Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора



Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
Лечение рака с помощью гуманизированного анти-cd19 химерного антигенного рецептора
C12N2510/02 - Микроорганизмы или ферменты; их композиции (биоциды, репелленты или аттрактанты или регуляторы роста растений, содержащие микроорганизмы, вирусы, микробные грибки, ферменты, агенты брожения или вещества, получаемые или экстрагируемые из микроорганизмов или из материала животного происхождения A01N 63/00; пищевые составы A21,A23; лекарственные препараты A61K; химические аспекты или использование материалов для бандажей, перевязочных средств, впитывающих подкладок или хирургических приспособлений A61L; удобрения C05); размножение, консервирование или сохранение микроорганизмов (консервирование живых тканей или органов людей или животных A01N 1/02); мутации или генная инженерия; питательные среды (среды для микробиологических испытаний C12Q)
C07K2317/24 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2711975:

ДЗЕ ТРАСТИЗ ОФ ДЗЕ ЮНИВЕРСИТИ ОФ ПЕНСИЛЬВАНИЯ (US)
НОВАРТИС АГ (CH)

Настоящее изобретение относится к области иммунологии. Предложены выделенная молекула нуклеиновой кислоты, кодирующая анти-CD19 химерный антигенный рецептор, выделенная молекула анти-CD19 химерный антигенный рецептор, а также гуманизированный анти-CD19-связывающий домен. Кроме того, рассмотрен вектор, клетки, способ получения клетки, способ получения популяции клеток, способ создания противоопухолевого иммунитета и способ лечения. Также описаны выделенные молекулы нуклеиновой кислоты, кодирующие анти-CD19 CAR. Данное изобретение может найти дальнейшее применение в терапии различных пролиферативных заболеваний, ассоциированных с экспрессией CD19, в частности рака. 15 н. и 68 з.п. ф-лы, 12 ил., 6 табл., 6 пр.

 

По настоящей заявке испрашивается приоритет на основании предварительной патентной заявки США с порядковым номером 61/802629, поданной 16 марта 2013 г., и предварительной патентной заявки США с порядковым номером 61/838537, поданной 24 июня 2013 г., полное содержание каждой из которых включено в настоящий документ посредством ссылки.

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Настоящая заявка содержит список последовательностей, который представлен в электронном виде в формате ASCII и включен в настоящий документ посредством ссылки в полном объеме. Указанная ASCII-копия, созданная 14 марта 2014 г., называется N2067-7002WO_SL.txt и имеет размер 228415 байт.

ОБЛАСТЬ ТЕХНИКИ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится, главным образом, к использованию T-клеток, генетически измененных для экспрессии химерного антигенного рецептора (CAR), для лечения заболевания, ассоциированного с экспрессией белка кластера дифференцировки 19 (CD19).

УРОВЕНЬ ТЕХНИКИ ИЗОБРЕТЕНИЯ

У многих пациентов B-клеточные злокачественные новообразования не поддаются лечению стандартными терапевтическими методами. Кроме того, традиционные методы лечения часто имеют серьезные побочные эффекты. Были предприняты попытки иммунотерапии рака, однако некоторые обстоятельства делают достижение клинической эффективности трудной задачей. Хотя были идентифицированы сотни так называемых опухолевых антигенов, они, как правило, получены из собственных опухолей и, следовательно, имеют слабую иммуногенность. Кроме того, опухоли имеют несколько механизмов противостояния началу и распространению иммунной атаки.

Недавние разработки в области терапии с использованием модифицированных химерным антигенным рецептором (CAR) аутологичных T-клеток (CART), основанной на перенаправлении T-клеток на соответствующие молекулы на поверхности раковых клеток, таких как B-клеточные злокачественные новообразования, показывают многообещающие результаты в использовании потенциала иммунной системы для лечения B-клеточных злокачественных новообразований и других видов рака (смотри, например, Sadelain et al., Cancer 1907393 1 Discovery 3: 388-398 (2013)). Клинические результаты применения мышиных CART19 (то есть, «CTL019») показали многообещающие результаты в достижении полной ремиссии у пациентов, страдающих CLL, а также в случае детского ALL (смотри, например, Kalos et al., Sci Transl Med 3: 95ra73 (2011), Porter et al., NEJM 365: 725-733 (2011), Grupp et al., NEJM 368: 1509-1518 (2013)). Помимо способности генетически модифицированных Т-клеток, имеющих на своей поверхности химерный антигенный рецептор, узнавать и уничтожать целевые клетки, для успешного лечения терапевтическими T-клетками они должны обладать способностью пролиферировать и сохраняться в течение долгого времени, а также в дальнейшем контролировать уцелевшие лейкозные клетки. Разное качество T-клеток, являющееся результатом анергии, подавления или истощения, будет оказывать влияние на эффективность CAR-трансформированных T-клеток, которую в настоящее время квалифицированные специалисты могут контролировать лишь в ограниченной степени. Для того, чтобы быть эффективными, CAR-трансформированные T-клетки пациента должны сохраняться и поддерживать способность пролиферировать в ответ на антиген CAR. Показано, что T-клетки пациента с ALL способны к этому в случае CART19, содержащего scFv мыши (смотри, например, Grupp et al., NEJM 368: 1509-1518 (2013)).

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Изобретение относится к контролированию иммунного ответа у пациентов путем обеспечения оптимизированных и гуманизированных фрагментов антитела (например, scFv), связывающих белок кластера дифференцировки 19 (CD19), интегрированных в конструкцию химерного антигенного рецептора (CAR), которая не будет вызывать иммунный ответ у пациентов, безопасна для использования в течение долгого времени и демонстрирует сходную или превосходящую клиническую эффективность в сравнении с известным терапевтическим средством на основе CART для лечения B-клеточных злокачественных новообразований. Кроме того, изобретение относится к использованию T-клеток, генетически измененных для экспрессии гуманизированного фрагмента антитела, который связывает CD19, интегрированного в CAR, для лечения рака крови, ассоциированного с экспрессией CD19 (регистрационный № OMIM 107265, регистрационный № Swiss Prot. P15391).

Соответственно, в одном аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей химерный антигенный рецептор (CAR), при этом CAR содержит антитело или фрагмент антитела, которые включают гуманизированный анти-CD19 связывающий домен, трансмембранный домен и внутриклеточный сигнальный домен (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен). В одном варианте осуществления CAR содержит антитело или фрагмент антитела, которые включают гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе, трансмембранный домен, описанный в настоящем документе, и внутриклеточный сигнальный домен, описанный в настоящем документе (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен).

