO 2007/025008, WO 2012/009644, WO 2001/055371, WO1999/024595, EP2610341A1 и EP2610340A1; содержание каждого из которых включено в настоящий документ полностью посредством ссылки), или их варианты, гомологи или функциональные производные. Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению включает одну или несколько копий ТЭЭ. ТЭЭ в трансляционном энхансерном полинуклеотиде может быть организован в виде одного или более сегментов последовательности. Сегмент последовательности может нести один или более из ТЭЭ, предложенных согласно настоящему изобретению, при этом каждый ТЭЭ присутствует в одной или более копиях. Если в трансляционном энхансерном полинуклеотиде присутствуют несколько сегментов последовательности, они могут быть гомогенными или гетерогенными. Соответственно, указанные несколько сегментов последовательности в трансляционном энхансерном полинуклеотиде могут нести ТЭЭ согласно настоящему изобретению идентичного или разных типов, одинаковое или разное число копий каждого из указанных ТЭЭ и/или организованные одинаковым или различным образом ТЭЭ в составе каждого сегмента последовательности. Согласно одному варианту реализации полинуклеотид согласно настоящему изобретению включает трансляционную энхансерную последовательность полинуклеотидов.

Согласно некоторым вариантам реализации 5'UTR и/или 3'UTR полинуклеотида согласно настоящему изобретению включает по меньшей мере один ТЭЭ или его часть, описанные в источниках: WO 1999/024595, WO 2012/009644, WO 2009/075886, WO 2007/025008, WO 1999/024595, WO 2001/055371, EP 2610341A1, EP 2610340A1, US 6310197, US 6849405, US 7456273, US 7183395, US 2009/0226470, US 2011/0124100, US 2007/0048776, US 2009/0093049 или US 2013/0177581, содержание которых включено в настоящий документ полностью посредством ссылки.

Согласно некоторым вариантам реализации 5'UTR и/или 3'UTR полинуклеотида согласно настоящему изобретению включает ТЭЭ, по меньшей мере на 5%, по меньшей мере на 10%, по меньшей мере на 15%, по меньшей мере на 20%, по меньшей мере на 25%, по меньшей мере на 30%, по меньшей мере на 35%, по меньшей мере на 40%, по меньшей мере на 45%, по меньшей мере на 50%, по меньшей мере на 55%, по меньшей мере на 60%, по меньшей мере на 65%, по меньшей мере на 70%, по меньшей мере на 75%, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95%, по меньшей мере на 96%, по меньшей мере на 97%, по меньшей мере на 98%, по меньшей мере на 99% или на 100% идентичный ТЭЭ, описанному в источниках: US 2009/0226470, US 2007/0048776, US 2013/0177581, US 2011/0124100, WO 1999/024595, WO 2012/009644, WO 2009/075886, WO 2007/025008, EP 2610341A1, EP 2610340A1, US 6310197, US 6849405, US 7456273, US 7183395, Chappell et al., PNAS 2004 101:9590-9594, Zhou et al., PNAS 2005 102:6273-6278, в дополнительной таблице 1 и дополнительной таблице 2 из публикации: Wellensiek et al., "Genome-wide profiling of human cap-independent translation-enhancing elements," Nature Methods 2013, DOI:10.1038/NMETH.2522; содержание каждого из которых включено в настоящий документ полностью посредством ссылки.

Согласно некоторым вариантам реализации 5'UTR и/или 3'UTR полинуклеотида согласно настоящему изобретению включает ТЭЭ, который выбран из фрагмента длиной 5-30 нуклеотидов, фрагмента длиной 5-25 нуклеотидов, фрагмента длиной 5-20 нуклеотидов, фрагмента длиной 5-15 нуклеотидов или фрагмента длиной 5-10 нуклеотидов (в том числе фрагмента из 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 или 30 нуклеотидов) последовательности ТЭЭ, описанной в источниках: US2009/0226470, US2007/0048776, US2013/0177581, US2011/0124100, WO1999/024595, WO2012/009644, WO2009/075886, WO2007/025008, EP2610341A1, EP2610340A1, US6310197, US6849405, US7456273, US7183395, Chappell et al., PNAS 2004 101:9590-9594, Zhou et al., PNAS 2005 102:6273-6278, в дополнительной таблице 1 и дополнительной таблице 2 из публикации Wellensiek et al., "Genome-wide profiling of human cap-independent translation-enhancing elements," Nature Methods 2013, DOI:10.1038/NMETH.2522.

Согласно некоторым вариантам реализации 5'UTR и/или 3'UTR полинуклеотида согласно настоящему изобретению включает ТЭЭ, который представляет собой транскрипционный регуляторный элемент, описанный в любом из источников: US7456273, US7183395, US2009/0093049 и WO2001/055371, содержание каждого из которых включено в настоящий документ полностью посредством ссылки. Указанные транскрипционные регуляторные элементы могут быть идентифицированы с применением способов, известных в данной области техники, таких как способы, описанные в US7456273, US7183395, US2009/0093049 и WO2001/055371, однако не ограничиваясь ими.

Согласно некоторым вариантам реализации 5′UTR и/или 3'UTR, содержащая по меньшей мере один ТЭЭ, описанный в настоящем документе, может быть включена в моноцистронную последовательность, такую как, однако не ограничиваясь перечисленными, векторная система или нуклеиновокислотный вектор. В неограничивающих примерах векторные системы и нуклеиновокислотные векторы могут включать описанные в US7456273, US7183395, US2007/0048776, US2009/0093049, US2011/0124100, WO2007/025008 и WO2001/055371.

Согласно некоторым вариантам реализации 5′UTR и/или 3′UTR полинуклеотида согласно настоящему изобретению включает ТЭЭ или его часть, описанные в настоящем документе. Согласно некоторым вариантам реализации ТЭЭ в 3′UTR могут быть такими же, что ТЭЭ, локализованные в 5′UTR, и/или отличаются от них.

Согласно некоторым вариантам реализации 5'UTR и/или 3'UTR полинуклеотида согласно настоящему изобретению может включать по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18 по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 30, по меньшей мере 35, по меньшей мере 40, по меньшей мере 45, по меньшей мере 50, по меньшей мере 55 или более чем 60 последовательностей ТЭЭ. Согласно одному варианту реализации 5′UTR полинуклеотида согласно настоящему изобретению может включать 1-60, 1-55, 1-50, 1-45, 1-40, 1-35, 1-30, 1-25, 1-20, 1-15, 1-10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 последовательность ТЭЭ. Последовательности ТЭЭ в 5′UTR полинуклеотида согласно настоящему изобретению могут быть представлены одинаковыми или разными последовательностями ТЭЭ. Комбинация разных последовательностей ТЭЭ в 5′UTR полинуклеотида согласно настоящему изобретению может включать комбинации, в которые включено более одной копии любых разных последовательностей ТЭЭ. Последовательности ТЭЭ могут соответствовать паттерну, такому как ABABAB, или AABBAABBAABB, или ABCABCABC, или их вариантам, повторяющемуся один, два, три или более трех раз. В указанных паттернах каждым из символов A, B или C обозначены разные последовательности нуклеотидов ТЭЭ.

Согласно некоторым вариантам реализации указанная 5′UTR и/или 3'UTR содержит спейсер для разделения двух последовательностей ТЭЭ. Согласно неограничивающему примеру указанный спейсер может представлять собой спейсер из 15 нуклеотидов и/или другие спейсеры, известные в данной области техники. Согласно другому неограничивающему примеру указанная 5′UTR и/или 3'UTR содержит модуль из последовательности ТЭЭ/спейсера, повторяющийся по меньшей мере один раз, по меньшей мере два раза, по меньшей мере 3 раза, по меньшей мере 4 раза, по меньшей мере 5 раз, по меньшей мере 6 раз, по меньшей мере 7 раз, по меньшей мере 8 раз, по меньшей мере 9 раз, по меньшей мере 10 раз, или более чем 10 раз в 5′UTR и/или 3'UTR, соответственно. Согласно некоторым вариантам реализации указанный 5′UTR и/или 3'UTR содержит модуль из последовательности ТЭЭ/спейсера, повторяющийся 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 раз.

Согласно некоторым вариантам реализации спейсер, разделяющий две последовательности ТЭЭ, может включать другие последовательности, известные в данной области техники, который могут регулировать трансляцию полинуклеотида согласно настоящему изобретению, например, последовательности miR, описанные в настоящем документе (например, сайты связывания miR и затравки miR). Согласно неограничивающему примеру каждый спейсер, используемый для разделения двух последовательностей ТЭЭ, может включать другую последовательность miR или компонент последовательности miR (например, затравочную последовательность miR).

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению включает последовательность miR и/или ТЭЭ. Согласно некоторым вариантам реализации включение последовательности miR и/или последовательности ТЭЭ в полинуклеотид согласно настоящему изобретению может изменять форму области петли-на-стебле, что может повышать и/или понижать трансляцию. См., например, источник: Kedde et al., Nature Cell Biology 2010 12(10):1014-20, включенный в настоящий документ полностью посредством ссылки).

Сайты связывания микроРНК (миРНК)

Полинуклеотиды согласно настоящему изобретению могут включать регуляторные элементы, например, сайты связывания микроРНК (миРНК), сайты связывания транскрипционных факторов, структурированные последовательности и/или мотивы мРНК, искусственные сайты связывания, сконструированные так, чтобы действовать как псевдорецепторы эндогенных связывающих нуклеиновые кислоты молекул; и их комбинации. Согласно некоторым вариантам реализации полинуклеотиды, включающие такие регуляторные элементы, называют включающими «сенсорные последовательности». Неограничивающие примеры сенсорных последовательностей описаны в публикации США 2014/0200261, содержание которой включены в настоящий документ полностью посредством ссылки.

Согласно некоторым вариантам реализации полинуклеотид (например, рибонуклеиновая кислота (РНК), например, матричная РНК (мРНК)) согласно настоящему изобретению содержит открытую рамку считывания (ORF), кодирующую представляющий интерес полипептид, и дополнительно содержит один или более сайтов связывания миРНК. Включение или встраивание сайта или сайтов связывания миРНК обеспечивает регуляцию полинуклеотидов согласно настоящему изобретению и, в свою очередь, кодируемых ими полипептидов, основанную на тканеспецифической и/или специфической для типа клеток экспрессии встречающихся в природе миРНК.

миРНК, например, встречающаяся в природе миРНК, представляет собой некодирующую РНК длиной 19-25, которая связывается с полинуклеотидом и отрицательно регулирует генную экспрессию либо путем уменьшения стабильности, либо путем ингибирования трансляции указанного полинуклеотида. Последовательность миРНК содержит область «затравки», т.е. последовательность в области положений 2-8 зрелой миРНК. миРНК-затравка может содержать положения 2-8 или 2-7 зрелой миРНК. Согласно некоторым вариантам реализации миРНК-затравка может содержать 7 нуклеотидов (например, нуклеотидов 2-8 зрелой миРНК), при этом сайт, комплементарный указанной затравке в соответствующем сайте связывания миРНК, фланкирован аденозином (A) напротив положения 1 миРНК. Согласно некоторым вариантам реализации миРНК-затравка может содержать 6 нуклеотидов (например, нуклеотиды 2-7 зрелой миРНК), при этом сайт, комплементарный указанной затравке в соответствующем сайте связывания миРНК, фланкирован аденозином (A) напротив положения 1 миРНК. См., например, Grimson A, Farh KK, Johnston WK, Garrett-Engele P, Lim LP, Bartel DP; Mol Cell. 2007 Jul 6;27(1):91-105. Профилирование миРНК целевых клеток или тканей может быть проведено для определения присутствия или отсутствия миРНК в указанных клетках или тканях. Согласно некоторым вариантам реализации полинуклеотид (например, рибонуклеиновая кислота (РНК), например, матричная РНК (мРНК)) согласно настоящему изобретению включает один или более сайтов связывания микроРНК, целевых последовательностей микроРНК, комплементарных микроРНК последовательностей или комплементарных микроРНК-затравке последовательностей. Такие последовательности могут соответствовать, например, быть комплементарны любой известной микроРНК, например, таким микроРНК, как описанные в публикациях США US2005/0261218 и US2005/0059005, содержание каждой из которых включено в настоящий документ полностью посредством ссылки.

В настоящем документе термин «сайт связывания микроРНК (миРНК, или miR)» относится к последовательности в составе полинуклеотида, например, в составе ДНК- или в составе РНК-транскрипта, в том числе в 5′UTR и/или 3′UTR, которая характеризуется достаточной комплементарностью всей последовательности или области последовательности миРНК, чтобы взаимодействовать с указанной миРНК, быть ассоциированной или связываться с указанной миРНК. Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению содержит ORF, кодирующий представляющий интерес полипептид, и дополнительно содержит один или более сайтов связывания миРНК. Согласно примерам вариантов реализации 5'UTR и/или 3'UTR полинуклеотида (например, рибонуклеиновой кислоты (РНК), например, матричной РНК (мРНК)) содержит один или более сайтов связывания миРНК.

Сайт связывания миРНК, обладающий достаточной комплементарностью миРНК, соответствует такому сайту со степенью комплементарности, достаточной для облегчения опосредованной миРНК регуляцией полинуклеотида, например, опосредованной миРНК репрессией трансляции или разложением указанного полинуклеотида. В примерах аспектов настоящего изобретения сайт связывания миРНК с достаточной комплементарностью миРНК имеет степень комплементарности, достаточную для облегчения опосредованного миРНК разложения полинуклеотида, например, опосредованного направляемым миРНК РНК-индуцированным комплексом сайленсинга (RISC) расщепления мРНК. Сайт связывания миРНК может иметь комплементарность, например, последовательности миРНК размером 19-25 нуклеотидов, последовательности миРНК размером 19-23 нуклеотида или последовательности миРНК размером 22 нуклеотида. Сайт связывания миРНК может быть комплементарен только части миРНК, например, части размером менее 1, 2, 3 или 4 нуклеотидов полноразмерной встречающейся в природе последовательности миРНК. Полная или совершенная комплементарность (например, полная комплементарность или совершенная комплементарность всей миРНК или значимой части встречающейся в природе миРНК) предпочтительна в тех случаях, когда требуемая регуляция представляет собой разложение мРНК.

Согласно некоторым вариантам реализации сайт связывания миРНК включает последовательность, которая характеризуется комплементарностью (например, частичной или полной комплементарностью) затравочной последовательности миРНК. Согласно некоторым вариантам реализации указанный сайт связывания миРНК включает последовательность, которая характеризуется полной комплементарностью затравочной последовательности миРНК. Согласно некоторым вариантам реализации сайт связывания миРНК включает последовательность, которая характеризуется комплементарностью (например, частичной или полной комплементарностью) последовательности миРНК. Согласно некоторым вариантам реализации указанный сайт связывания миРНК включает последовательность, которая характеризуется полной комплементарностью последовательности миРНК. Согласно некоторым вариантам реализации сайт связывания миРНК характеризуется полной комплементарностью последовательности миРНК, но с 1, 2 или 3 заменами нуклеотидов, концевыми добавлениями и/или усечениями.

Согласно некоторым вариантам реализации указанный сайт связывания миРНК имеет такую же длину, что и соответствующая миРНК. Согласно другим вариантам реализации указанный сайт связывания миРНК на один, два, три, четыре, пять, шесть, семь, восемь, девять, десять, одиннадцать или двенадцать нуклеотидов короче соответствующей миРНК с 5'-конца, 3'-конца, или с обоих концов. Согласно другим вариантам реализации сайт связывания микроРНК на два нуклеотида короче соответствующей микроРНК с 5'-конца, 3'-конца, или с обоих концов. Сайты связывания миРНК, более короткие, чем соответствующие миРНК, тем не менее, способны к разложению мРНК, в которую входят один или более сайтов связывания миРНК, или предотвращению трансляции указанной мРНК.

Согласно некоторым вариантам реализации указанный сайт связывания миРНК связывает соответствующую зрелую миРНК, которая входит в активный RISC, содержащий Dicer. Согласно другому варианту реализации связывание сайта связывания миРНК с соответствующим миРНК в RISC обеспечивает разложение мРНК, содержащей указанный сайт связывания миРНК, или предотвращает трансляцию указанной мРНК. Согласно некоторым вариантам реализации указанный сайт связывания миРНК характеризуется достаточной комплементарностью миРНК, так что комплекс RISC, содержащий указанную миРНК, расщепляет полинуклеотид, содержащий указанный сайт связывания миРНК. Согласно другим вариантам реализации указанный сайт связывания миРНК характеризуется неполной комплементарностью, так что комплекс RISC, содержащие указанную миРНК, индуцирует нестабильность в полинуклеотиде, содержащем указанный сайт связывания миРНК. Согласно другому варианту реализации указанный сайт связывания миРНК характеризуется неполной комплементарностью, так что комплекс RISC, содержащий указанную миРНК репрессирует транскрипцию полинуклеотида, содержащего указанный сайт связывания миРНК.

Согласно некоторым вариантам реализации указанный сайт связывания миРНК содержит одно, два, три, четыре, пять, шесть, семь, восемь, девять, десять, одиннадцать или двенадцать несовпадений комплементарности соответствующей миРНК.

Согласно некоторым вариантам реализации указанный сайт связывания миРНК содержит по меньшей мере приблизительно десять, по меньшей мере приблизительно одиннадцать, по меньшей мере приблизительно двенадцать, по меньшей мере приблизительно тринадцать, по меньшей мере приблизительно четырнадцать, по меньшей мере приблизительно пятнадцать, по меньшей мере приблизительно шестнадцать, по меньшей мере приблизительно семнадцать, по меньшей мере приблизительно восемнадцать, по меньшей мере приблизительно девятнадцать, по меньшей мере приблизительно двадцать или по меньшей мере приблизительно двадцать один непрерывный нуклеотид, комплементарные по меньшей мере приблизительно десяти, по меньшей мере приблизительно одиннадцати, по меньшей мере приблизительно двенадцати, по меньшей мере приблизительно тринадцати, по меньшей мере приблизительно четырнадцати, по меньшей мере приблизительно пятнадцати, по меньшей мере приблизительно шестнадцати, по меньшей мере приблизительно семнадцати, по меньшей мере приблизительно восемнадцати, по меньшей мере приблизительно девятнадцати, по меньшей мере приблизительно двадцати или по меньшей мере приблизительно двадцати одному, соответственно, непрерывным нуклеотидам соответствующей миРНК.

Конструирование одного или более сайтов связывания миРНК в полинуклеотиде согласно настоящему изобретению может обеспечивать нацеливание на указанный полинуклеотид для разложения или снижения трансляции, при условии, что доступна рассматриваемая миРНК. Указанное встраивание может уменьшать нецелевые эффекты при доставке указанного полинуклеотида. Например, если полинуклеотид согласно настоящему изобретению не предназначен для доставки в ткань или клетку, но в конечном итоге попадает в указанную ткань или клетку, миРНК, присутствующая в значительном количестве в указанной ткани или клетке, может ингибировать экспрессию представляющего интерес гена, если в 5′UTR и/или 3′UTR указанного полинуклеотида сконструированы один или несколько сайтов связывания миРНК.

И напротив, сайты связывания миРНК могут быть удалены из последовательностей полинуклеотидов, в которых они встречаются в естественных условиях, для повышения экспрессии белков в специфических тканях. Например, сайт связывания специфической миРНК может быть удален из полинуклеотида для улучшения экспрессии белков в тканях или клетках, содержащих указанную миРНК.

Согласно одному варианту реализации полинуклеотид согласно настоящему изобретению может включать по меньшей мере один сайт связывания миРНК в 5'UTR и/или 3′UTR для регуляции цитотоксических или цитопротекторных мРНК терапевтических средств в специфических клетках, таких как, не ограничиваясь перечисленными, нормальные и/или раковые клетки. Согласно другому варианту реализации полинуклеотид согласно настоящему изобретению может включать два, три, четыре, пять, шесть, семь, восемь, девять, десять, или более сайтов связывания миРНК в 5'-UTR и/или 3′-UTR для регуляции цитотоксических или цитопротекторных терапевтических мРНК-средств в специфических клетках, таких как, не ограничиваясь перечисленными, нормальные и/или раковые клетки.

Регуляция экспрессии в нескольких тканях может осуществляться путем введения или удаления одного или более сайтов связывания миРНК, например, одного или более отдельных сайтов связывания миРНК. Решение об удалении или инсерции сайта связывания миРНК может быть принято на основании паттернов экспрессии миРНК и/или их профилирования в тканях и/или клетках при их развитии и/или заболевании. Были описаны идентификация миРНК, сайтов связывания миРНК, паттернов их экспрессии и роли в биологии (например, см. источники: Bonauer et al., Curr Drug Targets 2010 11:943-949; Anand and Cheresh Curr Opin Hematol 2011 18:171-176; Contreras and Rao Leukemia 2012 26:404-413 (2011 Dec 20. doi: 10.1038/leu.2011.356); Bartel Cell 2009 136:215-233; Landgraf et al, Cell, 2007 129:1401-1414; Gentner and Naldini, Tissue Antigens. 2012 80:393-403 со всеми приведенными в них ссылками, каждый из которых включен в настоящий документ полностью посредством ссылки).

миРНК и сайты связывания миРНК могут соответствовать любой известной последовательности, в том числе неограничивающим примерам, описанным в публикациях США 2014/0200261, 2005/0261218 и 2005/0059005, каждая из которых включена в настоящий документ полностью посредством ссылки.

Примеры тканей, где миРНК, как известно, регулируют мРНК и, таким образом, экспрессию белков, включают, не ограничиваясь перечисленными, печень (miR-122), мышцы (miR-133, miR-206, miR-208), эндотелиальные клетки (miR-17-92, miR-126), миелоидные клетки (miR-142-3p, miR-142-5p, miR-16, miR-21, miR-223, miR-24, miR-27), жировая ткань (let-7, miR-30c), сердце (miR-1d, miR-149), почки (miR-192, miR-194, miR-204) и клетки легочного эпителия (let-7, miR-133, miR-126).

В частности, миРНК, как известно, дифференциально экспрессируются в иммунных клетках (также называемых гематопоэтическими клетками), такими как антигенпрезентирующие клетки (АПК) (например, дендритные клетки и макрофаги), макрофаги, моноциты, B-лимфоциты, T-лимфоциты, гранулоциты, естественные киллерные клетки и т.п. Специфические для иммунных клеток миРНК вовлечены в иммуногенность, аутоиммунитет, иммунный ответ на инфекцию, воспаление, а также нежелательный иммунный ответ после генной терапии и трансплантации тканей/органов. Специфические для иммунных клеток миРНК также регулируют многие аспекты развития, пролиферации, дифференцировки и апоптоза гематопоэтических клеток (иммунных клеток). Например, miR-142 и miR-146 экспрессируются исключительно в иммунных клетках, в частности, в большом количестве присутствуют в миелоидных дендритных клетках. Было продемонстрировано, что иммунный ответ на полинуклеотид может быть отключен путем добавления сайтов связывания miR-142 в 3′-UTR полинуклеотида, с обеспечением стабильного переноса генов в тканях и клетках. miR-142 обеспечивает эффективное разложение экзогенных полинуклеотидов в антигенпрезентирующих клетках и подавление цитотоксической элиминации трансдуцированных клеток (см., например, источники: Annoni A et al., Blood, 2009, 114, 5152-5161; Brown BD, et al., Nat med. 2006, 12(5), 585-591; Brown BD, et al., Blood, 2007, 110(13): 4144-4152, каждый из которых включен в настоящий документ полностью посредством ссылки).

Антиген-опосредованный иммунный ответ может относиться к иммунному ответу, запускаемому чужеродными антигенами, которые, попадая в организм, процессируют антигенпрезентирующие клетки и экспонируют на своей поверхности. T-клетки способны распознавать презентированный антиген и индуцировать цитотоксическую элиминацию клеток, которые экспрессируют указанный антиген.

Введение сайта связывания miR-142 в 5'UTR и/или 3′UTR полинуклеотида согласно настоящему изобретению может селективно репрессировать генную экспрессию в антигенпрезентирующих клетках за счет опосредованного miR-142 разложения, ограничивая презентацию антигена в антигенпрезентирующих клетках (например, дендритные клетки) и предотвращая таким образом антиген-опосредованный иммунный ответ после доставки указанного полинуклеотида. Затем указанный полинуклеотид стабильно экспрессируется в целевых тканях или клетках без запуска цитотоксической элиминации.

Согласно одному варианту реализации сайты связывания миРНК, которые, как известно, экспрессируются в иммунных клетках, в частности, антигенпрезентирующих клетках, могут быть сконструированы в полинуклеотиде согласно настоящему изобретению для подавления экспрессии указанного полинуклеотида в антигенпрезентирующих клетках за счет опосредованного миРНК разложения РНК, ослабляющего антиген-опосредованный иммунный ответ. Экспрессия полинуклеотида поддерживается в неиммунных клетках, где специфические для иммунных клеток миРНК не экспрессируются. Например, согласно некоторым вариантам реализации для предотвращения иммуногенной реакции против специфического для печени белка любой сайт связывания miR-122 может быть удален, а сайт связывания miR-142 (и/или mirR-146) может быть сконструирован в 5'UTR и/или 3'UTR полинуклеотида согласно настоящему изобретению.

Согласно одному варианту реализации сайты связывания миРНК, которые, как известно, экспрессируются в клетках печени, могут быть сконструированы в полинуклеотиде согласно настоящему изобретению для подавления экспрессии указанного полинуклеотида в печени. Например, согласно некоторым вариантам реализации для предотвращения экспрессии антигена в печени может быть сконструирован любой специфический для печени сайт связывания miR в 5'UTR и/или 3'UTR полинуклеотида согласно настоящему изобретению.

Для дополнительного управления избирательным разложением и супрессией в АПК и макрофагах полинуклеотид согласно настоящему изобретению может включать дополнительный элемент отрицательной регуляции в 5'UTR и/или 3'UTR, по отдельности или в комбинации с сайтами связывания miR-142 и/или miR-146. Согласно неограничивающему примеру указанный дополнительный элемент отрицательной регуляции представляет собой конститутивный элемент распада (CDE).

Специфические для иммунных клеток миРНК включают, не ограничиваясь перечисленными, hsa-let-7a-2-3p, hsa-let-7a-3p, hsa-7a-5p, hsa-let-7c, hsa-let-7e-3p, hsa-let-7e-5p, hsa-let-7g-3p, hsa-let-7g-5p, hsa-let-7i-3p, hsa-let-7i-5p, miR-10a-3p, miR-10a-5p, miR-1184, hsa-let-7f-1--3p, hsa-let-7f-2--5p, hsa-let-7f-5p, miR-125b-1-3p, miR-125b-2-3p, miR-125b-5p, miR-1279, miR-130a-3p, miR-130a-5p, miR-132-3p, miR-132-5p, miR-142-3p, miR-142-5p, miR-143-3p, miR-143-5p, miR-146a-3p, miR-146a-5p, miR-146b-3p, miR-146b-5p, miR-147a, miR-147b, miR-148a-5p, miR-148a-3p, miR-150-3p, miR-150-5p, miR-151b, miR-155-3p, miR-155-5p, miR-15a-3p, miR-15a-5p, miR-15b-5p, miR-15b-3p, miR-16-1-3p, miR-16-2-3p, miR-16-5p, miR-17-5p, miR-181a-3p, miR-181a-5p, miR-181a-2-3p, miR-182-3p, miR-182-5p, miR-197-3p, miR-197-5p, miR-21-5p, miR-21-3p, miR-214-3p, miR-214-5p, miR-223-3p, miR-223-5p, miR-221-3p, miR-221-5p, miR-23b-3p, miR-23b-5p, miR-24-1-5p, miR-24-2-5p, miR-24-3p, miR-26a-1-3p, miR-26a-2-3p, miR-26a-5p, miR-26b-3p, miR-26b-5p, miR-27a-3p, miR-27a-5p, miR-27b-3p, miR-27b-5p, miR-28-3p, miR-28-5p, miR-2909, miR-29a-3p, miR-29a-5p, miR-29b-1-5p, miR-29b-2-5p, miR-29c-3p, miR-29c-5p, miR-30e-3p, miR-30e-5p, miR-331-5p, miR-339-3p, miR-339-5p, miR-345-3p, miR-345-5p, miR-346, miR-34a-3p, miR-34a-5p, miR-363-3p, miR-363-5p, miR-372, miR-377-3p, miR-377-5p, miR-493-3p, miR-493-5p, miR-542, miR-548b-5p, miR548c-5p, miR-548i, miR-548j, miR-548n, miR-574-3p, miR-598, miR-718, miR-935, miR-99a-3p, miR-99a-5p, miR-99b-3p и miR-99b-5p. Кроме того, новые миРНК могут быть идентифицированы в иммунной клетке с применением гибридизации на микрочипах и микротомного анализа (см., например, источники: Jima DD et al, Blood, 2010, 116:e118-e127; Vaz C et al., BMC Genomics, 2010, 11,288, содержание каждого из которых включено в настоящий документ полностью посредством ссылки).

миРНК, которые, как известно, экспрессируются в печени, включают, не ограничиваясь перечисленными, miR-107, miR-122-3p, miR-122-5p, miR-1228-3p, miR-1228-5p, miR-1249, miR-129-5p, miR-1303, miR-151a-3p, miR-151a-5p, miR-152, miR-194-3p, miR-194-5p, miR-199a-3p, miR-199a-5p, miR-199b-3p, miR-199b-5p, miR-296-5p, miR-557, miR-581, miR-939-3p и miR-939-5p. Сайты связывания миРНК из любой специфической для печени миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в печени. Специфические для печени сайты связывания миРНК могут быть введены отдельно или, дополнительно, в комбинации с сайтами связывания миРНК иммунной клетки (например, АПК) в сконструированный полинуклеотид согласно настоящему изобретению.

миРНК, которые, как известно, экспрессируются в легких, включают, не ограничиваясь перечисленными, let-7a-2-3p, let-7a-3p, let-7a-5p, miR-126-3p, miR-126-5p, miR-127-3p, miR-127-5p, miR-130a-3p, miR-130a-5p, miR-130b-3p, miR-130b-5p, miR-133a, miR-133b, miR-134, miR-18a-3p, miR-18a-5p, miR-18b-3p, miR-18b-5p, miR-24-1-5p, miR-24-2-5p, miR-24-3p, miR-296-3p, miR-296-5p, miR-32-3p, miR-337-3p, miR-337-5p, miR-381-3p и miR-381-5p. Сайты связывания миРНК из любой специфической для легких миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в легких. Специфические для легких сайты связывания миРНК могут быть введены отдельно или, дополнительно, в комбинации с сайтами связывания миРНК иммунной клетки (например, АПК) в сконструированный полинуклеотид согласно настоящему изобретению.

миРНК, которые, как известно, экспрессируются в сердце, включают, не ограничиваясь перечисленными, miR-1, miR-133a, miR-133b, miR-149-3p, miR-149-5p, miR-186-3p, miR-186-5p, miR-208a, miR-208b, miR-210, miR-296-3p, miR-320, miR-451a, miR-451b, miR-499a-3p, miR-499a-5p, miR-499b-3p, miR-499b-5p, miR-744-3p, miR-744-5p, miR-92b-3p и miR-92b-5p. Сайты связывания миРНК из любой специфической для сердца микроРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в сердце. Специфические для сердца сайты связывания миРНК могут быть введены отдельно или, дополнительно, в комбинации с сайтами связывания миРНК иммунной клетки (например, АПК) в сконструированный полинуклеотид согласно настоящему изобретению.