В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, и/или одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, кодируемый гуманизированный анти-CD19 связывающий домен имеет две вариабельные области тяжелой цепи, каждая из которых содержит HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления кодируемая вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления кодируемая вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления кодируемая вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления кодируемая вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область легкой цепи, описанную в настоящем документе (например, в таблице 3), и/или гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3), например, по меньшей мере две гуманизированные вариабельные области тяжелой цепи, описанные в настоящем документе (например, в таблице 3). В одном варианте осуществления кодируемый анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в таблице 3. В одном варианте осуществления анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая гуманизированный анти-CD19 связывающий домен, содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен представляет собой scFv, и вариабельная область легкой цепи, содержащая аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, присоединена к вариабельной области тяжелой цепи, содержащей аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, через линкер, например, линкер, описанный в настоящем документе. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 3 или 4 (SEQ ID NO: 53). Вариабельная область легкой цепи и вариабельная область тяжелой цепи в scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном варианте осуществления кодируемый трансмембранный домен представляет собой трансмембранный домен белка, выбранного из группы, состоящей из альфа, бета или дзета-цепи T-клеточного рецептора, CD27, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154. В одном варианте осуществления кодируемый трансмембранный домен содержит последовательность SEQ ID NO: 15. В одном варианте осуществления кодируемый трансмембранный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 15, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 15. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая трансмембранный домен, содержит последовательность SEQ ID NO: 56 или последовательность, имеющую 95-99% идентичности с ней.

В одном варианте осуществления кодируемый анти-CD19 связывающий домен связан с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной в настоящем документе. В одном варианте осуществления кодируемая шарнирная область содержит SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая шарнирную область, содержит последовательность SEQ ID NO: 55 или SEQ ID NO: 46, или SEQ ID NO: 48, или последовательность, имеющую 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты дополнительно содержит последовательность, кодирующую костимулирующий домен. В одном варианте осуществления костимулирующий домен представляет собой функциональный сигнальный домен, полученный из белка, выбранного из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137). В одном варианте осуществления кодируемый костимулирующий домен содержит последовательность SEQ ID NO: 16. В одном варианте осуществления кодируемый костимулирующий домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая костимулирующий домен, содержит последовательность SEQ ID NO: 60 или последовательность, имеющую 95-99% идентичности с ней. В одном варианте осуществления выделенная молекула нуклеиновой кислоты дополнительно содержит последовательность, кодирующую внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит функциональный сигнальный домен CD27 и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 или SEQ ID NO: 51 и/или последовательность SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 43, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательностью SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 или SEQ ID NO: 51 и последовательность SEQ ID NO: 17 или SEQ ID NO: 43, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессированы в одной и той же рамке считывания и в виде одной полипептидной цепи. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая внутриклеточный сигнальный домен, содержит последовательность SEQ ID NO: 60 или последовательность, имеющую 95-99% идентичности с ней, и/или последовательность SEQ ID NO: 101 или SEQ ID NO: 44, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая внутриклеточный сигнальный домен, содержит последовательность SEQ ID NO: 52 или последовательность, имеющую 95-99% идентичности с ней, и/или последовательность SEQ ID NO: 101 или SEQ ID NO: 44, или последовательность, имеющую 95-99% идентичности ними.

В другом аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей конструкцию CAR, содержащую лидерную последовательность, например, лидерную последовательность, описанную в настоящем документе, например, SEQ ID NO: 13; гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, содержащий LC CDR1, LC CDR2, LC CDR3, HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, описанный в таблице 3, или последовательность, имеющую 95-99% идентичности с ним; шарнирную область, описанную в настоящем документе, например, SEQ ID NO: 14 или SEQ ID NO: 45; трансмембранный домен, описанный в настоящем документе, например, трансмембранный домен, содержащий SEQ ID NO: 15, и внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит костимулирующий домен, например, костимулирующий домен, описанный в настоящем документе, например, костимулирующий домен 4-1BB, имеющий последовательность SEQ ID NO: 16 или SEQ ID NO: 51, и/или основной сигнальный домен, например, основной сигнальный домен, описанный в настоящем документе, например, сигнальный домен CD3-дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит лидерную последовательность, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 54, или последовательность, имеющую 95-99% идентичности с ней. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит последовательность гуманизированного анти-CD19 связывающего домена, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит трансмембранную последовательность, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 56, или последовательность, имеющую 95-99% идентичности ней. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит последовательность внутриклеточного сигнального домена, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 60, или последовательность, имеющую 95-99% идентичности с ней, и/или последовательностью нуклеиновой кислоты SEQ ID NO: 101 или SEQ ID NO: 44, или последовательность, имеющей 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты содержит (например, состоит из) нуклеиновую кислоту, кодирующую аминокислотную последовательность CAR с SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42, или аминокислотную последовательность, имеющую по меньшей мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более чем 60, 50 или 40 модификаций (например, замен), аминокислотной последовательности, или аминокислотную последовательность, имеющую 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичности с аминокислотной последовательностью SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты содержит (например, состоит из) последовательность нуклеиновой кислоты SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 или SEQ ID NO: 96, или последовательность нуклеиновой кислоты, имеющую 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичности с последовательностью нуклеиновой кислоты SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 или SEQ ID NO: 96.

В одном аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей гуманизированный анти-CD19 связывающий домен, при этом анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) анти-CD19 связывающего домена, описанного в настоящем документе, и одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит вариабельную область легкой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12), и/или вариабельную область тяжелой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12. В одном из вариантов осуществления гуманизированный анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая гуманизированный анти-CD19 связывающий домен, содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними.

В другом аспекте изобретение относится к выделенной молекуле полипептида, кодируемой последовательностью нуклеиновой кислоты. В одном варианте осуществления выделенная молекула полипептида содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 и SEQ ID NO: 42. В одном варианте осуществления выделенный полипептид содержит последовательность SEQ ID NO: 31. В одном варианте осуществления выделенный полипептид содержит последовательность SEQ ID NO: 32. В одном варианте осуществления выделенная молекула полипептида содержит последовательность SEQ ID NO: 35. В одном варианте осуществления выделенная молекула полипептида содержит последовательность SEQ ID NO: 36. В одном варианте осуществления выделенная молекула полипептида содержит последовательность SEQ ID NO: 37.

В другом аспекте изобретение относится к выделенной молекуле химерного антигенного рецептора (CAR), содержащего гуманизированный анти-CD19 связывающий домен (например, гуманизированное антитело или фрагмент антитела, которые специфически связываются с CD19), трансмембранный домен и внутриклеточный сигнальный домен (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен). В одном варианте осуществления CAR содержит антитело или фрагмент антитела, содержащие гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе (например, гуманизированное антитело или фрагмент антитела, которые специфически связываются с CD19, как описано в настоящем документе), трансмембранный домен, описанный в настоящем документе, и внутриклеточный сигнальный домен, описанный в настоящем документе (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен, описанные в настоящем документе).

В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, и одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированный анти-CD19 связывающий домен имеет две вариабельные области тяжелой цепи, каждая из которых содержит HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит вариабельную область легкой цепи, описанную в настоящем документе (например, в таблице 3), и/или вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в таблице 3. В одном варианте осуществления анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, и вариабельная область легкой цепи, содержащая аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, присоединена к вариабельной области тяжелой цепи, содержащей аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, через линкер, например, линкер, описанный в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 3 или 4 (SEQ ID NO: 53). Вариабельная область легкой цепи и вариабельная область тяжелой цепи в scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном варианте осуществления выделенная молекула CAR содержит трансмембранный домен белка, выбранного из группы, состоящей из альфа, бета или дзета цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD 137 и CD 154. В одном варианте осуществления трансмембранный домен содержит последовательность SEQ ID NO: 15. В одном варианте осуществления трансмембранный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 15, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 15.