миРНК, которые, как известно, экспрессируются в нервной системе включают, не ограничиваясь перечисленными, miR-124-5p, miR-125a-3p, miR-125a-5p, miR-125b-1-3p, miR-125b-2-3p, miR-125b-5p, miR-1271-3p, miR-1271-5p, miR-128, miR-132-5p, miR-135a-3p, miR-135a-5p, miR-135b-3p, miR-135b-5p, miR-137, miR-139-5p, miR-139-3p, miR-149-3p, miR-149-5p, miR-153, miR-181c-3p, miR-181c-5p, miR-183-3p, miR-183-5p, miR-190a, miR-190b, miR-212-3p, miR-212-5p, miR-219-1-3p, miR-219-2-3p, miR-23a-3p, miR-23a-5p, miR-30a-5p, miR-30b-3p, miR-30b-5p, miR-30c-1-3p, miR-30c-2-3p, miR-30c-5p, miR-30d-3p, miR-30d-5p, miR-329, miR-342-3p, miR-3665, miR-3666, miR-380-3p, miR-380-5p, miR-383, miR-410, miR-425-3p, miR-425-5p, miR-454-3p, miR-454-5p, miR-483, miR-510, miR-516a-3p, miR-548b-5p, miR-548c-5p, miR-571, miR-7-1-3p, miR-7-2-3p, miR-7-5p, miR-802, miR-922, miR-9-3p и miR-9-5p. миРНК, которые в значительном количестве содержатся в нервной системе, дополнительно включают миРНК, специфически экспрессирующиеся в нейронах, в том числе, но не ограничиваясь перечисленными, miR-132-3p, miR-132-3p, miR-148b-3p, miR-148b-5p, miR-151a-3p, miR-151a-5p, miR-212-3p, miR-212-5p, miR-320b, miR-320e, miR-323a-3p, miR-323a-5p, miR-324-5p, miR-325, miR-326, miR-328, miR-922; и миРНК, специфически экспрессирующиеся в глиальных клетках, в том числе, но не ограничиваясь перечисленными, miR-1250, miR-219-1-3p, miR-219-2-3p, miR-219-5p, miR-23a-3p, miR-23a-5p, miR-3065-3p, miR-3065-5p, miR-30e-3p, miR-30e-5p, miR-32-5p, miR-338-5p и miR-657. Сайты связывания миРНК из любой специфической для ЦНС миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в нервной системе. Специфические для нервной системы сайты связывания миРНК могут быть введены отдельно или, дополнительно, в комбинации с сайтами связывания миРНК иммунной клетки (например, АПК) в сконструированный полинуклеотид согласно настоящему изобретению.

миРНК, которые, как известно, экспрессируются в поджелудочной железе, включают, не ограничиваясь перечисленными, miR-105-3p, miR-105-5p, miR-184, miR-195-3p, miR-195-5p, miR-196a-3p, miR-196a-5p, miR-214-3p, miR-214-5p, miR-216a-3p, miR-216a-5p, miR-30a-3p, miR-33a-3p, miR-33a-5p, miR-375, miR-7-1-3p, miR-7-2-3p, miR-493-3p, miR-493-5p и miR-944. Сайты связывания миРНК из любой специфической для поджелудочной железы миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в поджелудочной железе. Специфические для поджелудочной железы сайты связывания миРНК быть введены отдельно или, дополнительно, в комбинации с сайтами связывания миРНК иммунной клетки (например, АПК) в сконструированный полинуклеотид согласно настоящему изобретению.

миРНК, которые, как известно, экспрессируются в почках, включают, не ограничиваясь перечисленными, miR-122-3p, miR-145-5p, miR-17-5p, miR-192-3p, miR-192-5p, miR-194-3p, miR-194-5p, miR-20a-3p, miR-20a-5p, miR-204-3p, miR-204-5p, miR-210, miR-216a-3p, miR-216a-5p, miR-296-3p, miR-30a-3p, miR-30a-5p, miR-30b-3p, miR-30b-5p, miR-30c-1-3p, miR-30c-2-3p, miR30c-5p, miR-324-3p, miR-335-3p, miR-335-5p, miR-363-3p, miR-363-5p и miR-562. Сайты связывания миРНК из любой специфической для почек миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в почках. Специфические для почек сайты связывания миРНК могут быть введены отдельно или, дополнительно, в комбинации с сайтами связывания миРНК иммунной клетки (например, АПК) в сконструированный полинуклеотид согласно настоящему изобретению.

миРНК, которые, как известно, экспрессируются в мышцах, включают, не ограничиваясь перечисленными, let-7g-3p, let-7g-5p, miR-1, miR-1286, miR-133a, miR-133b, miR-140-3p, miR-143-3p, miR-143-5p, miR-145-3p, miR-145-5p, miR-188-3p, miR-188-5p, miR-206, miR-208a, miR-208b, miR-25-3p и miR-25-5p. Сайты связывания миРНК из любой специфической для мышц миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в мышцах. Специфические для мышц сайты связывания миРНК могут быть введены отдельно или, дополнительно, в комбинации с сайтами связывания миРНК иммунной клетки (например, АПК) в сконструированный полинуклеотид согласно настоящему изобретению.

миРНК также дифференциально экспрессируются в разных типах клеток, например, однако не ограничиваясь перечисленным, эндотелиальных клетках, эпителиальных клетках и адипоцитах.

миРНК, которые, как известно, экспрессируются в эндотелиальных клетках, включают, не ограничиваясь перечисленными, let-7b-3p, let-7b-5p, miR-100-3p, miR-100-5p, miR-101-3p, miR-101-5p, miR-126-3p, miR-126-5p, miR-1236-3p, miR-1236-5p, miR-130a-3p, miR-130a-5p, miR-17-5p, miR-17-3p, miR-18a-3p, miR-18a-5p, miR-19a-3p, miR-19a-5p, miR-19b-1-5p, miR-19b-2-5p, miR-19b-3p, miR-20a-3p, miR-20a-5p, miR-217, miR-210, miR-21-3p, miR-21-5p, miR-221-3p, miR-221-5p, miR-222-3p, miR-222-5p, miR-23a-3p, miR-23a-5p, miR-296-5p, miR-361-3p, miR-361-5p, miR-421, miR-424-3p, miR-424-5p, miR-513a-5p, miR-92a-1-5p, miR-92a-2-5p, miR-92a-3p, miR-92b-3p и miR-92b-5p. Многие новые миРНК были обнаружены в эндотелиальных клетках с помощью анализа методом глубокого секвенирования (см., например, Voellenkle C et al., RNA, 2012, 18, 472-484, включенный в настоящий документ полностью посредством ссылки). Сайты связывания миРНК из любой специфической для эндотелиальных клеток миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в эндотелиальных клетках.

миРНК, которые, как известно, экспрессируются в эпителиальных клетках, включают, не ограничиваясь перечисленными, let-7b-3p, let-7b-5p, miR-1246, miR-200a-3p, miR-200a-5p, miR-200b-3p, miR-200b-5p, miR-200c-3p, miR-200c-5p, miR-338-3p, miR-429, miR-451a, miR-451b, miR-494, miR-802 и miR-34a, miR-34b-5p, miR-34c-5p, miR-449a, miR-449b-3p, miR-449b-5p, специфические для клеток респираторного реснитчатого эпителия, семейство let-7, miR-133a, miR-133b, miR-126, специфические для клеток эпителия легких, miR-382-3p, miR-382-5p, специфические для клеток эпителия почек, и miR-762, специфические для эпителиальных клеток роговицы. Сайты связывания миРНК из любой специфической для эпителиальных клеток миРНК могут быть введены в полинуклеотид или удалены из полинуклеотида согласно настоящему изобретению для регуляции экспрессии указанного полинуклеотида в эпителиальных клетках.

Кроме того, большая группа миРНК присутствует в большом количестве в эмбриональных стволовых клетках, контролируя самообновление стволовых клеток, а также развитие и/или дифференцировку различных линий клеток, таких как нервные клетки, сердечные, гематопоэтические клетки, клетки кожи, остеогенные клетки и мышечные клетки (см., например, источники: Kuppusamy KT et al., Curr. Mol Med, 2013, 13(5), 757-764; Vidigal JA and Ventura A, Semin Cancer Biol. 2012, 22(5-6), 428-436; Goff LA et al., PLoS One, 2009, 4:e7192; Morin RD et al., Genome Res,2008,18, 610-621; Yoo JK et al., Stem Cells Dev. 2012, 21(11), 2049-2057, каждый из которых включен в настоящий документ полностью посредством ссылки). миРНК, присутствующие в большом количестве в эмбриональных стволовых клетках, включают, не ограничиваясь перечисленными, let-7a-2-3p, let-a-3p, let-7a-5p, let7d-3p, let-7d-5p, miR-103a-2-3p, miR-103a-5p, miR-106b-3p, miR-106b-5p, miR-1246, miR-1275, miR-138-1-3p, miR-138-2-3p, miR-138-5p, miR-154-3p, miR-154-5p, miR-200c-3p, miR-200c-5p, miR-290, miR-301a-3p, miR-301a-5p, miR-302a-3p, miR-302a-5p, miR-302b-3p, miR-302b-5p, miR-302c-3p, miR-302c-5p, miR-302d-3p, miR-302d-5p, miR-302e, miR-367-3p, miR-367-5p, miR-369-3p, miR-369-5p, miR-370, miR-371, miR-373, miR-380-5p, miR-423-3p, miR-423-5p, miR-486-5p, miR-520c-3p, miR-548e, miR-548f, miR-548g-3p, miR-548g-5p, miR-548i, miR-548k, miR-548l, miR-548m, miR-548n, miR-548o-3p, miR-548o-5p, miR-548p, miR-664a-3p, miR-664a-5p, miR-664b-3p, miR-664b-5p, miR-766-3p, miR-766-5p, miR-885-3p, miR-885-5p, miR-93-3p, miR-93-5p, miR-941,miR-96-3p, miR-96-5p, miR-99b-3p и miR-99b-5p. Многие предсказанные новые миРНК были обнаружены с помощью глубокого секвенирования в эмбриональных стволовых клетках человека (см., например, источники: Morin RD et al., Genome Res, 2008,18, 610-621; Goff LA et al., PLoS One, 2009, 4:e7192; Bar M et al., Stem cells, 2008, 26, 2496-2505, содержание каждого из которых включено в настоящий документ полностью посредством ссылки).

Многие исследования экспрессии миРНК проводятся для профилирования дифференциальной экспрессии миРНК в различных раковых клетках/тканях и при других заболеваниях. Некоторые миРНК аномальным образом сверхэкспрессируются в определенных раковых клетках, а другие недоэкспрессируются. Например, миРНК дифференциально экспрессируются в раковых клетках (WO2008/154098, US2013/0059015, US2013/0042333, WO2011/157294); раковых стволовых клетках (US2012/0053224); при раке и заболеваниях в поджелудочной железе (US2009/0131348, US2011/0171646, US2010/0286232, US8389210); при астме и воспалении (US8415096); в раке предстательной железы (US2013/0053264); в гепатоцеллюлярной карциноме (WO2012/151212, US2012/0329672, WO2008/054828, US8252538); в клетках рака легкого (WO2011/076143, WO2013/033640, WO2009/070653, US2010/0323357); в кожной T-клеточной лимфоме (WO2013/011378); в клетках рака ободочной и прямой кишки (WO2011/0281756, WO2011/076142); лимфатических узлах с положительным раковым статусом (WO2009/100430, US2009/0263803); в носоглоточной карциноме (EP2112235); при хронической обструктивной болезни легких (US2012/0264626, US2013/0053263); раке щитовидной железы (WO2013/066678); в клетках рака яичников ( US2012/0309645, WO2011/095623); в клетках рака молочной железы (WO2008/154098, WO2007/081740, US2012/0214699), лейкозе и лимфоме (WO2008/073915, US2009/0092974, US2012/0316081, US2012/0283310, WO2010/018563, содержание каждой из которых включено в настоящий документ полностью посредством ссылки).

Согласно неограничивающему примеру сайты связывания миРНК для миРНК, которые сверхэкспрессируются в определенных раковых и/или опухолевых клетках, могут быть удалены из 3'UTR полинуклеотида согласно настоящему изобретению, с восстановлением экспрессии, репрессированной указанными сверхэкспрессируемыми миРНК в раковых клетках, что улучшает соответствующую биологическую функцию, например, стимуляцию и/или репрессию транскрипция, остановку клеточного цикла, апоптоз и клеточную смерть. На нормальные клетки и ткани, где не происходит положительная регуляция экспрессии миРНК, указанное действие не распространяется.

миРНК могут также регулировать сложные биологические процессы, такие как ангиогенез (например, miR-132) (Anand and Cheresh Curr Opin Hematol 2011 18:171-176). В полинуклеотидах согласно настоящему изобретению сайты связывания миРНК, которые вовлечены в такие процессы, могут быть удалены или введены для настройки экспрессии указанных полинуклеотидов в биологически релевантных типах клеток или при релевантных биологических процессах. В указанном контексте полинуклеотиды согласно настоящему изобретению определены как ауксотрофные полинуклеотиды.

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению включает сайт связывания миРНК, который содержит одну или более последовательностей нуклеотидов, выбранных из таблицы 1 или описанных в любых разделах настоящего документа, в том числе одну или более копий любого одного или более из сайтов связывания последовательностей миРНК. Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению дополнительно содержит по меньшей мере один, два, три, четыре, пять, шесть, семь, восемь, девять, десять или более одинаковых или разных сайтов связывания миРНК, выбранных из таблицы 1 или описанных в других разделах в настоящем документе, в том числе любую их комбинацию. Согласно некоторым вариантам реализации сайт связывания миРНК связывается с miR-142 или комплементарен miR-142. Согласно некоторым вариантам реализации miR-142 содержит SEQ ID NO: 303. Согласно некоторым вариантам реализации указанный сайт связывания миРНК связывается с miR-142-3p или miR-142-5p. Согласно некоторым вариантам реализации сайт связывания miR-142-3p содержит SEQ ID NO: 305. Согласно некоторым вариантам реализации сайт связывания miR-142-5p содержит SEQ ID NO: 307. Согласно некоторым вариантам реализации указанный сайт связывания миРНК содержит последовательность нуклеотидов, по меньшей мере на 80%, по меньшей мере на 85%, по меньшей мере на 90%, по меньшей мере на 95% или на 100% идентичную последовательностям SEQ ID NO: 305 или 307.

ТАБЛИЦА 1. miR-142 и альтернативные сайты связывания miR-142

SEQ ID NO. Описание Последовательность
303 miR-142 GACAGUGCAGUCACCCAUAAAGUAGAAAGCACUACUA
ACAGCACUGGAGGGUGUAGUGUUUCCUACUUUAUGGA
UGAGUGUACUGUG
304 miR-142-3p uguaguguuuccuacuuuaugga
305 Сайт связывания miR-142-3p uccauaaaguaggaaacacuaca
306 miR-142-5p cauaaaguagaaagcacuacu
307 Сайт связывания miR-142-5p aguagugcuuucuacuuuaug

Согласно некоторым вариантам реализации сайт связывания миРНК инсертируют в полинуклеотид согласно настоящему изобретению в любое положение указанного полинуклеотида (например, 5'UTR и/или 3'UTR). Согласно некоторым вариантам реализации 5'UTR содержит сайт связывания миРНК. Согласно некоторым вариантам реализации 3'UTR содержит сайт связывания миРНК. Согласно некоторым вариантам реализации 5'UTR и 3'UTR содержат сайт связывания миРНК. Сайт инсерции в полинуклеотиде может располагаться где угодно, при условии, что инсерция сайта связывания миРНК в полинуклеотиде не влияет на трансляцию функционального полипептида в отсутствие соответствующей миРНК; а в присутствии указанной миРНК инсерция сайта связывания миРНК в полинуклеотид и связывание указанного сайта связывания миРНК с соответствующей миРНК способны обеспечивать разложение указанного полинуклеотида или предотвращать трансляцию указанного полинуклеотида.

Согласно некоторым вариантам реализации сайт связывания миРНК инсертируют на расстоянии по меньшей мере приблизительно 30 нуклеотидов в 3’-направлении от стоп-кодона ORF в полинуклеотиде согласно настоящему изобретению, содержащем указанную ORF. Согласно некоторым вариантам реализации сайт связывания миРНК инсертируют на расстоянии по меньшей мере приблизительно 10 нуклеотидов, по меньшей мере приблизительно 15 нуклеотидов, по меньшей мере приблизительно 20 нуклеотидов, по меньшей мере приблизительно 25 нуклеотидов, по меньшей мере приблизительно 30 нуклеотидов, по меньшей мере приблизительно 35 нуклеотидов, по меньшей мере приблизительно 40 нуклеотидов, по меньшей мере приблизительно 45 нуклеотидов, по меньшей мере приблизительно 50 нуклеотидов, по меньшей мере приблизительно 55 нуклеотидов, по меньшей мере приблизительно 60 нуклеотидов, по меньшей мере приблизительно 65 нуклеотидов, по меньшей мере приблизительно 70 нуклеотидов, по меньшей мере приблизительно 75 нуклеотидов, по меньшей мере приблизительно 80 нуклеотидов, по меньшей мере приблизительно 85 нуклеотидов, по меньшей мере приблизительно 90 нуклеотидов, по меньшей мере приблизительно 95 нуклеотидов или по меньшей мере приблизительно 100 нуклеотидов в 3’-направлении от стоп-кодона ORF в полинуклеотиде согласно настоящему изобретению. Согласно некоторым вариантам реализации сайт связывания миРНК инсертируют на расстоянии от приблизительно 10 нуклеотидов до приблизительно 100 нуклеотидов, от приблизительно 20 нуклеотидов до приблизительно 90 нуклеотидов, от приблизительно 30 нуклеотидов до приблизительно 80 нуклеотидов, от приблизительно 40 нуклеотидов до приблизительно 70 нуклеотидов, от приблизительно 50 нуклеотидов до приблизительно 60 нуклеотидов, от приблизительно 45 нуклеотидов до приблизительно 65 нуклеотидов в 3’-направлении от стоп-кодона ORF в полинуклеотиде согласно настоящему изобретению.

На регуляцию генов с помощью миРНК может влиять последовательность, окружающая указанную миРНК, например, но не ограничиваясь указанным, вид окружающей последовательности, тип последовательности (например, гетерологичная, гомологичная, экзогенная, эндогенная или искусственная), регуляторные элементы в окружающей последовательности и/или структурные элементы окружающей последовательности. На миРНК может влиять 5′UTR и/или 3′UTR. Согласно неограничивающему примеру полученная не от человека 3′UTR может увеличивать регуляторный эффект последовательности миРНК на экспрессию представляющего интерес полипептида по сравнению с 3′UTR человека того же типа последовательности.

Согласно одному варианту реализации другие регуляторные элементы и/или структурные элементы 5′UTR могут влиять на опосредованную миРНК генную регуляцию. Один пример регуляторного элемента и/или структурного элемента представлен структурированным IRES (участком внутренней посадки рибосомы) в 5′UTR, который необходим для связывания факторов удлинения при трансляции для инициации трансляции белков. Связывание EIF4A2 с указанным вторично структурированным элементом в 5′-UTR необходимо для опосредованной миРНК генной экспрессии (Meijer HA et al., Science, 2013, 340, 82-85, включенный в настоящий документ полностью посредством ссылки). Полинуклеотиды согласно настоящему изобретению могут также включать указанный структурированный 5′UTR для улучшения опосредованной микроРНК регуляция генов.

По меньшей мере один сайт связывания миРНК может быть сконструирован в 3′UTR полинуклеотида согласно настоящему изобретению. В указанном контексте по меньшей мере два, по меньшей мере три, по меньшей мере четыре, по меньшей мере пять, по меньшей мере шесть, по меньшей мере семь, по меньшей мере восемь, по меньшей мере девять, по меньшей мере десять или более сайтов связывания миРНК могут быть сконструированы в 3′UTR полинуклеотида согласно настоящему изобретению. Например, 1-10 сайтов, 1-9, 1-8, 1-7, 1-6, 1-5, 1-4, 1-3, 2 сайта или 1 сайт связывания миРНК могут быть сконструированы в 3′UTR полинуклеотида согласно настоящему изобретению. Согласно одному варианту реализации сайты связывания миРНК, встроенные в полинуклеотид согласно настоящему изобретению, могут быть одинаковыми или могут быть разными сайтами миРНК. Комбинация разных сайтов связывания миРНК, встроенных в полинуклеотид согласно настоящему изобретению, может включать комбинации, в которые включено более одной копии любых из указанных разных сайтов миРНК. Согласно другому варианту реализации сайты связывания миРНК, встроенные в полинуклеотид согласно настоящему изобретению, могут быть нацелены на одну и ту же или на разные ткани в организме. Согласно неограничивающему примеру за счет введения тканеспецифических, специфических для типа клеток или заболевания сайтов связывания миРНК в 3′-UTR полинуклеотида согласно настоящему изобретению может быть снижена степень экспрессии в клетках специфических типов (например, гепатоцитах, миелоидных клетках, эндотелиальных клетках, раковых клетках и т.п.).

Согласно одному варианту реализации сайт связывания миРНК может быть сконструирован возле 5′-конца 3′UTR, приблизительно посередине между 5′-концом и 3′-концом 3′UTR и/или возле 3′-конца 3′UTR в полинуклеотиде согласно настоящему изобретению. Согласно неограничивающему примеру сайт связывания миРНК может быть сконструирован возле 5′-конца 3′UTR и приблизительно посередине между 5′-концом и 3′-концом 3′UTR. Согласно другому неограничивающему примеру сайт связывания миРНК может быть сконструирован возле 3′-конца 3′UTR и приблизительно посередине между 5′-концом и 3′-концом 3′UTR. Согласно еще одному неограничивающему примеру сайт связывания миРНК может быть сконструирован возле 5′-конца 3′UTR и возле 3′-конца 3′UTR.

Согласно другому варианту реализации 3′UTR может содержать 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 сайтов связывания миРНК. Указанные сайты связывания миРНК могут быть комплементарны миРНК, затравочной последовательности миРНК и/или последовательностям миРНК, фланкирующим указанную затравочную последовательность.

Согласно одному варианту реализации полинуклеотид согласно настоящему изобретению может быть сконструирован таким образом, чтобы включать более одного сайта миРНК, экспрессируемых в разных тканях или разных типах клеток субъекта. Согласно неограничивающему примеру полинуклеотид согласно настоящему изобретению может быть сконструирован таким образом, чтобы включать miR-192 и miR-122 для регуляции экспрессии указанного полинуклеотида в печени и почках субъекта. Согласно другому варианту реализации полинуклеотид согласно настоящему изобретению может быть сконструирован таким образом, чтобы включать более чем один сайт миРНК для одной и той же ткани.

Согласно некоторым вариантам реализации терапевтическое окно и или дифференциальная экспрессия, ассоциированные с полипептидом, кодируемым полинуклеотидом согласно настоящему изобретению, могут быть изменены с помощью сайта связывания миРНК. Например, полинуклеотид, кодирующий полипептид, который обеспечивает сигнал клеточной смерти, может быть разработан таким образом, чтобы экспрессироваться на более высоком уровне в раковых клетках за счет миРНК-сигнатуры указанных клеток. Если раковая клетка экспрессирует конкретную миРНК на более низком уровне, полинуклеотид, кодирующий сайт связывания указанной (или указанных) миРНК, будет экспрессироваться на более высоком уровне. Соответственно, полипептид, который обеспечивает сигнал клеточной смерти, запускает или индуцирует клеточную смерть в раковой клетке. На соседние нераковые клетки, отличающиеся более высокой экспрессией той же миРНК, указанный кодируемый сигнал клеточной смерти будет оказывать меньшее влияние, поскольку указанный полинуклеотид будет экспрессироваться на более низком уровне из-за эффектов связывания указанной миРНК с сайтом связывания или «сенсором», закодированным в 3′UTR. И напротив, сигналы выживания клеток, или цитопротекторные сигналы могут быть доставлен в ткани, содержащие раковые и нераковые клетки, отличающиеся тем, что миРНК экспрессируется на более высоком уровне в раковых клетках - в результате в раковую клетку поступает меньший сигнал выживания, а в нормальную клетку больший. Может быть разработано и введено несколько полинуклеотидов, обеспечивающих разные сигналы, на основе использования сайтов связывания миРНК согласно описанию в настоящем документе.

Согласно некоторым вариантам реализации экспрессию полинуклеотида согласно настоящему изобретению можно контролировать путем включения в полинуклеотид по меньшей мере одного сайта связывания miR или сенсорной последовательности, и получения состава для введения с указанным полинуклеотидом. Согласно неограничивающему примеру полинуклеотид согласно настоящему изобретению может быть нацелен на ткань или клетку путем включения сайта связывания миРНК и получения состава с указанным полинуклеотидом в липидной наночастице, содержащей ионизируемый липид (например, катионный липид), в том числе любые из липидов, описанных в настоящем документе.

Полинуклеотид согласно настоящему изобретению может быть сконструирован для более нацеленной экспрессии в специфических тканях, типах клеток или биологических состояний на основании паттернов экспрессии миРНК в разных тканях, типах клеток или биологических состояний. За счет введения сайтов связывания тканеспецифических миРНК может быть разработан полинуклеотид согласно настоящему изобретению для оптимальной экспрессии белков в ткани или клетке, или в контексте биологического состояния.

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению может быть разработан таким образом, чтобы включать сайты связывания миРНК, которые либо на 100% идентичны известным затравочным последовательностям миРНК, либо менее чем на 100% идентичны затравочным последовательностям миРНК. Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению может быть разработан таким образом, чтобы включать сайты связывания миРНК, по меньшей мере на 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, или 99% идентичные известным затравочным последовательностям миРНК. Затравочная последовательность миРНК может быть частично мутирована для уменьшения аффинности связывания миРНК и, таким образом, обеспечивать уменьшение отрицательной модуляции полинуклеотида. В сущности, степень совпадения или несовпадения между сайтом связывания миРНК и миРНК-затравкой может действовать как «реостат» для более тонкой настройки способности миРНК модулировать экспрессию белков. Кроме того, мутация в незатравочной области сайта связывания миРНК может также оказывать влияние на способность миРНК модулировать экспрессию белков.

Согласно одному варианту реализации последовательность миРНК может быть включена в петлю петли-на-стебле.

Согласно другому варианту реализации затравочная последовательность миРНК может быть включена в петлю петли-на-стебле, а сайт связывания миРНК может быть включен в 5′- или 3′-стебель указанной петли-на-стебле.

Согласно одному варианту реализации трансляционный энхансерный элемент (ТЭЭ) может быть включен на 5′-конце стебля петли-на-стебле, а миРНК-затравка может быть включена в стебель указанной петли-на-стебле. Согласно другому варианту реализации ТЭЭ может быть включен на 5′-конце стебля петли-на-стебле, миРНК-затравка может быть включена в стебель указанной петли-на-стебле, а сайт связывания миРНК может быть включен в 3′-конец стебля или последовательность после указанной петли-на-стебле. миРНК-затравка и сайт связывания миРНК могут быть предназначены для одной или и/или разных последовательностей миРНК.

Согласно одному варианту реализации включение последовательности миРНК и/или последовательности ТЭЭ изменяет форму указанной области петли-на-стебле, что может повышать и/или снижать трансляцию. (См., например, источник: Kedde et al., "A Pumilio-induced RNA structure switch in p27-3′UTR controls miR-221 and miR-22 accessibility." Nature Cell Biology. 2010, включенный в настоящий документ полностью посредством ссылки.)

Согласно одному варианту реализации 5′-UTR полинуклеотида согласно настоящему изобретению может содержать по меньшей мере одну последовательность миРНК. Указанная последовательность миРНК может представлять собой, не ограничиваясь перечисленными, последовательность длиной 19 или 22 нуклеотидов и/или последовательность миРНК без затравки.

Согласно одному варианту реализации последовательность миРНК в 5′UTR может применяться для стабилизации полинуклеотида согласно настоящему изобретению, описанного в настоящем документе.

Согласно другому варианту реализации последовательность миРНК в 5′UTR полинуклеотида согласно настоящему изобретению может применяться для уменьшения доступности сайта инициации трансляции, такого как, однако не ограничиваясь указанным, стартовый кодон. См., например, источник: Matsuda et al., PLoS One. 2010 11(5):e15057; включенный в настоящий документ полностью посредством ссылки, где описано применение олигонуклеотидов антисмысловой закрытой нуклеиновой кислоты (LNA) и комплексы сращивания экзонов (EJC) вокруг стартового кодона ((-4) - (+37), где A кодонов AUG соответствует +1) для уменьшения доступности первого стартового кодона (AUG). Matsuda показал, что изменение последовательности вокруг стартового кодона с применением LNA или EJC влияло на эффективность, длину и структурную стабильность полинуклеотида. Полинуклеотид согласно настоящему изобретению может содержать последовательность миРНК вместо последовательности LNA или EJC, описанной Matsuda с соавторами, возле сайта инициации трансляции для уменьшения доступности указанного сайта инициации трансляции. Сайт инициации трансляции может быть расположен до, после или в пределах последовательности миРНК. Согласно неограничивающему примеру указанный сайт инициации трансляции может быть локализован в составе последовательности миРНК, такой как затравочная последовательность или сайт связывания. Согласно другому неограничивающему примеру указанный сайт инициации трансляции может быть локализован в составе последовательности miR-122, такой как затравочная последовательность или сайта связывания mir-122.

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению может включать по меньшей мере одну миРНК для ослабления презентации антигена антигенпрезентирующими клетками. Указанная миРНК может представлять собой полную последовательность миРНК, затравочную последовательность миРНК, последовательность миРНК без затравки или их комбинацию. Согласно неограничивающему примеру миРНК, встроенная в полинуклеотид согласно настоящему изобретению, может быть специфической для гематопоэтической системы. Согласно другому неограничивающему примеру миРНК, встроенная в полинуклеотид согласно настоящему изобретению для ослабления презентации антигена, представляет собой miR-142-3p.

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению может включать по меньшей мере одну миРНК для ослабления экспрессии кодируемого полипептида в представляющей интерес ткани или клетке. Согласно неограничивающему примеру полинуклеотид согласно настоящему изобретению может включать по меньшей мере один сайт связывания miR-122 для ослабления экспрессии представляющего интерес кодируемого полипептида в печени. Согласно другому неограничивающему примеру полинуклеотид согласно настоящему изобретению может включать по меньшей мере один сайт связывания miR-142-3p, затравочную последовательность miR-142-3p, сайт связывания miR-142-3p без затравки, сайт связывания miR-142-5p, затравочную последовательность miR-142-5p, сайт связывания miR-142-5p без затравки, сайт связывания miR-146, затравочную последовательность miR-146 и/или сайт связывания miR-146 без затравочной последовательности.

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению могут содержать по меньшей мере один сайт связывания миРНК в 3′UTR для селективного разложения терапевтических мРНК-средств в иммунных клетках, для смягчения нежелательных иммуногенных реакций, вызываемых доставкой терапевтических средств. Согласно неограничивающему примеру указанный сайт связывания миРНК может придавать полинуклеотид согласно настоящему изобретению бо́льшую нестабильность в антигенпрезентирующих клетках. Неограничивающие примеры указанных миРНК включают mir-142-5p, mir-142-3p, mir-146a-5p и mir-146-3p.

Согласно одному варианту реализации полинуклеотид согласно настоящему изобретению включает по меньшей мере одну последовательность миРНК в области полинуклеотида, который может взаимодействовать со связывающим РНК белком.

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению (например, РНК, например, мРНК) содержит (i) оптимизированную последовательность нуклеотидов (например, ORF), кодирующую один или более эпитопов антигенов дикого типа, и (ii) сайт связывания миРНК (например, сайт связывания миРНК, который связывается с miR-142).