В одном варианте осуществления гуманизированный анти-CD19 связывающий домен связан с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной в настоящем документе. В одном варианте осуществления закодированная шарнирная область содержит SEQ ID NO: 14 или SEQ ID NO: 45, или последовательность, имеющую 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула CAR дополнительно содержит последовательность, кодирующую костимулирующий домен, например, костимулирующий домен, описанный в настоящем документе. В одном варианте осуществления костимулирующий домен содержит функциональный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137). В одном варианте осуществления костимулирующий домен содержит последовательность SEQ ID NO: 16. В одном варианте осуществления костимулирующий домен содержит последовательность SEQ ID NO: 51. В одном варианте осуществления костимулирующий домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 51, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16 или SEQ ID NO: 51.

В одном варианте осуществления выделенная молекула CAR дополнительно содержит последовательность, кодирующую внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 и/или последовательность SEQ ID NO: 17. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 и/или последовательность SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит функциональный сигнальный домен CD27 и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 51 и/или последовательность SEQ ID NO: 17. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 51 и/или последовательность SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 43, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательностью SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 или SEQ ID NO: 51 и последовательность SEQ ID NO: 17 или SEQ ID NO: 43, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессируются в одной и той же рамке считывания и в виде одной полипептидной цепи.

В одном варианте осуществления выделенная молекула CAR дополнительно содержит лидерную последовательность, например, лидерную последовательность, описанную в настоящем документе. В одном варианте осуществления лидерная последовательность содержит аминокислотную последовательность SEQ ID NO: 13 или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 13.

В другом аспекте изобретение относится к выделенной молекуле CAR, содержащей лидерную последовательность, например, лидерную последовательность, описанную в настоящем документе, например, лидерную последовательность SEQ ID NO: 13, или имеющую 95-99% идентичности с ней; гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, содержащий LC CDR1, LC CDR2, LC CDR3, HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, приведенный в таблице 3, или последовательность, имеющую 95-99% идентичности с ним; шарнирную область, например, шарнирную область, описанную в настоящем документе, например, шарнирную область SEQ ID NO: 14 или имеющую 95-99% идентичности с ней; трансмембранный домен, например, трансмембранный домен, описанный в настоящем документе, например, трансмембранный домен, имеющий последовательность SEQ ID NO: 15 или последовательность, имеющую 95-99% идентичности с ней; внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или a основной сигнальный домен). В одном варианте осуществления внутриклеточный сигнальный домен содержит костимулирующий домен, например, костимулирующий домен, описанный в настоящем документе, например, костимулирующий домен 4-1BB, имеющий последовательность SEQ ID NO: 16 или SEQ ID NO: 51, или имеющий 95-99% идентичности с ними, и/или основной сигнальный домен, например, основной сигнальный домен, описанный в настоящем документе, например, сигнальный домен CD3-дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 43, или имеющий 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула CAR содержит (например, состоит из) аминокислотную последовательность SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42, или аминокислотную последовательность, имеющую по меньшей мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более чем 60, 50 или 40 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42, или аминокислотную последовательность, имеющую 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичности с аминокислотной последовательностью SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42.

В одном аспекте изобретение относится к гуманизированному анти-CD19 связывающему домену, содержащему одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) анти-CD19 связывающего домена, описанного в настоящем документе, и одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит вариабельную область легкой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12), и/или вариабельную область тяжелой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12. В одном из вариантов осуществления гуманизированный анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

В другом аспекте изобретение относится к вектору, содержащему последовательность нуклеиновой кислоты, кодирующую CAR. В одном варианте осуществления вектор выбран из группы, состоящей из ДНК, РНК, плазмиды, лентивирусного вектора, аденовирусного вектора или ретровирусного вектора.

В одном варианте осуществления вектор представляет собой лентивирусный вектор. В одном варианте осуществления вектор дополнительно содержит промотор. В одном варианте осуществления промотор представляет собой промотор EF-1. В одном варианте осуществления промотор EF-1 содержит последовательность SEQ ID NO: 100.

В одном варианте осуществления вектор представляет собой in vitro транскрибируемый вектор, например, вектор, который транскрибирует РНК молекулы нуклеиновой кислоты, описанной в настоящем документе. В одном варианте осуществления последовательность нуклеиновой кислоты в векторе дополнительно содержит поли(A)-последовательность, например, поли(A)-последовательность, описанную в настоящем документе, например, содержащую примерно 150 оснований аденозина (SEQ ID NO: 104). В одном варианте осуществления последовательность нуклеиновой кислоты в векторе дополнительно содержит 3'UTR, например, 3'UTR, описанную в настоящем документе, например, содержащую по меньшей мере один повтор 3'UTR из бета-глобулина человека. В одном варианте осуществления последовательность нуклеиновой кислоты в векторе дополнительно содержит промотор, например, промотор T2A.

В другом аспекте изобретение относится к клетке, содержащей вектор. В одном варианте осуществления клетка представляет собой человеческую T-клетку. В одном варианте осуществления клетка представляет собой клетку, описанную в настоящем документе, например, человеческую T-клетку, например, человеческую T-клетку, описанную в настоящем документе. В одном варианте осуществления человеческая T-клетка представляет собой CD8+ T-клетку.

В другом варианте осуществления CAR-экспрессирующая клетка, описанная в настоящем документе, может дополнительно экспрессировать другой агент, например, агент, повышающий активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агент может быть агентом, который ингибирует ингибирующую молекулу. Примеры ингибирующих молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR-бета. В одном варианте осуществления агент, который ингибирует ингибирующую молекулу, содержит первый полипептид, например, ингибирующую молекулу, связанный со вторым полипептидом, который обеспечивает положительный сигнал для клетки, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления агент содержит первый полипептид, например, ингибирующую молекулу, такую как PD1, LAG3, CTLA4, CD160, BTLA, LAIR1, TEVI3, 2B4 и TIGIT, или фрагмент любой из них (например, по меньшей мере часть внеклеточного домена любой из них), и второй полипептид, который представляет собой внутриклеточный сигнальный домен, описанный в настоящем документе (например, содержащий костимулирующий домен (например, 41BB, CD27 или CD28, например, описанные в настоящем документе) и/или основной сигнальный домен (например, сигнальный домен CD3-дзета, описанный в настоящем документе). В одном варианте осуществления агент содержит первый полипептид молекулы PD1 или ее фрагмент (например, по меньшей мере часть внеклеточного домена PD1) и второй полипептид внутриклеточного сигнального домена, описанного в настоящем документе (например, сигнального домена CD28, описанного в настоящем документе, и/или сигнального домена CD3-дзета, описанного в настоящем документе).

В другом аспекте изобретение относится к способу получения клетки, включающему трансдуцирование T-клетки вектором, содержащим нуклеиновую кислоту, кодирующую CAR, например, CAR, описанный в настоящем документе.

Настоящее изобретение также относится к способу получения популяции клеток с генетически измененной РНК, например, клеток, описанных в настоящем документе, например, T-клеток, временно экспрессирующих экзогенную РНК. Способ включает введение in vitro транскрибированной РНК или синтетической РНК в клетку, при этом РНК содержит нуклеиновую кислоту, кодирующую молекулу CAR, описанную в настоящем документе.