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению включает урацил-модифицированную последовательность, кодирующую один или более полипептидов раковых эпитопов согласно описанию в настоящем документе, и сайт связывания миРНК согласно описанию в настоящем документе, например, сайт связывания миРНК, который связывается с miR-142. Согласно некоторым вариантам реализации указанная урацил-модифицированная последовательность, кодирующая один или более полипептидов раковых эпитопов, содержит по меньшей мере одно химически модифицированное нуклеиновое основание, например, 5-метоксиурацил. Согласно некоторым вариантам реализации по меньшей мере 95% некоторого типа нуклеинового основания (например, урацила) в урацил-модифицированной последовательности, кодирующей один или более полипептидов раковых эпитопов согласно настоящему изобретению, представлено модифицированными нуклеиновыми основаниями. Согласно некоторым вариантам реализации по меньшей мере 95% урацила в урацил-модифицированной последовательности, кодирующей один или более полипептидов раковых эпитопов, представлено 5-метоксиуридином. Согласно некоторым вариантам реализации указанный полинуклеотид, содержащий последовательность нуклеотидов, кодирующую один или более полипептидов раковых эпитопов согласно описанию в настоящем документе, и сайт связывания миРНК введены в состав с агентом для доставки, например, ЛНЧ, содержащей, например, липид формулы (I), (IA), (II), (IIa), (IIb), (IIc), (IId) или (IIe), например, любые из соединений 1-232.

3′ UTR и богатые AU элементы

Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую эпитоп ракового антигена согласно настоящему изобретению) дополнительно содержит 3' UTR. Согласно некоторым вариантам реализации полинуклеотид согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую пептид активирующей мутации онкогена согласно настоящему изобретению) дополнительно содержит 3' UTR.

3'-UTR представляет собой участок мРНК, следующий непосредственно за кодоном терминации транскрипции, и часто содержит регуляторные области, оказывающие посттранскрипционное влияние на генную экспрессию. Регуляторные области в составе 3'-UTR могут влиять на полиаденилирование, эффективность трансляцию, локализацию и стабильность мРНК. Согласно одному варианту реализации 3'-UTR, подходящая для применения согласно настоящему изобретению, включает сайт связывания регуляторных белков или микроРНК. Согласно некоторым вариантам реализации указанная 3'-UTR содержит сайленсерную область, которая связывается с репрессорными белками и ингибирует экспрессию мРНК. Согласно другим вариантам реализации указанная 3'-UTR содержит богатый AU элемент. Белки связывают элементы ARE, что оказывает влияние на стабильность или скорость распада транскриптов локальным образом или оказывает влияние на инициацию трансляции. Согласно другим вариантам реализации указанная 3'-UTR содержит последовательность AAUAAA, направляющую добавление нескольких сотен остатков аденина, называемых концевым поли(A)-фрагментом, к концу мРНК-транскрипта.

В природных 3′ UTR, или 3′ UTR дикого типа, как известно, заключены отрезки из остатков аденозина и уридина. Указанные богатые AU сигнатуры, в частности, распространены в генах с высокими показателями оборота. На основании особенностей их последовательностей и функциональных свойств богатые AU элементы (ARE) могут быть разделены на три класса (Chen et al, 1995): ARE класса I содержат несколько рассредоточенных копий мотива AUUUA в пределах богатых U областей. C-Myc и MyoD включают ARE класса I. ARE класса II содержат два или более перекрывающихся нонамера UUAUUUA(U/A)(U/A). Молекулы, содержащие ARE указанного типа, включают ГМ-КСФ и ФНО-a. ARE класса III менее четко определены. Указанные богатые U области не содержат мотива AUUUA. c-Jun и миогенин представляют собой два хорошо изученных примера из указанного класса. Известно, что большинство белков, связывающихся с ARE, дестабилизируют мРНК, однако представители семейства ELAV, прежде всего HuR, как было документально подтверждено, повышают стабильность мРНК. HuR связывается с ARE всех трех классов. Конструирование сайтов специфического связывания HuR в 3′ UTR молекул нуклеиновых кислот приводит к связыванию HuR и, соответственно, стабилизации мРНК in vivo.

Введение, удаление или модификация богатых AU элементов 3′ UTR (ARE) может быть использовано для модуляции стабильности полинуклеотидов согласно настоящему изобретению. При конструировании специфических полинуклеотидов могут быть введены одна или более копий ARE для получения менее стабильных полинуклеотидов согласно настоящему изобретению, с сокращением таким образом трансляции и снижением продуцирования итогового белка. Сходным образом, ARE могут быть идентифицированы и удалены или мутированы для увеличения внутриклеточной стабильности и, соответственно, увеличения трансляции и продуцирования итогового белка. Эксперименты с трансфекцией могут быть проведены в релевантных линиях клеток с применением полинуклеотидов согласно настоящему изобретению, и продуцирование белка может быть проанализировано в различные точки времени после трансфекции. Например, клетки могут быть трансфицированы разными сконструированными молекулами с ARE и с применением набора для ИФА ELISA для релевантного белка проведен анализ на продуцированный белок через 6 часов, 12 часов, 24 часа, 48 часов и 7 дней после трансфекции.

Области, содержащие 5′-кэп

Настоящим изобретением также предусмотрен полинуклеотид, который содержит и 5′-кэп, и полинуклеотид согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую эпитоп ракового антигена, такой как пептид активирующей мутации онкогена).

5′-кэпирующая структура природной мРНК вовлечена в ядерный экспорт, увеличивает стабильность мРНК и связывает мРНК-кэп-связывающий белок (CBP), который отвечает за стабильность мРНК в клетке и трансляционную способность за счет образования связи CBP с связывающим поли(A) белком с образованием зрелых циклических видов мРНК. Также кэп способствует удалению 5′-проксимальных интронов во время сплайсинга мРНК.

Эндогенные молекулы мРНК могут быть кэпированы на 5′-конце с получением 5′-ppp-5′-трифосфатной связи между концевым гуанозиновым остатком кэпа и 5′-концевым транскрибируемым смысловым нуклеотидом молекулы мРНК. Указанный 5′-гуанилатный кэп может затем быть метилирован с получением N7-метил-гуанилатного остатка. Рибозные сахара концевых и/или предшествующих концевым транскрибируемых нуклеотидов 5′-конца мРНК могут необязательно также быть 2′-O-метилированными. Удаление 5′-кэпа путем гидролиза и расщепление гуанилатной кэпирующей структуры может обеспечивать нацеливание на молекулу нуклеиновой кислоты, такую как молекула мРНК, для разложения.

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую эпитоп ракового антигена) содержат кэпирующий фрагмент.

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую эпитоп ракового антигена, такой как пептид активирующей мутации онкогена) содержат негидролизуемую кэпирующую структуру, предотвращающую удаление кэпа и, соответственно, увеличивающую время полужизни мРНК. Поскольку гидролиз кэпирующих структур требует расщепления 5′-ppp-5′-фосфодиэфирных связей, при реакции кэпирования могут применяться модифицированные нуклеотиды. Например, для создания фосфотиоатной связи в 5′-ppp-5′-кэпе может применяться кэпирующий фермент вируса осповакцины от New England Biolabs (Ипсвич, Массачусетс) с α-тиогуанозиновыми нуклеотидами в соответствии с инструкциями изготовителя. Могут применяться дополнительные модифицированные гуанозиновые нуклеотиды, такие как α-метилфосфонатные и селенофосфатные нуклеотиды.

Дополнительные модификации включают, не ограничиваясь перечисленным, 2′-O-метилирование рибозных сахаров 5′-концевых и/или предшествующих 5′-концевым нуклеотидов полинуклеотида (как уже упоминалось выше) на 2′-гидроксильной группе сахарного кольца. Для получения 5′-кэпа молекулы нуклеиновой кислоты, такой как полинуклеотид, который функционирует в качестве молекулы мРНК, может применяться несколько отдельных 5′-кэпирующих структур. Аналоги кэпа, которые в настоящем документе также называются синтетическими аналогами кэпа, химическими кэпами, химическими аналогами кэпа, или структурными или функциональными аналогами кэпа, отличаются от природных (т.е. эндогенных, дикого типа или физиологических) 5′-кэпов химической структурой при сохранении функции кэпа. Аналоги кэпов могут быть химически (т.е. неферментативным путем) или ферментативным путем синтезированы и/или соединены с полинуклеотидами согласно настоящему изобретению.

Например, препятствующий встраиванию в обратной ориентации аналог кэпа (ARCA-кэп) содержит два гуанина, соединенные 5′-5′-трифосфатной группой, при этом один гуанин содержит N7-метильную группу, а также 3′-O-метильную группу (т.е. N7,3′-O-диметилгуанозин-5′-трифосфат-5′-гуанозин (m7G-3′mppp-G; который может, эквивалентным образом, называться 3′ O-Me-m7G(5')ppp(5')G). Атом 3′-O другого, немодифицированного, гуанина соединяется с 5′-концевым нуклеотидом кэпированного полинуклеотида. N7- и 3′-O-метилированный гуанин обеспечивает образование концевого фрагмента кэпированного полинуклеотида.

Другим примером кэпа является mCAP, который аналогичен ARCA, но содержит 2′-O-метильную группу на гуанозине (т.е. N7,2′-O-диметилгуанозин-5′-трифосфат-5′-гуанозин, m7Gm-ppp-G).

Согласно некоторым вариантам реализации указанный кэп представляет собой динуклеотидный аналог кэпа. Согласно неограничивающему примеру указанный динуклеотидный аналог кэпа может быть модифицирован по разным фосфатным положениям боранофосфатной группой или фосфороселеноатной группой, как, например, динуклеотидные аналоги кэпа, описанные в патенте США № US 8519110, содержание которого включено в настоящий документ полностью посредством ссылки.

Согласно другому варианту реализации указанный кэп представляет собой аналог кэпа, представляющий собой N7-(4-хлорфеноксиэтил)-замещенную динуклеотидную форму аналога кэпа, известную в данной области техники и/или описанную в настоящем документе. Неограничивающие примеры N7-(4-хлорфеноксиэтил)-замещенной динуклеотидной формы аналога кэпа включают N7-(4-хлорфеноксиэтил)-G(5')ppp(5')G и аналог кэпа N7-(4-хлорфеноксиэтил)-m3'-OG(5')ppp(5')G (см., например, различные аналоги кэпа и способы синтеза аналогов кэпа, описанные в источнике: Kore et al. Bioorganic & Medicinal Chemistry 2013 21:4570-4574; содержание которого включено в настоящий документ полностью посредством ссылки). Согласно другому варианту реализации аналог кэпа согласно настоящему изобретению представляет собой 4-хлор/бромфеноксиэтиловый аналог.

Хотя аналоги кэпа обеспечивают сопутствующее кэпирование полинуклеотида или его области в реакции транскрипции in vitro, до 20% транскриптов может оставаться некэпированным. Указанный факт, а также структурные отличия аналога кэпа от эндогенных 5′-кэпирующих структур нуклеиновых кислот, продуцируемых за счет эндогенных клеточных механизмов транскрипции, может приводить к снижению трансляционной способности и клеточной стабильности.

Полинуклеотиды согласно настоящему изобретению (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующий эпитоп ракового антигена) могут также быть кэпированы после получения (либо путем IVT, либо путем химического синтеза) с применением ферментов, для получения более аутентичных 5′-кэпирующих структур. В настоящем документе выражение «более аутентичный» относится к признаку, очень сходному или имитирующему, в структурном или функциональном отношении, эндогенный признак или признак дикого типа. Таким образом, «более аутентичный» признак лучше отражает эндогенную, дикого типа, естественную или физиологическую клеточную функцию и/или структуру по сравнению с синтетическими признаками или аналогами, и т.п., известными из предшествующего уровня техники, или превосходит соответствующий эндогенный, дикого типа, природный или физиологический признак в одном или более отношениях. Неограничивающие примеры более аутентичных 5′-кэпирующих структур согласно настоящему изобретению включают структуры, отличающиеся, в том числе, улучшенным связыванием и кэп-связывающих белков, увеличенным временем полужизни, сниженной чувствительностью к 5′-эндонуклеазам и/или снижением удаления 5′-кэпа по сравнению с синтетическими 5′-кэпирующими структурами, известными в данной области техники (или с 5′-кэпирующей структурой дикого типа, естественной или физиологической 5′-кэпирующей структурой). Например, рекомбинантный кэпирующий фермент вируса осповакцины и фермент рекомбинантный 2′-O-метилтрансфераза могут формировать каноническую 5′-5′-трифосфатную связь между 5′-концевым нуклеотидом полинуклеотида и гуаниновым нуклеотидом кэпа, при этом гуанин кэпа N7-метилирован, а 5′-концевой нуклеотид мРНК содержит 2′-O-метил. Такую структуру называют структурой кэпа-1. Указанный кэп обеспечивает более высокую трансляционную способность и клеточную стабильность, и снижение активации клеточных провоспалительных цитокинов, по сравнению, например, с другими аналогами 5′-кэпирующих структур, известными в данной области техники. Кэпирующие структуры включают, не ограничиваясь перечисленными, 7mG(5')ppp(5')N, pN2p (кэп 0), 7mG(5')ppp(5')NlmpNp (кэп 1) и 7mG(5')-ppp(5')NlmpN2mp (кэп 2).

Согласно неограничивающему примеру кэпирование химерных полинуклеотидов после получения может быть более эффективным, поскольку может быть кэпировано почти 100% указанных химерных полинуклеотидов. Указанный показатель отличается от ~80% при соединении аналога кэпа с химерным полинуклеотидом в ходе реакции транскрипции in vitro.

В соответствии с настоящим изобретением 5′-концевые кэпы могут включать эндогенные кэпы или аналоги кэпов. В соответствии с настоящим изобретением 5′-концевой кэп может содержать аналог гуанина. Подходящие аналоги гуанина включают, не ограничиваясь перечисленными, инозин, N1-метилгуанозин, 2′фтор-гуанозин, 7-деазагуанозин, 8-оксогуанозин, 2-амино-гуанозин, LNA-гуанозин и 2-азидогуанозин.

Концевые поли-A-фрагменты

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему описанию (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую эпитоп ракового антигена, такой как пептид активирующей мутации онкогена) дополнительно содержат концевой поли-A-фрагмент. Согласно дополнительным вариантам реализации для стабилизации могут быть включены концевые группы на концевом поли-A-фрагменте. Согласно другим вариантам реализации концевой поли-A-фрагмент содержит дес-3'-гидроксильные концевые фрагменты.

При процессинге РНК длинная цепь адениновых нуклеотидов (концевой поли-A-фрагмент) может быть добавлена к полинуклеотиду, такому как молекула мРНК, для увеличения стабильности. Непосредственно после транскрипции 3'-конец транскрипта может быть расщеплен с высвобождением 3'-гидроксила. Затем поли-A-полимераза добавляет цепь адениновых нуклеотидов к РНК. Указанный процесс, называемый полиаденилированием, добавляет концевой поли-A-фрагмент, длина которого может составлять от, например, приблизительно 80 до приблизительно 250 остатков, в том числе приблизительно 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240 или 250 остатков.

Концевые поли-A-фрагменты могут также добавлены после экспорта указанной конструкции из ядра.

В соответствии с настоящим изобретением для стабилизации могут быть включены концевые группы на концевом поли-A-фрагменте. Полинуклеотиды согласно настоящему изобретению могут включать дес-3'-гидроксильные концевые фрагменты. Они могут также включать структурные фрагменты или 2'-O-метильные модификаций согласно описанию Junjie Li с соавторами (в источнике: Junjie Li, et al. Current Biology, Vol. 15, 1501-1507, August 23, 2005, содержание которого включено в настоящий документ полностью посредством ссылки).

Полинуклеотиды согласно настоящему изобретению могут быть разработаны таким образом, чтобы кодировать транскрипты с альтернативными структурами концевых поли-A-фрагментов, в том числе гистонной мРНК. Согласно Norbury, «также было детектировано терминальное уридилирование зависимых от репликации гистонных мРНК человека. Предполагается, что оборот указанных мРНК важен для предотвращения накопления потенциально токсичного гистона после завершения или ингибирования хромосомной репликации ДНК. Указанные мРНК отличаются отсутствием 3ʹ-концевого поли(A)-фрагмента, функцию которого принимает на себя стабильная структура типа «петля на стебле» и ее когнатный связывающий белок типа «петля на стебле» (SLBP); последний выполняет те же функции, что и PABP в полиаденилированных мРНК» (источник: Norbury, "Cytoplasmic RNA: a case of the tail wagging the dog," Nature Reviews Molecular Cell Biology; ускоренная онлайн-публикация (AOP), публикация в сети Интернет 29 августа 2013 г.; doi:10.1038/nrm3645), содержание которого включено в настоящий документ полностью посредством ссылки.