В другом аспекте изобретение относится к способу создания противоопухолевого иммунитета у млекопитающего, включающему введение млекопитающему эффективного количества клетки, содержащей молекулу CAR, например, клетки, экспрессирующей молекулу CAR, описанную в настоящем документе. В одном варианте осуществления клетка представляет собой аутологичную T-клетку. В одном варианте осуществления клетка представляет собой аллогенную Т-клетку. В одном варианте осуществления млекопитающее является человеком.

В другом аспекте изобретение относится к способу лечения млекопитающего, страдающего заболеванием, ассоциированным с экспрессией CD19, включающему введение млекопитающему эффективного количества клетки, содержащей молекулу CAR, например, молекулу CAR, описанную в настоящем документе.

В одном варианте осуществления заболевание, ассоциированное с экспрессией CD19, выбирают из пролиферативного заболевания, такого как рак или злокачественное новообразование или предраковое состояние, такое как миелодисплазия, миелодиспластический синдром или предлейкоз, или оно представляет собой не относящиеся к раку симптомы, ассоциированные с экспрессией CD19. В одном варианте осуществления заболевание представляет собой рак крови. В одном варианте осуществления рак крови представляет собой лейкоз. В одном варианте осуществления рак выбирают из группы, состоящей из одной или более форм острого лейкоза, включая, но не ограничиваясь ими, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одной или более форм хронического лейкоза, включая, но не ограничиваясь ими, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL); других форм рака крови или патологических состояний крови, включая, но не ограничиваясь ими, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и заболевания, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, при которых экспрессируется CD19; а также любые их сочетания.

В одном варианте осуществления инфузию лимфоцитов, например, инфузию аллогенных лимфоцитов, используют в лечении рака, при этом вводимые инфузией лимфоциты содержат по меньшей мере одну CD19 CAR-экспрессирующую клетку. В одном варианте осуществления в лечении рака используют инфузию аутологичных лимфоцитов, при этом вводимые инфузией аутологичные лимфоциты содержат по меньшей мере одну CD19 CAR-экспрессирующую клетку.

В одном варианте осуществления CD19 CAR-экспрессирующую клетку, например, T-клетку, вводят субъекту, которому ранее была проведена трансплантация стволовых клеток, например, трансплантация аутологичных стволовых клеток.

В одном варианте осуществления CD19 CAR-экспрессирующую клетку, например, T-клетку, вводят субъекту, который ранее получал дозу мелфалана.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в сочетании с агентом, который повышает эффективность клетки, экспрессирующей молекулу CAR, например, агентом, описанным в настоящем документе.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в сочетании с агентом, который ослабляет один или более побочных эффектов, связанных с введением клетки, экспрессирующей молекулу CAR, например, агентом, описанным в настоящем документе.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в сочетании с агентом, который лечит заболевание, ассоциированное с CD19, например, агентом, описанным в настоящем документе.

В одном варианте осуществления, клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в дозе и/или в режиме дозирования, описанных в настоящем документе.

В одном варианте осуществления молекулу CAR вводят в T-клетки, например, с использованием in vitro транскрипции, и субъекту (например, человеку) первоначально вводят клетки, содержащие молекулу CAR, с одним или более последующими введениями клеток, содержащих молекулу CAR, при этом одно или более последующих введений выполняют через менее чем 15 дней, например, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 или 2 дней после предыдущего введения. В одном варианте осуществления более одного введения клеток, содержащих молекулу CAR, выполняют для субъекта (например, человека) в неделю, например, в неделю выполняют 2, 3 или 4 введения клеток, содержащих молекулу CAR. В одном варианте осуществления субъект (например, субъект-человек) получает более одного введения клеток, содержащих молекулу CAR, в неделю (например, 2, 3 или 4 введения в неделю) (что в настоящем документе также называют циклом), затем следует неделя без введения клеток, содержащих молекулу CAR, и вслед за этим одно или более дополнительных введений клеток, содержащих молекулу CAR, (например, более одного введения клеток, содержащих молекулу CAR, в неделю) выполняют для субъекта. В другом варианте осуществления субъект (например, субъект-человек) получает более одного цикла введения клеток, содержащих молекулу CAR, и период времени между циклами составляет менее 10, 9, 8, 7, 6, 5, 4 или 3 дней. В одном варианте осуществления клетки, содержащие молекулу CAR, вводят через день, что составляет 3 введения в неделю. В одном варианте осуществления клетки, содержащие молекулу CAR, вводят в течение по меньшей мере двух, трех, четырех, пяти, шести, семи, восьми или более недель.

В одном варианте осуществления, клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в качестве терапии первой линии для заболевания, например, рака, например, рака, описанного в настоящем документе. В другом варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в качестве терапии второй, третьей, четвертой линии лечения для заболевания, например, рака, например, рака, описанного в настоящем документе.

В одном варианте осуществления, вводят популяцию клеток, описанных в настоящем документе.

В другом аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей CAR по изобретению, выделенной молекуле полипептида CAR по изобретению, вектору, содержащему CAR по изобретению, а также клетке, содержащей CAR по изобретению, для использования в качестве лекарственного средства.

В другом аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей CAR по изобретению, выделенной молекуле полипептида CAR по изобретению, вектору, содержащему CAR по изобретению, а также клетке, содержащей CAR по изобретению, для использования в лечении заболевания, при котором экспрессируется CD19.

В одном аспекте изобретение относится к популяции аутологичных клеток, которые трансфицированы или трансдуцированы вектором, содержащим молекулу нуклеиновой кислоты, кодирующую молекулу CD19 CAR, например, описанную в настоящем документе. В одном варианте осуществления вектор представляет собой ретровирусный вектор. В одном варианте осуществления вектор представляет собой самоинактивирующийся лентивирусный вектор, описанный в другом разделе настоящего документа. В одном варианте осуществления вектор доставляют (например, путем трансфекции или электропорации) в клетку, например, T-клетку, при этом вектор содержит молекулу нуклеиновой кислоты, кодирующую молекулу CD19 CAR, описанную в настоящем документе, которая транскрибируется в виде молекулы мРНК, и молекула CD19 CAR транслируется с молекулы РНК и экспрессируется на поверхности клетки.

В другом аспекте настоящее изобретение относится к популяции CAR-экспрессирующих клеток, например, клеток CART. В некоторых вариантах осуществления популяция CAR-экспрессирующих клеток содержит смесь клеток, экспрессирующих различные CAR. Например, в одном варианте осуществления популяция клеток CART может содержать первую клетку, экспрессирующую CAR, имеющий анти-CD19 связывающий домен, описанный в настоящем документе, и вторую клетку, экспрессирующую CAR, имеющий другой анти-CD19 связывающий домен, например, анти-CD19 связывающий домен, описанный в настоящем документе, который отличается от анти-CD19 связывающего домена в CAR, экспрессируемом первой клеткой. В качестве другого примера, популяция CAR-экспрессирующих клеток может содержать первую клетку, экспрессирующую CAR, имеющий анти-CD19 связывающий домен, например, описанный в настоящем документе, и вторую клетку, экспрессирующую CAR, имеющий антигенсвязывающий домен для мишени, отличной от CD19 (например, CD123). В одном варианте осуществления популяция CAR-экспрессирующих клеток содержит, например, первую клетку, экспрессирующую CAR, имеющий основной внутриклеточный сигнальный домен, и вторую клетку, экспрессирующую CAR, имеющий вспомогательный сигнальный домен.