Уникальные длины концевых поли-A-фрагментов обеспечивают определенные преимущества полинуклеотидов согласно настоящему изобретению. Обычно длина поли-A концевого фрагмента, в случае его присутствия, составляет более 30 нуклеотидов. Согласно другому варианту реализации длина концевого поли-A-фрагмента составляет более 35 нуклеотидов (например, по меньшей мере или более чем приблизительно 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2500 и 3000 нуклеотидов).

Согласно некоторым вариантам реализации указанный полинуклеотид или его область включает от приблизительно 30 до приблизительно 3000 нуклеотидов (например; от 30 до 50; от 30 до 100; от 30 до 250; от 30 до 500; от 30 до 750; от 30 до 1000; от 30 до 1500; от 30 до 2000; от 30 до 2500; от 50 до 100; от 50 до 250; от 50 до 500; от 50 до 750; от 50 до 1000; от 50 до 1500; от 50 до 2000; от 50 до 2500; от 50 до 3000; от 100 до 500; от 100 до 750; от 100 до 1000; от 100 до 1500; от 100 до 2000; от 100 до 2500; от 100 до 3000; от 500 до 750; от 500 до 1000; от 500 до 1500; от 500 до 2000; от 500 до 2500; от 500 до 3000; от 1000 до 1500; от 1000 до 2000; от 1000 до 2500; от 1000 до 3000; от 1500 до 2000; от 1500 до 2500; от 1500 до 3000; от 2000 до 3000; от 2000 до 2500; и от 2500 до 3000 нуклеотидов).

Согласно некоторым вариантам реализации концевой поли-A-фрагмент разработан с учетом длины всего полинуклеотида или длины конкретной области указанного полинуклеотида. Указанный дизайн может быть основан на длине кодирующей области, длине конкретного элемента или области, или основан на длине конечного продукта, экспрессируемого с указанных полинуклеотидов.

В указанном контексте длина концевого поли-A-фрагмента может быть на 10, 20, 30, 40, 50, 60, 70, 80, 90 или 100% больше длины полинуклеотида или его элемента. Концевой поли-A-фрагмент может также быть разработан в виде фракции полинуклеотидов, которым он принадлежит. В указанном контексте длина концевого поли-A-фрагмента может на 10, 20, 30, 40, 50, 60, 70, 80, или 90%, или более превышать общую длину конструкции, области конструкции или общую длину указанной конструкции за вычетом указанного концевого поли-A-фрагмента. Кроме того, сконструированные сайты связывания и конъюгация полинуклеотидов со связывающим поли-A-белком может усиливать экспрессию.

Кроме того, несколько отдельных полинуклеотидов могут быть соединены между собой посредством PABP (связывающий поли-A белок) через 3′-конец с помощью модифицированных нуклеотидов на 3′-конце концевого поли-A-фрагмента. Могут быть проведены эксперименты с трансфекцией на клетках релевантных линий и продуцирование белков может быть проанализировано с помощью ИФА ELISA через 12 ч, 24 ч, 48 ч, 72 ч и на 7 день после трансфекции.

Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению разработаны таким образом, чтобы включать область поли-A-G-квартета. G-квартет представляет собой циклический массив из четырех связанных водородной связью гуаниновых нуклеотидов, который может быть образован богатыми G последовательностями как ДНК, так и РНК. Согласно указанному варианту реализации G-квартет вводят в конец концевого поли-A-фрагмента. Анализируют стабильность, продуцирование белка и другие показатели, в том числе время полужизни, для полученного полинуклеотида в различные точки времени. Было обнаружено, что поли-A-G квартет приводит к продуцированию белка с мРНК, эквивалентному по меньшей мере 75% от продуцирования, наблюдаемого при применении концевого поли-A-фрагмента из 120 нуклеотидов по отдельности.

Область стартового кодона

Настоящим изобретением также предусмотрен полинуклеотид, который содержит и область стартового кодона, и полинуклеотид, описанный в настоящем документе (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую эпитоп ракового антигена, такой как пептид активирующей мутации онкогена). Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению могут содержать области, аналогичные области стартового кодона или функционирующие сходным с ними образом.

Согласно некоторым вариантам реализации инициация трансляции полинуклеотида может происходить на кодоне, который не представляет собой стартовый кодон AUG. Инициация трансляции указанного полинуклеотида может происходить на альтернативном стартовом кодоне, например, не ограничиваясь перечисленными, ACG, AGG, AAG, CTG/CUG, GTG/GUG, ATA/AUA, ATT/AUU, TTG/UUG (см. источники: Touriol et al. Biology of the Cell 95 (2003) 169-178$ и Matsuda and Mauro PLoS ONE, 2010 5:11; содержание каждого из которых включено в настоящий документ полностью посредством ссылки).

Согласно неограничивающему примеру трансляция полинуклеотида начинается на альтернативном стартовом кодоне ACG. Согласно другому неограничивающему примеру трансляция полинуклеотида начинается на альтернативном стартовом кодоне CTG или CUG. Согласно еще одному неограничивающему примеру трансляция полинуклеотида начинается на альтернативном стартовом кодоне GTG или GUG.

Нуклеотиды, фланкирующие кодон, который инициирует трансляцию, такой как, не ограничиваясь перечисленными, стартовый кодон или альтернативный стартовый кодон, как известно, влияют на эффективность трансляции, длину и/или структуру полинуклеотида. (См., например, источник: Matsuda and Mauro PLoS ONE, 2010 5:11; содержание которого включено в настоящий документ полностью посредством ссылки). Для изменения положения инициации трансляции, эффективности трансляция, длины и/или структуры полинуклеотида может применяться маскировка любого из нуклеотидов, фланкирующих кодон, который инициирует трансляцию.

Согласно некоторым вариантам реализации может применяться маскирующий агент возле стартового кодона или альтернативного стартового кодона с целью маскировки или скрытия указанного кодона для снижения вероятности инициации трансляции в маскированном стартовом кодоне или альтернативном стартовом кодоне. Неограничивающие примеры маскирующих агентов включают антисмысловые полинуклеотиды закрытых нуклеиновых кислот (LNA) и комплексы сращивания экзонов (EJC) (см., например, описание маскирующих агентов из LNA-полинуклеотидов и EJC у Matsuda и Mauro (источник: PLoS ONE, 2010 5:11, содержание которого включено в настоящий документ полностью посредством ссылки).

Согласно другому варианту реализации маскирующий агент может применяться с целью маскировки стартового кодона полинуклеотида для увеличения вероятности инициации трансляции на альтернативном стартовом кодоне. Согласно некоторым вариантам реализации маскирующий агент может применяться с целью маскировки первого стартового кодона или альтернативного стартового кодона для увеличения вероятности инициации трансляции на стартовом кодоне или альтернативном стартовом кодоне в 3’-направлении от маскированного стартового кодона или альтернативного стартового кодона.

Согласно некоторым вариантам реализации стартовый кодон или альтернативный стартовый кодон может быть локализован в идеально комплементарной сайту связывания miR последовательности. Указанная идеально комплементарная сайту связывания miR последовательность может способствовать контролю трансляции, длины и/или структуры полинуклеотида, аналогично маскирующему агенту. Согласно неограничивающему примеру стартовый кодон или альтернативный стартовый кодон может быть локализован в середине идеально комплементарной сайту связывания миРНК последовательности. Указанный стартовый кодон или альтернативный стартовый кодон может быть локализован после первого нуклеотида, второго нуклеотида, третьего нуклеотида, четвертого нуклеотида, пятого нуклеотида, шестого нуклеотида, седьмого нуклеотида, восьмого нуклеотида, девятого нуклеотида, десятого нуклеотида, одиннадцатого нуклеотида, двенадцатого нуклеотида, тринадцатого нуклеотида, четырнадцатого нуклеотида, пятнадцатого нуклеотида, шестнадцатого нуклеотида, семнадцатого нуклеотида, восемнадцатого нуклеотида, девятнадцатого нуклеотида, двадцатого нуклеотида или двадцать первого нуклеотида.

Согласно другому варианту реализации стартовый кодон полинуклеотида может быть удален из последовательности полинуклеотидов, чтобы обеспечить начало трансляции указанного полинуклеотида на кодоне, который не представляет собой стартовый кодон. Трансляция указанного полинуклеотида может начинаться на кодоне, следующем за удаленным стартовым кодоном или на расположенном в 3'-направлении стартовом кодоне или альтернативном стартовом кодоне. Согласно неограничивающему примеру стартовый кодон ATG или AUG удаляют в качестве первых 3 нуклеотидов последовательности полинуклеотидов, чтобы инициация трансляции происходила на расположенном в 3'-направлении стартовом кодоне или альтернативном стартовом кодоне. Последовательность полинуклеотидов, из которой был удален стартовый кодон, может дополнительно содержать по меньшей мере один маскирующий агент для расположенного в 3'-направлении стартового кодона и/или альтернативных стартовых кодонов для контроля или попытки контроля инициации трансляции, длины указанного полинуклеотида и/или структуры указанного полинуклеотида.

Область стоп-кодона

Настоящим изобретением также предусмотрен полинуклеотид, который содержит и область стоп-кодона, и полинуклеотид, описанный в настоящем документе (например, полинуклеотид, содержащий последовательность нуклеотидов, кодирующую эпитоп ракового антигена, такой как пептид активирующей мутации онкогена). Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению могут включать по меньшей мере два стоп-кодона перед 3' нетранслируемой областью (UTR). Стоп-кодон может быть выбран из TGA, TAA и TAG в случае ДНК, или из UGA, UAA и UAG в случае РНК. Согласно некоторым вариантам реализации полинуклеотиды согласно настоящему изобретению включают стоп-кодон TGA в случае ДНК, или стоп-кодон UGA в случае РНК, и один дополнительный стоп-кодон. Согласно дополнительному варианту реализации указанный добавленный стоп-кодон может представлять собой TAA или UAA. Согласно другому варианту реализации полинуклеотиды согласно настоящему изобретению включают три последовательных стоп-кодона, четыре стоп-кодона или более.

Инсерции и Замены

Настоящим изобретением также предусмотрен полинуклеотид согласно настоящему описанию, который дополнительно содержит инсерции и/или замены.

Согласно некоторым вариантам реализации 5’UTR указанного полинуклеотида может быть заменена путем инсерции по меньшей мере одной области и/или нити из нуклеозидов с одним и тем же основанием. Указанная область и/или нить нуклеотидов может включать, не ограничиваясь перечисленным, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7 или по меньшей мере 8 нуклеотидов, причем указанные нуклеотиды могут быть природными и/или не встречающимися в природе. Согласно неограничивающему примеру группа нуклеотидов может включать 5-8 аденинов, цитозинов, тиминов, нить из любых других нуклеотидов согласно описанию в настоящем документе и/или их комбинации

Согласно некоторым вариантам реализации указанная 5’UTR указанного полинуклеотида может быть заменена путем инсерции по меньшей мере двух областей и/или нитей нуклеотидов с двумя разными основаниями, например, не ограничиваясь перечисленными, аденином, цитозином, тимином, любыми другими нуклеотидами согласно описанию в настоящем документе и/или их комбинациями. Например, 5'UTR может быть заменена путем инсерции 5-8 адениновых оснований с последующей инсерцией 5-8 цитозиновых оснований. Согласно другому примеру 5'UTR может быть может быть заменена путем инсерции 5-8 цитозиновых оснований с последующей инсерцией 5-8 адениновых оснований.

Согласно некоторым вариантам реализации указанный полинуклеотид может включать по меньшей мере одну замену и/или инсерцию в 3’-направлении от сайта старта транскрипции, которую может распознавать РНК-полимераза. Согласно неограничивающему примеру по меньшей мере одна замена и/или инсерция может происходить в 3’-направлении от сайта старта транскрипции путем замены по меньшей мере одной нуклеиновой кислоты в области в 3’-направлении непосредственно за сайтом старта транскрипции (например, однако не ограничиваясь перечисленным, в положениях от +1 до +6). Изменения области нуклеотидов в 3'-направлении непосредственно за сайтом старта транскрипции могут оказывать действие на показатели инициации, увеличивать кажущиеся значения констант реакции нуклеотидтрифосфатов (NTP) и увеличивать отсоединение коротких транскриптов от транскрипционного комплекса в ходе начальной транскрипции (источник: Brieba et al, Biochemistry (2002) 41: 5144-5149; включен в настоящий документ полностью посредством ссылки). Модификация, замена и/или инсерция по меньшей мере одного нуклеозида может вызывать молчащую мутацию последовательности или может вызывать мутацию в последовательности аминокислот.

Согласно некоторым вариантам реализации указанный полинуклеотид может включать замену по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12 или по меньшей мере 13 гуаниновых оснований в 3’-направлении от сайта старта транскрипции.

Согласно некоторым вариантам реализации указанный полинуклеотид может включать замену по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5 или по меньшей мере 6 гуаниновых оснований в области в 3’-направлении непосредственно за сайтом старта транскрипции. Согласно неограничивающему примеру в тех случаях, когда в указанной области находятся нуклеотиды GGGAGA, гуаниновые основания могут быть заменены по меньшей мере 1, по меньшей мере 2, по меньшей мере 3 или по меньшей мере 4 адениновыми нуклеотидами. Согласно другому неограничивающему примеру в тех случаях, когда в указанной области находятся нуклеотиды GGGAGA, гуаниновые основания могут быть заменены по меньшей мере 1, по меньшей мере 2, по меньшей мере 3 или по меньшей мере 4 цитозиновыми основаниями. Согласно другому неограничивающему примеру в тех случаях, когда в указанной области находятся нуклеотиды GGGAGA, гуаниновые основания могут могут быть заменены по меньшей мере 1, по меньшей мере 2, по меньшей мере 3 или по меньшей мере 4 тиминами и/или любыми из нуклеотидов, описанных в настоящем документе.

Согласно некоторым вариантам реализации указанный полинуклеотид может включать по меньшей мере одну замену и/или инсерцию в 5’-направлении от стартового кодона. Проясним, что, как будет понятно специалисту в данной области техники, стартовый кодон представляет собой первый кодон кодирующей области белка, а сайт старта транскрипции представляет собой сайт, где начинается транскрипция. Указанный полинуклеотид может включать, не ограничиваясь перечисленным, по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7 или по меньшей мере 8 замен и/или инсерций нуклеотидных оснований. Нуклеотидные основания могут быть инсертированы или заменены в 1, по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4 или по меньшей мере 5 локализациях в 5’-направлении от стартового кодона. Инсертированные и/или замененные нуклеотиды могут быть представлены одним основанием (например, все нуклеотиды представляют собой A, или все нуклеотиды представляют собой C, или T, или G), двумя разными основаниями (например, A и C, A и T; или C и T), тремя разными основаниями (например, A, C и T; или A, C и T) или по меньшей мере четырьмя разными основаниями.

Согласно неограничивающему примеру гуаниновое основание в 5’-направлении от кодирующей области в полинуклеотиде может быть заменено на аденин, цитозин, тимин или любой из нуклеотидов, описанных в настоящем документе. Согласно другому неограничивающему примеру замена гуаниновых оснований в полинуклеотиде может быть спланирована таким образом, чтобы оставалось одно гуаниновое основание в области в 3’-направлении от сайта старта транскрипции и до стартового кодона (см. источник: Esvelt et al. Nature (2011) 472(7344):499-503; содержание которого включено в настоящий документ полностью посредством ссылки). Согласно неограничивающему примеру по меньшей мере 5 нуклеотидов могут быть инсертированы в 1 локализации в 3’-направлении от сайта старта транскрипции, но в 5’-направлении от стартового кодона, и по меньшей мере 5 нуклеотидов могут относиться к одному типу оснований.