В другом аспекте настоящее изобретение относится к популяции клеток, в которой по меньшей мере одна клетка экспрессирует CAR, имеющий анти-CD19 домен, описанный в настоящем документе, и вторая клетка экспрессирует другой агент, например, агент, который повышает активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агент может представлять собой агент, который ингибирует ингибирующую молекулу. Примеры ингибирующих молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR-бета. В одном варианте осуществления агент, который ингибирует ингибирующую молекулу, содержит первый полипептид, например, ингибирующую молекулу, связанный со вторым полипептидом, который обеспечивает положительный сигнал для клетки, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления агент содержит первый полипептид, например, ингибирующую молекулу, такую как PD1, LAG3, CTLA4, CD160, BTLA, LAIR1, TEVI3, 2B4 и TIGIT, или фрагмент любой из них (например, по меньшей мере часть внеклеточного домена любой из них) и второй полипептид, который представляет собой внутриклеточный сигнальный домен, описанный в настоящем документе (например, содержащий костимулирующий домен (например, 41BB, CD27 или CD28, например, как описано в настоящем документе) и/или основной сигнальный домен (например, сигнальный домен CD3-дзета, описанный в настоящем документе). В одном варианте осуществления агент содержит первый полипептид молекулы PD1 или ее фрагмент (например, по меньшей мере часть внеклеточного домена PD1) и второй полипептид внутриклеточного сигнального домена, описанного в настоящем документе (например, сигнального домена CD28, описанного в настоящем документе, и/или сигнального домена CD3-дзета, описанного в настоящем документе).

В одном варианте осуществления молекула нуклеиновой кислоты, кодирующая молекулу CD19 CAR, например, описанную настоящем документе, экспрессируется в виде молекулы мРНК. В одном варианте осуществления генетически модифицированные CD19 CAR-экспрессирующие клетки, например, T-клетки, можно получать путем трансфекции или электропорации молекулы РНК, кодирующей нужные CAR (например, без последовательности вектора), в клетку. В одном варианте осуществления молекула CD19 транслируется с молекулы РНК после ее введения и экспрессируется на поверхности рекомбинантной клетки.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фигурах 1A, 1B и 1C графически представлены результаты анализа цитотоксичности с использованием T-клеток ND317 (нормальных донорских), трансдуцированных анти-CD19 CAR мыши или гуманизированными анти-CD19 CAR по изобретению и культивируемых либо с контрольными клетками K562, которые не экспрессируют CD19 (K562cc), как показано на фигуре 1A, клетками K562, трансформированными CD19 (K562.CD19), как показано на фигуре 1B, или злокачественными B-клетками, полученными от пациента с CLL (B-клеточный изолят Pt 14), как показано на фигуре 1C.

На фигурах 2A и 2B приведены графики, демонстрирующие пролиферативный ответ клеток, экспрессирующих гуманизированные и мышиные анти-CD19 CAR, на CD19+ клетки, при этом большее число жизнеспособных CAR+ T-клеток коррелирует с популяциями, демонстрирующими максимальную пролиферацию CD4+ и CD8+ T-клеток в ответ на первичные клетки CLL.

На фигуре 3 графически представлены развернутые ВЭЖХ масс-спектры для scFvs по изобретению, при этом верхний ряд соответствует необработанному scFv и нижний ряд соответствует родственному дегликозилированному scFv.

На фигуре 4 графически представлена конформационная стабильность по результатам измерения методом дифференциальной сканирующей флуориметрии. Tm для мышиных scFv составляла 57°C (жирная линия). Для всех гуманизированных вариантов scFv были характерны более высокие значения Tm около 70°C по сравнению с родительскими мышиными scFv. Остатки, введенные в процессе гуманизации, приводили к повышению Tm более чем на 10°C.

На фигуре 5 графически представлена пролиферация трансдуцированных CD19 CAR T-клеток, при этом клетки CART19 были направлены либо против (a) линии клеток хронического миелогенного лейкоза («CML»), которые отрицательны в отношении экспрессии CD19 и, вследствие этого, были использованы в качестве отрицательного контроля; (b) рекомбинантных клеток K562, которые положительны в отношении экспрессии CD19, и, вследствие этого, были использованы в качестве положительного контроля, или (c) B-клеток Pt14, полученных от пациента с CLL, которые экспрессируют CD19 на клеточной поверхности.

На фигурах 6A и 6B схематически изображены репрезентативные CAR.

На фигуре 7 показано прогрессирование первичного ALL заболевания HALLX5447 у мышей NSG после лечения трансдуцированными CD19 CAR T-клетками. Рост клеток первичного ALL человека у мышей NSG после лечения CAR T-клетками, специфичными в отношении CD19, продемонстрировал контроль над прогрессированием заболевания. Средний процент CD19+ ALL клеток человека в периферической крови у мышей NSG служил показателем бремени заболевания ко дню 65 после имплантации опухоли. Черные кружки: мыши получали 100 мкл PBS через хвостовую вену; красные квадраты: мыши получали суррогатные трансдуцированные T-клетки; синие треугольники: мыши получали трансдуцированные мышиным CD19 CAR T-клетки и перевернутые фиолетовые треугольники: мыши получали трансдуцированные гуманизированным CD19 CAR T-клетки. Статистическую значимость рассчитывали с помощью ANOVA; * обозначает P<0,01.

На фигуре 8 показана экспрессия CD19 в клетках опухоли пациента. CD138+CD45dim клетки опухоли окрашивали на CD19 (ось x) и CD38 (ось y).

ПОДРОБНОЕ ОПИСАНИЕ

Определения

Если не указано иное, все технические и научные термины, используемые в настоящем документе, имеют то же значение, которое им обычно придают специалисты в области, к которой относится изобретение.

Единственное число существительных соответствует грамматической форме «один или более чем один» (то есть, по меньшей мере один) объектов. В качестве примера, «элемент» означает один элемент или более чем один элемент.

Выражение «примерно», используемое применительно к измеряемой величине, такой как количество, временная продолжительность и тому подобное, охватывает вариации в пределах примерно ±20% или в некоторых случаях ±10%, или в некоторых случаях ±5%, или в некоторых случаях ±1%, или в некоторых случаях ±0,1% от указанного значения, поскольку такие вариации являются подходящими для осуществления описанных способов.

Термин «химерный антигенный рецептор» или, альтернативно, «CAR» относится к рекомбинантной полипептидной конструкции, содержащей по меньшей мере внеклеточный антигенсвязывающий домен, трансмембранный домен и цитоплазматический сигнальный домен (также называемый в настоящем документе «внутриклеточным сигнальным доменом»), содержащий функциональный сигнальный домен, полученный из стимулирующей молекулы, описанной ниже. В одном аспекте стимулирующая молекула представляет собой дзета-цепь, связанную с T-клеточным рецепторным комплексом. В одном аспекте цитоплазматический сигнальный домен дополнительно содержит один или более функциональных сигнальных доменов, полученных из по меньшей мере одной костимулирующей молекулы, описанной ниже. В одном аспекте костимулирующую молекулу выбирают из 4-1BB (то есть, CD137), CD27 и/или CD28. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий функциональный сигнальный домен, полученный из костимулирующей молекулы, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий два функциональных сигнальных домена, полученных из одной или более костимулирующих молекул, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий по меньшей мере два функциональных сигнальных домена, полученных из одной или более костимулирующих молекул, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR содержит необязательную лидерную последовательность на амино-конце (N-конце) слитого белка CAR. В одном аспекте CAR дополнительно содержит лидерную последовательность на N-конце внеклеточного узнающего антиген домена, при этом лидерная последовательность необязательно отщепляется от узнающего антиген домена (например, scFv) во время клеточного процессинга и локализации CAR на клеточной мембране.

Термин «сигнальный домен» относится к функциональной части белка, которая действует путем передачи информации в клетке для регуляции клеточной активности с помощью определенных сигнальных путей, генерируя вторичные мессенджеры или действуя в качестве эффекторов, отвечая на такие мессенджеры.

Используемый в настоящем документе термин «CD19» означает белок кластера дифференцировки 19, который представляет собой антигенную детерминанту, находящуюся на лейкозных клетках-предшественниках. Аминокислотные и нуклеотидные последовательности человека и мыши можно найти в общедоступной базе данных, такой как, GenBank, UniProt и Swiss-Prot. Например, аминокислотную последовательность человеческого CD19 можно найти под в UniProt/Swiss-Prot под регистрационным № P15391 и нуклеотидную последовательность, кодирующую человеческий CD19, можно найти под регистрационным № NM_001178098. CD19 экспрессируется на большинстве раковых клеток B-клеточной линии дифференцировки, включая, например, острый лимфобластный лейкоз, хронический лимфоцитарный лейкоз и неходжскинскую лимфому. Другие клетки, экспрессирующие CD19, приведены ниже, где дается определение «заболеванию, ассоциированному с экспрессией CD19». Он также является ранним маркером предшественников B-клеток. Смотри, например, Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997). В одном аспекте антигенсвязывающая часть CART узнает и связывает антиген во внеклеточном домене белка CD19. В одном аспекте белок CD19 экспрессируется на раковой клетке.

Используемый в настоящем документе термин «антитело» означает белок или полипептидную последовательность, полученную из молекулы иммуноглобулина, которая специфически связывается с антигеном. Антитела могут быть поликлональными или моноклональными, содержать несколько или одну цепь, или быть интактными иммуноглобулинами, и могут быть получены из природных источников или из рекомбинантных источников. Антитела могут представлять собой тетрамеры молекул иммуноглобулинов.

Термин «фрагмент антитела» означает по меньшей мере одну часть интактного антитела, или его рекомбинантных вариантов, и относится к антигенсвязывающему домену, например, связывающей антиген вариабельной области интактного антитела, достаточной для обеспечения узнавания и специфического связывания фрагмента антитела с мишенью, такой как антиген. Примеры фрагментов антитела включают, но не ограничиваются ими, Fab, Fab', F(ab')2, и Fv фрагменты, scFv фрагменты антитела, линейные антитела, однодоменные антитела, такие как одАт (sdAb) (либо VL, либо VH), домены VHH верблюдовых и мультиспецифические антитела, образованные из фрагментов антител. Термин «scFv» означает слитый белок, который содержит по меньшей мере один фрагмент антитела, содержащий вариабельную область легкой цепи, и по меньшей мере один фрагмент антитела, содержащий вариабельную область тяжелой цепи, при этом вариабельные области легкой и тяжелой цепи связаны последовательно с помощью короткого гибкого полипептидного линкера, и который может экспрессироваться в виде одноцепочечного полипептида, при этом scFv сохраняет специфичность интактного антитела, из которого он был получен. Если не указано иное, описанный в настоящем документе scFv может иметь вариабельные области VL и VH в любом порядке, например, в направлении от N-конца к C-концу полипептида scFv может содержать VL-линкер-VH или может содержать VH-линкер-VL.

Часть композиции CAR по изобретению, содержащего антитело или фрагмент этого антитела, может существовать в различных формах, в которых антигенсвязывающий домен экспрессируется в виде части непрерывной полипептидной цепи, включая, например, однодоменный фрагмент антитела (sdAb), одноцепочечное антитело (scFv) и гуманизированное антитело (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85: 5879-5883; Bird et al., 1988, Science 242: 423-426). В одном аспекте антигенсвязывающий домен композиции CAR по изобретению содержит фрагмент антитела. В другом аспекте CAR содержит фрагмент антитела, представляющий собой scFv.

Термин «тяжелая цепь антитела» означает большую по размеру из полипептидных цепей двух типов, присутствующих в молекулах антител в естественных конформациях, и которая, как правило, определяет класс, к которому относится антитело.

Термин «легкая цепь антитела» означает меньшую по размеру из полипептидных цепей двух типов, присутствующих в молекулах антител в естественных конформациях. Легкие цепи каппа (κ) и лямбда (λ) относятся к двум основным изотипам легких цепей антитела.

Термин «рекомбинантное антитело» означает антитело, которое получено с использованием технологии рекомбинантной ДНК, такое как, например, антитело, экспрессированное в системе экспрессии бактериофагов или дрожжей. Термин также должен означать антитело, которое было получено путем синтеза молекулы ДНК, кодирующей антитело, и с этой молекулы ДНК осуществляется экспрессия белка антитела или аминокислотной последовательности, точно определяющей антитело, при этом ДНК или аминокислотная последовательность получены с использованием технологий рекомбинантной ДНК или аминокислотной последовательности, которые доступны и широко известны в данной области.

Термин «антиген» или «Ag» означает молекулу, которая вызывает иммунный ответ. Этот иммунный ответ может включать либо продуцирование антител, либо активацию специфических иммунологически компетентных клеток, либо и то и другое. Специалист в данной области понимает, что любая макромолекула, включая практически все белки или пептиды, может служить в качестве антигена. Кроме того, антигены могут быть получены из рекомбинантной или геномной ДНК. Специалист в данной области понимает, что любая ДНК, которая содержит нуклеотидную последовательность или частичную нуклеотидную последовательность, кодирующую белок, вызывающий иммунный ответ, таким образом, кодирует «антиген» в соответствии с определением, используемым в настоящем документе. Кроме того, специалист в данной области понимает, что антиген не обязательно должен кодироваться исключительно полноразмерной нуклеотидной последовательностью гена. Очевидно, что настоящее изобретение включает, но без ограничения, использование частичной нуклеотидной последовательности более чем одного гена, и что эти нуклеотидные последовательности расположены в различных комбинациях для кодирования полипептидов, которые вызывают желательный иммунный ответ. Более того, специалист в данной области понимает, что антиген вовсе не обязательно должен кодироваться «геном». Очевидно, что антиген может быть синтезирован или может быть получен из биологического образца, или может быть другой макромолекулой помимо полипептида. Такой биологический образец может включать, но не ограничивается ими, образец ткани, образец опухоли, клетку или жидкость с другими биологическими компонентами.

Термин «противоопухолевый эффект» означает биологический эффект, который может проявляться различными способами, включая, но не ограничиваясь ими, например, уменьшение объема опухоли, уменьшение количества клеток опухоли, уменьшение количества метастазов, увеличение ожидаемой продолжительности жизни, уменьшение пролиферации клеток опухоли, уменьшение выживаемости клеток опухоли или ослабление различных физиологических симптомов, ассоциированных с раком. «Противоопухолевый эффект» также может проявляться за счет способности пептидов, полинуклеотидов, клеток и антител по изобретению изначально предотвращать возникновение опухоли.