В соответствии с настоящим изобретением две области или части химерного полинуклеотида могут быть соединены или лигированы, например, с применением трифосфатных химических структур. Согласно некоторым вариантам реализации первую область или часть длиной 100 нуклеотидов или менее химически синтезируют с 5′-монофосфатом и концевым 3′-дес-OH или блокированным OH. Если указанная область длиннее 80 нуклеотидов, она может быть синтезирована в виде двух или более цепей, которые затем химически соединяют путем лигирования. Если первая область или часть синтезирована в виде не модифицированной позиционно области или части с применением IVT, затем может быть проведено преобразование в 5′-монофосфат с последующим кэпированием 3′-конца. Монофосфатные защитные группы могут быть выбраны из любых таких известных в данной области техники групп. Вторая область или часть химерного полинуклеотида может быть синтезирована с применением либо химического синтеза, либо способов IVT, например, согласно описанию в настоящем документе. Способы IVT могут включать применение РНК-полимеразы, которая может задействовать праймер с модифицированным кэпом. Как вариант, кэп может быть химически синтезирован и сопряжен с областью или частью IVT.

Что касается способов лигирования, следует отметить, что лигирование ДНК-лигазой T4 с последующей обработкой ДНКазой (для элиминации ДНК-шунта, необходимого для активности ДНК-лигазы T4) должно легко предотвращать нежелательное образование продуктов конкатенации.

При получении химерного полинуклеотида не обязательно вся его последовательность должна содержать фосфатно-сахарный остов. Если одна из областей или частей кодирует полипептид, тогда предпочтительно, чтобы такая область или часть содержала фосфатно-сахарный остов.

Лигирование может быть выполнено с применением любой подходящей методики, такой как ферментативное лигирование, клик-химия, орто-клик-химия, Solulink или другие методы биоконъюгатной химии, известные специалистам в данной области техники. Согласно некоторым вариантам реализации лигирование направляет комплементарный олигонуклеотидный шунт. Согласно некоторым вариантам реализации лигирование осуществляют без комплементарного олигонуклеотидного шунта.

Согласно другим аспектам настоящее изобретение относится к наборам для получения противораковой мРНК-вакцины с применением способов IVT. При использовании персонализированных противораковых вакцин важно идентифицировать специфические для пациента мутации и вакцинировать пациента одним или более неоэпитопами. В таких вакцинах антиген(ы), кодируемые ORF мРНК, будут специфическими для пациента. 5′- и 3′-концы РНК, кодирующей указанный(ые) антиген(ы), могут быть более широко применимыми, поскольку они включают нетранслируемые области и стабилизирующие области, общие для многих РНК. В том числе согласно настоящему изобретению предложены наборы, которые включают химерный полинуклеотид или части химерного полинуклеотида, например, одну или более 5′- и/или 3′-областей РНК, которые могут быть скомбинированы с ORF, кодирующей специфический для пациента эпитоп. Например, набор может включать полинуклеотид, содержащий что-либо одно или более из 5′-ORF, 3′-ORF и концевого поли(A)-фрагмента. Согласно некоторым вариантам реализации каждый полинуклеотидный компонент находится в индивидуальном контейнере. Согласно другим вариантам реализации в единственном контейнер находится вместе более одного полинуклеотидного компонента. Согласно некоторым вариантам реализации указанный набор включает фермент лигазу. Согласно некоторым вариантам реализации предложенные наборы включают инструкции для применения. Согласно некоторым вариантам реализации указанные инструкции включают инструкцию по лигированию кодирующей эпитоп ORF с одним или более другими компонентами набора, например, 5′-ORF, 3′-ORF и/или концевым поли(A)-фрагментом.

Способы получения персонализированные противораковые вакцины в соответствии с настоящим изобретением включают идентификацию мутаций с применением таких методик, как способы глубокого секвенирования нуклеиновых кислот или белков согласно описанию в настоящем документе в образцах тканей. Согласно некоторым вариантам реализации осуществляют начальную идентификацию мутаций в транскриптоме пациента. Данные для транскриптома пациента сравнивают с информацией о последовательностях из экзома пациента для идентификации экспрессируемых специфических для пациента и опухолеспецифических мутаций. В результате сравнения получают набор данных о предполагаемых неоэпитопах, называемый мутаномом. Мутаном может включать приблизительно 100-10 000 кандидатных мутаций для каждого пациента. Мутаном подвергают зондирующему анализу данных с применением набора запросов или алгоритмов с идентификацией оптимального набора мутаций для получения вакцины с неоантигенами. Согласно некоторым вариантам реализации разрабатывают и производят мРНК-вакцину с неоантигенами. Затем пациент получает лечение указанной вакциной.

Вакцина с неоантигенами может представлять собой полицистронную вакцину, включающую несколько неоэпитопов, или одну или более одиночных РНК-вакцин, или комбинацию перечисленного.

Согласно некоторым вариантам реализации указанный способ полностью, от инициации процесса идентификации мутаций до начала лечения пациента, осуществляют менее чем за 2 месяца. Согласно другим вариантам реализации весь процесс осуществляется за 7 недель или менее, 6 недель или менее, 5 недель или менее, 4 недели или менее, 3 недели или менее, 2 недели или менее, или менее чем за 1 неделю. Согласно некоторым вариантам реализации указанный способ полностью осуществляют менее чем за 30 дней.

Процесс идентификации мутаций может включать анализ как транскриптома, так и экзома, или только анализ транскриптома или экзома. Согласно некоторым вариантам реализации сначала осуществляют анализ транскриптома, а затем анализ экзома. Указанный анализ проводят на биологическом образце или образце ткани. Согласно некоторым вариантам реализации биологический образец или образец ткани представляет собой образец крови или сыворотки. Согласно другим вариантам реализации указанный образец представляет собой образец из банка тканей или EBV-трансформированные B-клетки.

Было обнаружено и известно, что путем анализа определенных свойств ассоциированных с раком мутаций могут быть оценены и/или выбраны оптимальные неоэпитопы для включения в мРНК-вакцину. Например, в заданное время, одно или более из ряда свойств могут быть оценены и взвешены для выбора набора неоэпитопов для включения в вакцину. Свойство неоэпитопа или набора неоэпитопов может включать, например, оценку экспрессии на уровне генов или транскриптов у пациента при RNA-seq или другом анализе нуклеиновых кислот, тканеспецифической экспрессии из доступных баз данных, известных супрессоров онкогенов/опухолей, показателя достоверности при распознавании вариантов, аллель-специфической экспрессии при RNA-seq, консервативной/неконсервативной замены АК, положения точечной мутации (индекс центрирования для повышенного вовлечения TCR), положения точечной мутации (индекс привязки для дифференциального связывания HLA), «самости»: <100% гомологии коровых эпитопов по данным WES (полноэкзомного секвенирования) пациента, HLA-A и -B IC50 для 8-меров-11-меров, HLA-DRB1 IC50 для 15-меров-20-меров, показателя неизбирательности (т.е. числа HLA пациента, которые будут связаны согласно прогнозу), HLA-C IC50 для 8-меров-11-меров, HLA-DRB3-5 IC50 для 15-меров-20-меров, HLA-DQB1/A1 IC50 для 15-меров-20-меров, HLA-DPB1/A1 IC50 для 15-меров-20-меров, пропорции класса I относительно класса II, разнообразия охваченных аллотипов HLA-A, -B и DRB1 пациента, пропорции точечных мутаций/комплексных эпитопов (например, со сдвигом рамки) и/или показателей связывания псевдоэпитопов HLA.

Согласно некоторым вариантам реализации свойства ассоциированных с раком мутаций, используемых для идентификации оптимальных неоэпитопов, представляют собой свойства, связанные с типом мутации, распространенностью мутации в образце от пациента, иммуногенностью, отсутствием аутореактивности и природой пептидной композиции.

Тип мутации должен быть определен и рассмотрен как фактор, определяющий включение предполагаемого эпитопа в вакцину. Тип мутации может варьировать. В некоторых случаях может быть желательно включение нескольких разных типов мутаций в одну вакцину. В других случаях более желательно включение единственного типа мутации. Значение для конкретной мутации может быть взвешено и рассчитано. Согласно некоторым вариантам реализации конкретная мутация представляет собой однонуклеотидный полиморфизм (SNP). Согласно некоторым вариантам реализации конкретная мутация представляет собой сложный вариант, например, пептидную последовательность, образующуюся в результате удержания интрона, событий сложного сплайсинга или инсерционных/делеционных мутаций, изменяющих рамку считывания последовательности.

Может также оцениваться распространенность мутации в образце от пациента, и учитываться при принятии решения о включении предполагаемого эпитопа в вакцину. Достаточно распространенные мутации могут способствовать более устойчивому иммунному ответу.

Оценка иммуногенности представляет собой важный компонент при выборе оптимальных неоэпитопов для включения в вакцину. Иммуногенность может оцениваться, например, путем анализа MHC-связывающей способности неоэпитопа, неизбирательности HLA, положения мутаций, предсказанной реактивности T-клеток, фактической реактивности T-клеток, структуры, приводящей к конкретным конформациям и итогового воздействия растворителя, и представленности специфических аминокислот. Известные алгоритмы, такие как алгоритм предсказания NetMHC, могут быть использованы для предсказания способности пептида связывать общие аллели HLA-A и HLA-B. Структурная оценка MHC-связанного пептида может также быть проведена in silico с применением 3-мерного анализа и/или программ для предсказания стыковки белков. Предсказанная структура эпитопа, связанного с молекулой MHC, например, полученная с помощью алгоритма Rosetta, может применяться для оценки степени доступности для растворителя остатков аминокислот эпитопа в связанном с молекулой MHC состоянии. Реактивность T-клеток может быть оценена экспериментальным путем с эпитопами и T-клетками in vitro. Как вариант, реактивность T-клеток может оцениваться с применением с использованием наборов данных ответов T-клеток/последовательностей.

Важной составляющей неоэпитопа, включаемого в вакцину, является отсутствие аутореактивности. Может быть проведен скрининг предполагаемых неоэпитопов для подтверждения того, что эпитоп ограничен опухолевой тканью, например, возникает в результате генетического изменения в злокачественных клетках. В идеале, указанный эпитоп не должен присутствовать в нормальной ткани пациента и, соответственно, сходные с собственными эпитопы отфильтровывают из набора данных. Персонализированный кодирующий геном может быть использован в качестве референсного для сравнения кандидатных неоантигенов и определения отсутствия аутореактивности. Согласно некоторым вариантам реализации персонализированный кодирующий геном получают из индивидуализированного транскриптома и/или экзома.

Природа пептидной композиции может также быть учтена при разработке эпитопа. Например, для каждого предполагаемого эпитоп может быть получен показатель, относящийся к количеству консервативных/ неконсервативных аминокислот, обнаруживаемых в указанном эпитопе.

Согласно некоторым вариантам реализации анализ, выполняемый с помощью инструментов, описанных в настоящем документе, может включать сравнение разных наборов свойств, полученных для пациента в разные моменты времени, т.е. до и после терапевтического вмешательства, в образцах разных тканей, от разных пациентов с аналогичными опухолями и т.п. Согласно некоторым вариантам реализации может быть проведено сравнение среднего пикового значения из одного набора свойств со средним пиковым значением из другого набора свойств. Например, может быть проведено сравнение среднего значения связывания HLA в двух разных наборах распределений. Указанные два набора распределений могут быть определены для временных интервалов, разделенных, например, днями, месяцами или годами.

Кроме того, авторы настоящего изобретения обнаружили и приняли во внимание, что такие данные относительно свойств раковых мутаций могут быть собраны и проанализированы с использованием алгоритмов, описанных в настоящем документе. Указанные данные полезны для идентификации неоэпитопов и наборов неоэпитопов для разработки персонализированных противораковых вакцин.

Согласно некоторым вариантам реализации все аннотированные транскрипты варианта опухолевого пептида включают в вакцину согласно настоящему изобретению. Согласно некоторым вариантам реализации продукты трансляции РНК, идентифицированной при RNAseq, включают в вакцину в соответствии с настоящим изобретением.

Следует понимать, что конкатемер из 2 или более пептидов, например, 2 или более неоантигенов, может образовывать непредусмотренные новые эпитопы (псевдоэпитопы) в границах пептида. Для предотвращения или элиминации таких псевдоэпитопов аллели класса I могут быть сканированы на попадания в границах пептида в конкатемере. Согласно некоторым вариантам реализации пептиды в конкатемере меняют местами для снижения или элиминации образования псевдоэпитопов. Согласно некоторым вариантам реализации используют линкер между пептидами, например, линкер из одной аминокислоты, такой как глицин, для снижения или элиминации образования псевдоэпитопов. Согласно некоторым вариантам реализации якорные аминокислоты могут быть заменены на другие аминокислоты, которые будут снижать или элиминировать образование псевдоэпитопов. Согласно некоторым вариантам реализации пептиды обрезают на границе пептидов в составе конкатемера для снижения или элиминации образования псевдоэпитопов.

Согласно некоторым вариантам реализации несколько антигенов с пептидными эпитопами располагают и упорядочивают для минимизации псевдоэпитопов. Согласно другим вариантам реализации несколько антигенов с пептидными эпитопами представлены полипептидом, не содержащим псевдоэпитопов. Если эпитопы раковых антигенов расположены в конкатемерной структуре в порядке от головного фрагмента к концевому фрагменту, между каждым из эпитопов раковых антигенов образуется участок сращивания. Указанный участок включает несколько, т.е. 1-10, аминокислот из эпитопа на N-конце пептида и несколько, т.е. 1-10, аминокислот на C-конце смежного прямо присоединенного эпитопа. Важно, чтобы участок сращивания не был иммуногенным пептидом, который может вызвать иммунный ответ. Согласно некоторым вариантам реализации указанный участок сращивания образует пептидную последовательность, которая связывается с белком HLA субъекта, для которого разработана персонализированные противораковая вакцина, с IC50, составляющей более чем приблизительно 50 нМ. Согласно другим вариантам реализации пептидная последовательность участка сращивания связывается с белком HLA субъекта с IC50, составляющей более чем приблизительно 10 нМ, 150 нМ, 200 нМ, 250 нМ, 300 нМ, 350 нМ, 400 нМ, 450 нм или 500 нМ.

Система определения характеристик неоэпитопов, в соответствии с методиками, описанными в данном документе, может принимать любую подходящую форму, поскольку варианты реализации в этом отношении не ограничены. Иллюстративное воплощение компьютерной системы 900, которая может применяться в сочетании с некоторыми вариантами реализации, представлено на фиг. 5. Одна или более компьютерных систем, таких как компьютерная система 900, могут применяться для реализации любых описанных выше функциональных возможностей. Компьютерная система 900 может включать один или более процессоров 910 и один или более машиночитаемых накопителей (т.е. материальных машиночитаемых носителей для долговременного хранения), например, энергозависимое запоминающее устройство 920 и один или более энергонезависимых накопителей 930, которые могут быть сформированы любыми подходящими накопителями данных. Процессор 910 может контролировать запись данных и считывание данных с энергозависимого запоминающего устройства 920 и энергонезависимого запоминающего устройства устройство 930 любым подходящим образом, поскольку варианты реализации в этом отношении не ограничены. Для осуществления любой из функциональных возможностей, описанных в настоящем документе, процессор 910 может исполнять одну или более их инструкций, которые хранятся в одном или более машиночитаемых накопителях (например, энергозависимом запоминающем устройстве 920 и/или энергонезависимом запоминающем устройстве 930), которые могут служить в качестве материальных машиночитаемых носителей для долговременного хранения инструкций для исполнения процессором 910.

Вышеописанные варианты реализации могут быть реализованы любым из многочисленных способов. Например, указанные варианты реализации могут быть реализованы с применением аппаратных средств, программного обеспечения или их комбинации. При осуществлении в программном обеспечении код указанного программного обеспечения может быть исполнен любым подходящим процессором или комплектом процессоров, представленных в виде одного компьютера или распределенных по нескольким компьютерам. Следует понимать, что любой компонент или комплект компонентов, выполняющий описанные выше функции, могут быть в общем рассмотрены как один или более контроллеров, контролирующих описанные выше функции. Указанные один или более контроллеров могут быть реализованы многочисленными способами, например, с применением специализированных аппаратных средств, или аппаратных средств общего назначения (например, одного или более процессоров), программируемых с использованием микрокода или программного обеспечения для выполнения описанных выше функций.