Термин «аутологичный» относится к любому материалу, полученному от того же индивидуума, которому он впоследствии будет повторно введен.

Термин «аллогенный» относится к любому материалу, полученному от другого животного того же вида, что и индивидуум, которому вводят материал. Говорят, что два или более индивидуумов являются аллогенными по отношению друг к другу, когда гены в одном или более локусах не идентичны. В некоторых аспектах аллогенный материал от индивидуумов одного и того же вида может в достаточной степени различаться генетически, чтобы являться антигенным.

Термин «ксеногенный» относится к трансплантату, полученному от животного другого вида.

Термин «рак» относится к заболеванию, характеризующемуся быстрым и неконтролируемым ростом аберрантных клеток. Раковые клетки могут распространяться локально или через кровеносную и лимфатическую систему к другим частям тела. Примеры различных видов рака описаны в настоящем документе и включают, но не ограничиваются ими, рак молочной железы, рак предстательной железы, рак яичников, рак шейки матки, рак кожи, рак поджелудочной железы, колоректальный рак, рак почки, рак печени, рак головного мозга, лимфому, лейкоз, рак легкого и тому подобное.

Определение «заболевание, ассоциированное с экспрессией CD19» охватывает, но не ограничивается ими, заболевание, ассоциированное с экспрессией CD19, или состояние, ассоциированное с клетками, которые экспрессируют CD19, включая, например, пролиферативные заболевания, такие как рак или злокачественное новообразование, или предраковое состояние, такое как миелодисплазия, миелодиспластический синдром или предлейкоз, или не относящиеся к раку симптомы, ассоциированные с клетками, которые экспрессируют CD19. В одном аспекте рак, ассоциированный с экспрессией CD19, представляет собой рак крови. В одном аспекте рак крови представляет собой лейкоз или лимфому. В одном аспекте рак, ассоциированный с экспрессией CD19, включает формы рака и злокачественные новообразования, в том числе, но не ограничиваясь ими, например, одну или более форм острого лейкоза, включая, но не ограничиваясь ими, например, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одну или более форм хронического лейкоза, включая, но не ограничиваясь ими, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL). Другие формы рака крови или патологические состояния крови, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и тому подобное. Другие заболевания, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, ассоциированные с экспрессией CD19. Не относящиеся к раку симптомы, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, аутоиммунное заболевание (например, волчанку), воспалительные заболевания (аллергию и астму) и трансплантацию.

Термин «консервативные модификации последовательности» относится к аминокислотным модификациям, которые существенно не влияют или не изменяют характеристики связывания антитела или фрагмента антитела, содержащего аминокислотную последовательность. Такие консервативные модификации включают аминокислотные замены, добавления и делеции. Модификации можно вносить в антитело или фрагмент антитела по изобретению стандартными методами, известными в данной области, такими как сайт-направленный мутагенез и ПЦР-опосредованный мутагенез. Консервативные аминокислотные замены представляют собой такие замены, при которых аминокислотный остаток заменяется аминокислотным остатком, имеющим аналогичную боковую цепь. Семейства аминокислотных остатков, имеющих аналогичные боковые цепи, известны в данной области. Эти семейства включают аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислотными боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин, триптофан), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин). Таким образом, один или более аминокислотных остатков в CAR по изобретению можно заменять другими аминокислотными остатками из семейства остатков с такими же боковыми цепями, и измененный CAR можно тестировать с использованием функциональных анализов, описанных в настоящем документе.

Термин «стимуляция» означает первичный ответ, индуцированный связыванием стимулирующей молекулы (например, комплекса TCR/CD3) с родственным ей лигандом, тем самым опосредуется событие передачи сигнала, такое как, но без ограничения, передача сигнала через комплекс TCR/CD3. Стимуляция может опосредовать изменение экспрессии некоторых молекул, например, понижающую регуляцию TGF-β, и/или реорганизацию структур цитоскелета и тому подобное.

Термин «стимулирующая молекула» означает молекулу, экспрессируемую T-клеткой, которая обеспечивает основную цитоплазматическую сигнальную последовательность(и), регулирующие основную активацию комплекса TCR стимулирующим образом для по меньшей мере некоторых аспектов T-клеточного сигнального пути. В одном аспекте основной сигнал инициируется, например, связыванием комплекса TCR/CD3 с молекулой MHC, нагруженной пептидом, что приводит к опосредованию T-клеточного ответа, включая, но без ограничения, пролиферацию, активацию, дифференцировку и тому подобное. Основная цитоплазматическая сигнальная последовательность (также называемая «основным сигнальным доменом»), которая действует стимулирующим образом, может содержать сигнальный мотив, который известен как тирозин-содержащий мотив активации иммунных рецепторов или ITAM. Примеры ITAM-содержащих основных цитоплазматических сигнальных последовательностей, которые особенно полезны для данного изобретения, включают, но не ограничиваются ими, те, которые получены из TCR-дзета, FcR-гамма, FcR-бета, CD3-гамма, CD3-дельта, CD3-эпсилон, CD5, CD22, CD79a, CD79b, CD278 (также известного как «ICOS») и CD66d. В конкретных CAR по изобретению внутриклеточный сигнальный домен в любом одном или более CAR по изобретению содержит внутриклеточную сигнальную последовательность, например, основную сигнальную последовательность CD3-дзета. В конкретных CAR по изобретению основная сигнальная последовательность CD3-дзета представляет собой последовательность, приведенную в SEQ ID NO: 17, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного. В конкретном CAR по изобретению основная сигнальная последовательность CD3-дзета представляет собой последовательность, приведенную в SEQ ID NO: 43, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного.

Термин «антигенпредставляющая клетка» или «АПК» относится к клетке иммунной системы, такой как вспомогательная клетка (например, B-клетка, дендритная клетка и тому подобное), которая экспонирует чужеродный антиген в комплексе с главными комплексами гистосовместимости (MHC) на своей поверхности. T-клетки могут узнавать эти комплексы при помощи их T-клеточных рецепторов (TCR). АПК процессируют антигены и представляют их T-клеткам.

Используемый в настоящем документе термин «внутриклеточный сигнальный домен» означает внутриклеточную часть молекулы. Внутриклеточный сигнальный домен генерирует сигнал, который стимулирует иммунную эффекторную функцию CAR-содержащей клетки, например, CART-клетки. Примеры иммунной эффекторной функции, например, в CART-клетке, включают цитолитическую активность и хелперную активность, в том числе секрецию цитокинов.

В одном из вариантов осуществления внутриклеточный сигнальный домен может содержать основной внутриклеточный сигнальный домен. Иллюстративные основные внутриклеточные сигнальные домены включают те, которые получены из молекул, ответственных за основную стимуляцию или антиген-зависимую стимуляцию. В одном из вариантов осуществления внутриклеточный сигнальный домен может содержать костимулирующий внутриклеточный домен. Иллюстративные костимулирующие внутриклеточные сигнальные домены включают те, которые получены из молекул, ответственных за костимулирующие сигналы или антиген-независимую стимуляцию. Например, в случае CART основной внутриклеточный сигнальный домен может содержать цитоплазматическую последовательность T-клеточного рецептора, и костимулирующий внутриклеточный сигнальный домен может содержать цитоплазматическую последовательность из корецептора или костимулирующей молекулы.