В этом отношении следует понимать, что один вариант реализации включает по меньшей мере один машиночитаемый накопитель (т.е. по меньшей мере один материальный машиночитаемый носитель для долговременного хранения), такой как память компьютера (например, жесткий диск, флэш-память, рабочая память процессора и т.п.), дискета, оптический диск, магнитная лента или другой материальный машиночитаемый носитель для долговременного хранения, где закодирована компьютерная программа (т.е. совокупность инструкций), которая, при исполнении на одном или более процессоров, выполняет описанные выше функции. Указанный машиночитаемый накопитель может быть транспортируемым, так что хранящаяся на нем программа может быть загружена на любой компьютерный ресурс для реализации методик, описанных в настоящем документе. Кроме того, следует понимать, что при упоминании компьютерной программы, которая при исполнении выполняет вышеописанные функции, не подразумевается ограничение прикладной программой, работающей на основном компьютере. Напротив, термин «компьютерная программа» используется в данном документе в общем смысле для обозначения любого типа компьютерного кода (например, программного обеспечения или микрокода), который может быть использован для программирования одного или более процессоров для реализации вышеописанных методик.

Богатые GC Домены

Определения

Богатый GC: В настоящем документе термин «богатый GC» относится к составу нуклеиновых оснований полинуклеотида (например, мРНК) или любой его части (например, РНК-элемент), содержащего гуаниновые (G) и/или цитозиновые (C) нуклеиновые основания, или их производных или аналогов, причем содержание GC составляет более чем приблизительно 50%. Термин «богатый GC» относится ко всему полинуклеотиду или к его части, в том числе, не ограничиваясь перечисленным, к гену, некодирующей области, 5’ UTR, 3’ UTR, открытой рамке считывания, РНК-элементу, последовательности мотива или любой дискретной последовательности, ее фрагменту или сегменту, который или которая содержит приблизительно 50% GC. Согласно некоторым вариантам реализации настоящего изобретения богатые GC полинуклеотиды или любые их части, состоят исключительно из гуаниновых (G) и/или цитозиновых (C) нуклеиновых оснований.

Содержание GC: В настоящем документе термин «содержание GC» относится к проценту нуклеиновых оснований в полинуклеотиде (например, мРНК) или его части (например, РНК-элементе), представленных гуаниновыми (G) и цитозиновыми (C) нуклеиновыми основаниями, или их производными или аналогами (от общего числа возможных нуклеиновых оснований, в том числе аденина (A) и тимина (T) или урацила (U), и их производных или аналогов, в ДНК и в РНК). Термин «содержание GC» относится ко всему полинуклеотиду или к его части, в том числе, но не ограничиваясь перечисленными, к гену, некодирующей области, 5’ UTR, 3’ UTR, открытой рамке считывания, РНК-элементу, последовательности мотива или любой дискретной последовательности, ее фрагменту или сегменту.

Инициирующий кодон: В настоящем документе термин «инициирующий кодон», используемый взаимозаменяемо с термином «стартовый кодон», относится к первому кодону открытой рамки считывания, транслируемому рибосомой, и состоит из триплета соединенных нуклеиновых оснований аденин-урацил-гуанин. Инициирующий кодон обозначают кодами первых букв аденина (A), урацила (U) и гуанина (G) и часто записывают просто как «AUG». Хотя в природных мРНК в качестве инициирующего кодона могут использоваться отличные от AUG кодоны, которые называются в настоящем документе «альтернативными инициирующими кодонами», в качестве инициирующих кодонов полинуклеотидов, описанных в настоящем документе, используется кодон AUG. Во время процесса инициации трансляции последовательность, содержащая инициирующий кодон, распознается за счет спаривания комплементарных оснований с антикодоном инициаторной тРНК (Met-tRNAiMet), связанной рибосомой. Открытые рамки считывания могут содержать более одного инициирующего кодона AUG, которые называют в настоящем документе «альтернативными инициирующими кодонами».

Инициирующий кодон играет важнейшую роль в инициации трансляции. Инициирующий кодон является первым кодоном открытой рамки считывания, который транслируется рибосомой. Как правило, инициирующий кодон содержит нуклеотидный триплет AUG, однако в некоторых случаях инициация трансляции может происходить на других кодонах, состоящих из отличных нуклеотидов. Инициация трансляции у эукариот представляет собой многоэтапный биохимический процесс, который включает многочисленные белок-белковые взаимодействия, взаимодействия белков и РНК и РНК-РНК, между молекулами матричной РНК (мРНК), 40S рибосомальной субъединицей, другими компонентами механизмов трансляции (например, эукариотическими факторами инициации; eIF). Текущая модель инициации трансляции мРНК предполагает, что преинициаторный комплекс (как вариант «43S преинициаторный комплекс»; сокращенно «PIC») транслоцируется из сайта рекрутинга на мРНК (как правило, 5’-кэпа) в инициирующий кодон, сканируя нуклеотиды в направлении 5′→3′ до встречи с первым кодоном AUG, расположенным в специфическом способствующем трансляции нуклеотидном окружении (последовательности Козак) (Kozak (1989) J Cell Biol 108:229-241). Сканирование PIC заканчивается спариванием комплементарных оснований в нуклеотидах, содержащих антикодон инициаторной Met-tRNAiMet транспортной РНК и нуклеотидах, содержащих инициирующий кодон мРНК. Продуктивное спаривание оснований кодона AUG и антикодона Met-tRNAiMet вызывает ряд структурных и биохимических событий, который завершается соединением большой 60S рибосомальной субъединицы с PIC с образованием активной рибосомы, способной обеспечивать удлинение при трансляции.

Последовательность Козак: Термин «последовательность Козак» (также называемая «консенсусной последовательностью Козак») относится к энхансерному элементу инициации трансляции, усиливающему экспрессию гена или открытой рамки считывания, которая у эукариот локализована в 5’UTR. Консенсусная последовательность Козак изначально была определена как последовательность GCCRCC, где R=пурин, на основании анализа эффектов одиночных мутаций вокруг инициирующего кодона (AUG) на трансляцию гена препроинсулина (Kozak (1986) Cell 44:283-292). Полинуклеотиды согласно описанию в настоящем документе содержат консенсусную последовательность Козак, или ее производное или модифицированный вариант. (Примеры трансляционных энхансерных композиций и способы их применения можно найти в патенте США № 5807707, Andrews et al., включенном в настоящий документ полностью посредством ссылки; патенте США №5723332, Chernajovsky, включенном в настоящий документ полностью посредством ссылки; патенте США №5891665, Wilson, включенном в настоящий документ полностью посредством ссылки.)

Ослабленное сканирование: явление, известное как «ослабленное сканирование» может возникать, когда PIC обходит инициирующий кодон, продолжая сканирование в 3'-направлении до распознавания варианта инициирующего кодона или альтернативного инициирующего кодона. В зависимости от частоты возникновения обход инициирующего кодона PIC может приводить к снижению эффективности трансляции. Кроме того, может происходить трансляция с указанного 3'-кодона AUG, что приводит к продуцированию нежелательного аберрантного продукта трансляции, который может быть неспособен вызывать требуемый терапевтический ответ. Более того, в некоторых случаях аберрантный продукт трансляции может вызывать пагубный ответ (Kracht et al., (2017) Nat Med 23(4):501-507).

Модифицированный: В настоящем документе «модифицированный» или «модификация» относится к измененному состоянию или к изменению состава или структуры полинуклеотида (например, мРНК). Полинуклеотиды могут быть модифицированы различными путями, в том числе химически, структурно и/или функционально. Например, полинуклеотиды могут быть структурно модифицированы путем включения одного или более РНК-элементов, причем указанный РНК-элемент содержит последовательность и/или вторичную структуру (структуры) РНК, обеспечивающие одну или более функций (например, трансляционную регуляторную активность). Соответственно, полинуклеотиды согласно настоящему описанию могут включать одну или более модификаций (например, могут включать одну или более химических, структурных или функциональных модификаций, в том числе любую их комбинацию).

Нуклеиновое основание: В настоящем документе термин «нуклеиновое основание» (как вариант, «нуклеотидное основание» или «азотистое основание») относится к пуриновому или пиримидиновому гетероциклическому соединению, обнаруживаемому в нуклеиновых кислотах, в том числе любым производным или аналогам встречающихся в природе пуринов и пиримидинов, которые улучшают свойства (например, аффинность связывания, устойчивость к нуклеазам, химическую стабильность) нуклеиновой кислоте, или ее части или сегменту. Аденин, цитозин, гуанин, тимин и урацил представляют собой нуклеиновые основания, преимущественно обнаруживаемые в природных нуклеиновых кислотах. Другие природные, не встречающиеся в природе и/или синтетические нуклеиновые основания, известные в данной области техники и/или описанные в настоящем документе, могут быть включены в нуклеиновые кислоты.

Нуклеозид/Нуклеотид: В настоящем документе термин «нуклеозид» относится к соединению, содержащему молекулу сахара (например, рибозу в РНК или дезоксирибозу в ДНК), или ее производное или аналог, ковалентно связанную с нуклеиновым основанием (например, пурином или пиримидином), или его производным или аналогом (также называемым в настоящем документе «нуклеиновым основанием»), однако без межнуклеозидной соединяющей группы (например, фосфатной группой). В настоящем документе термин «нуклеотид» относится к нуклеозиду, ковалентно связанному с межнуклеозидной соединяющей группой (например, фосфатной группой), или любому его производному, аналогу или модифицированному варианту, который улучшает химические и/или функциональные свойства (например, аффинность связывания, устойчивость к нуклеазам, химическую стабильность) нуклеиновой кислоты, или ее части или сегмента.

Нуклеиновая кислота: В настоящем документе термин «нуклеиновая кислота» используется в самом широком смысле и охватывает любое соединение и/или вещество, которые включает полимер из нуклеотидов, или их производных или аналогов. Указанные полимеры часто называют «полинуклеотидами». Соответственно, в настоящем документе термины «нуклеиновая кислота» и «полинуклеотид» эквивалентны и используются взаимозаменяемо. Примеры нуклеиновых кислот или полинуклеотидов согласно настоящему описанию включают, не ограничиваясь перечисленными, рибонуклеиновые кислоты (РНК), дезоксирибонуклеиновые кислоты (ДНК), гибриды ДНК-РНК, индуцирующие РНК-интерференцию агенты, агенты РНК-интерференции, ми-РНК, кшРНК, мРНК, модифицированные мРНК, миРНК, антисмысловые РНК, рибозимы, каталитическую ДНК, РНК, которые индуцируют образование тройной спирали, треозные нуклеиновые кислоты (ТНК), гликолевые нуклеиновые кислоты (ГНК), пептидные нуклеиновые кислоты (ПНК), закрытые нуклеиновые кислоты (ЗНК, в том числе ЗНК в β-D-рибо-конфигурации, α-ЗНК в α-L-рибо-конфигурации (диастереоизомер ЗНК), 2'-амино-ЗНК с 2'-амино- функционализацией и 2'-амино-α-ЗНК с 2'-амино-функционализацией) или их гибриды.

Структура нуклеиновой кислоты: В настоящем документе термин «структура нуклеиновой кислоты» (используемый взаимозаменяемо с «полинуклеотидной структурой») относится к расположению или организации атомов, химических составляющих, элементов, мотивов и/или последовательности соединенных нуклеотидов, или их производных или аналогов, которые содержат нуклеиновую кислоту (например, мРНК). Термин также относится к двумерному или трехмерному состоянию нуклеиновой кислоты. Соответственно, термин «РНК-структура» относится к расположению или организации атомов, химических составляющих, элементов, мотивов и/или последовательности соединенных нуклеотидов, или их производных или аналогов, которые содержат молекулу РНК (например, мРНК), и/или относится к двумерному и/или трехмерному состоянию молекулы РНК. Структура нуклеиновой кислоты может быть дополнительно разделены на четыре организационные категории, называемые в настоящем документе «молекулярной структурой», «первичной структурой», «вторичной структурой» и «третичной структурой», основанные на возрастающей сложности организации.

Открытая рамка считывания: В настоящем документе термин «открытая рамка считывания», сокращенно «ORF», относится к сегменту или области молекулы мРНК, которая кодирует полипептид. ORF содержит непрерывный отрезок неперекрывающихся кодонов внутри рамки, начинающийся инициирующим кодоном и заканчивающийся стоп-кодоном, и транслируется рибосомой.

Преинициаторный комплекс (PIC): В настоящем документе термин «преинициаторный комплекс» (как вариант, «43S преинициаторный комплекс»; сокращенно «PIC») относится к комплексу рибонуклеопротеина, содержащему 40S рибосомальную субъединицу, эукариотические факторы инициации (eIF1, eIF1A, eIF3, eIF5) и трехчастный комплекс eIF2-GTP-Met-tRNAiMet, по природе способный прикрепляться к 5’-кэпу молекулы мРНК и после прикрепления выполнять рибосомное сканирование 5’ UTR.

РНК-элемент: В настоящем документе термин «РНК-элемент» относится к части, фрагменту или сегменту молекулы РНК, который(ая) обеспечивает биологическую функцию и/или обладает биологической активностью (например, трансляционной регуляторной активностью). Модификация полинуклеотида путем включения одного или более РНК-элементов, таких как описанные в настоящем документе, обеспечивает одно или более требуемых функциональных свойств модифицированному полинуклеотиду. РНК-элементы, согласно описанию в настоящем документе, могут быть встречающимися в природе, не встречающимися в природе, синтетическими, сконструированными, или представлять собой любую комбинацию перечисленного. Например, встречающиеся в природе РНК-элементы, которые обеспечивают регуляторную активность, включают элементы, обнаруживаемые повсеместно в транскриптомах вирусов, прокариотических и эукариотических организмах (например, у человека). РНК-элементы, в частности, эукариотические мРНК и транслируемые вирусные РНК, как было показано, вовлечены в опосредование многих функций в клетках. Примеры природных РНК-элементов включают, не ограничиваясь перечисленными, элементы инициации трансляции (например, участок внутренней посадки рибосомы (IRES), см. Kieft et al., (2001) РНК 7(2):194-206), трансляционные энхансерные элементы (например, трансляционный энхансерный элемент мРНК APP, см. Rogers et al., (1999) J Biol Chem 274(10):6421-6431), элементы стабильности мРНК (например, AU-богатые элементы (ARE), см. Garneau et al., (2007) Nat Rev Mol Cell Biol 8(2):113-126), элемент репрессии трансляции (см., например, Blumer et al., (2002) Mech Dev 110(1-2):97-112), связывающие белки РНК-элементы (например, железочувствительный элемент, см. Selezneva et al., (2013) J Mol Biol 425(18):3301-3310), элементы цитоплазматического полиаденилирования (Villalba et al., (2011) Curr Opin Genet Dev 21(4):452-457) и каталитические РНК-элементы (например, рибозимы, см. Scott et al., (2009) Biochim Biophys Acta 1789(9-10):634-641).

Время удерживания: В настоящем документе термин «время удерживания» относится к времени занятости преинициаторного комплекса (PIC) или рибосомы в дискретном положении или локализации на молекуле мРНК.

Трансляционная регуляторная активность: В настоящем документе термин «трансляционная регуляторная активность» (используемый взаимозаменяемо с «функцией регуляции трансляции») относится к биологической функции, механизму, или процессу, который модулирует (например, регулирует, влияет, контролирует, изменяет) активность трансляционного аппарата, в том числе активность PIC и/или рибосомы. Согласно некоторым аспектам указанная требуемая трансляционная регуляторная активность способствует правильности и/или повышает правильность трансляции мРНК. Согласно некоторым аспектам указанная требуемая трансляционная регуляторная активность уменьшает и/или ингибирует ослабленное сканирование.

Трансляция полинуклеотида, содержащего открытую рамку считывания, кодирующую полипептид, может быть контролироваться и регулироваться различными механизмами, которые обеспечивают различные цис-действующие структуры нуклеиновых кислот. Например, в