Основной внутриклеточный сигнальный домен может содержать сигнальный мотив, который известен как тирозин-содержащий мотив активации иммунных рецепторов или ITAM. Примеры ITAM-содержащих основных цитоплазматических сигнальных последовательностей включают, но не ограничиваются ими, те, которые получены из CD3-дзета, FcR-гамма, FcR-бета, CD3-гамма, CD3-дельта, CD3-эпсилон, CD5, CD22, CD79a, CD79b, а также CD66d DAP10 и DAP12.

Термин «дзета» или, альтернативно, «дзета-цепь», «CD3-дзета» или «TCR-дзета» относится к белку, имеющему регистрационный № GenBan BAG36664.1, или эквивалентным остаткам из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного, и «стимулирующий домен дзета» или, альтернативно, «стимулирующий домен CD3-дзета» или «стимулирующий домен TCR-дзета» определяют как аминокислотные остатки из цитоплазматического домена дзета-цепи, которые достаточны для функциональной передачи первичного сигнала, необходимого для активации T-клетки. В одном аспекте цитоплазматический домен дзета содержит остатки с 52 по 164 в белке с регистрационным № GenBank BAG36664.1 или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного, которые являются его функциональными ортологами. В одном аспекте «стимулирующий домен дзета» или «стимулирующий домен CD3-дзета» представляет собой последовательность, приведенную в SEQ ID NO: 17. В одном аспекте «стимулирующий домен дзета» или «стимулирующий домен CD3-дзета» представляет собой последовательность, приведенную в SEQ ID NO: 43.

Термин «костимулирующая молекула» относится к родственному связывающемуся партнеру на T-клетке, который специфически связывается с костимулирующим лигандом, тем самым опосредуя костимулирующий ответ T-клетки, такой как, но без ограничения, пролиферация. Костимулирующие молекулы представляют собой молекулы клеточной поверхности, отличные от рецепторов антигена или их лигандов, которые необходимы для эффективного иммунного ответа. Костимулирующие молекулы включают, но не ограничиваются ими, молекулы MHC класса I, BTLA и Toll-подобный рецептор, а также OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18) и 4-1BB (CD137).

Костимулирующий внутриклеточный сигнальный домен может представлять собой внутриклеточную часть костимулирующей молекулы. Костимулирующая молекула может быть представлена в следующих семействах белков: белки-рецепторы TNF, иммуноглобулиноподобные белки, рецепторы цитокинов, интегрины, сигнальные молекулы активации лимфоцитов (белки SLAM) и активирующие NK-клетки рецепторы. Примеры таких молекул включают CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, ассоциированный с функцией лимфоцитов антиген-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, лиганд, который специфически связывается с CD83, и тому подобное.

Внутриклеточный сигнальный домен может содержать всю внутриклеточную часть, или весь нативный внутриклеточный сигнальный домен, молекулы, из которой он получен, либо ее функциональный фрагмент.

Термин «4-1BB» относится к члену суперсемейства TNFR с аминокислотной последовательностью, имеющей регистрационный № GenBank AAA62478.2, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного; и «костимулирующий домен 4-1BB» определяют как аминокислотные остатки 214-255 белка с регистрационным № GenBank AAA62478.2, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного. В одном аспекте «костимулирующий домен 4-1BB» представляет собой последовательность, приведенную в SEQ ID NO: 16 или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного.

Термин «кодирующий» относится к внутреннему свойству определенных последовательностей нуклеотидов в полинуклеотиде, таком как ген, кДНК или мРНК, служить в качестве матриц для синтеза в биологических процессах других полимеров и макромолекул, имеющих либо определенную последовательность нуклеотидов (например, рРНК, тРНК и мРНК), либо определенную последовательность аминокислот и вытекающие из этого биологические свойства. Таким образом, ген, кДНК или РНК кодирует белок, если транскрипция и трансляция мРНК, соответствующей данному гену, приводит к образованию белка в клетке или другой биологической системе. Как кодирующая цепь, нуклеотидная последовательность которой идентична последовательности мРНК и, как правило, приводится в списках последовательностей, так и некодирующая цепь, используемая в качестве матрицы для транскрипции гена или кДНК, может быть названа кодирующей белок или другой продукт данного гена или кДНК.

Если не указано иное, выражение «нуклеотидная последовательность, кодирующая аминокислотную последовательность» подразумевает все нуклеотидные последовательности, которые являются вырожденными вариантами друг друга и которые кодируют одну и ту же аминокислотную последовательность. Выражение «нуклеотидная последовательность, кодирующая белок или РНК» может также включать интроны в случае, если нуклеотидная последовательность, кодирующая белок, может в некоторых вариантах содержать интрон(ы).

Термины «эффективное количество» или «терапевтически эффективное количество» используются в настоящем документе взаимозаменяемо и относятся к количеству соединения, препарата, материала или композиции, описанных в настоящем документе, которое эффективно для достижения конкретного биологического результата.

Термин «эндогенный» относится к любому материалу, полученному из, или продуцируемому в организме, клетке, ткани или системе.

Термин «экзогенный» относится к любому материалу, введенному извне или продуцируемому вне организма, клетки, ткани или системы.

Термин «экспрессия» означает транскрипцию и/или трансляцию конкретной нуклеотидной последовательности, управляемую промотором.

Термин «вектор переноса» означает композицию химически связанных компонентов, содержащую выделенную нуклеиновую кислоту, которую можно использовать для доставки выделенной нуклеиновой кислоты внутрь клетки. Множество векторов известно в данной области, включая, но не ограничиваясь ими, линейные полинуклеотиды, полинуклеотиды, связанные с ионными или амфифильными соединениями, плазмиды и вирусы. Таким образом, термин «вектор переноса» включает автономно реплицирующуюся плазмиду или вирус. Следует понимать, что термин также включает не-плазмидные и не-вирусные соединения, которые облегчают перенос нуклеиновой кислоты в клетки, такие как, например, соединение полилизина, липосомы и тому подобное. Примеры вирусных векторов переноса включают, но не ограничиваются ими, аденовирусные векторы, аденоассоциированные вирусные векторы, ретровирусные векторы, лентивирусные векторы и тому подобное.

Термин «экспрессионный вектор» означает вектор, содержащий рекомбинантный полинуклеотид, содержащий последовательности контроля экспрессии, функционально связанные с экспрессируемой нуклеотидной последовательностью. Экспрессионный вектор содержит достаточно цис-действующих элементов для экспрессии; другие элементы для экспрессии могут быть представлены клеткой-хозяином или присутствовать в in vitro системе экспрессии. Экспрессионные векторы включают все, которые известны в данной области, в том числе космиды, плазмиды (например, «голые» или содержащиеся в липосомах) и вирусы (например, лентивирусы, ретровирусы, аденовирусы и аденоассоциированные вирусы), которые включают рекомбинантный полинуклеотид.

Термин «лентивирус» служит для обозначения рода семейства Retroviridae. Лентивирусы являются уникальными среди ретровирусов тем, что они способны инфицировать неделящиеся клетки; они способны доставлять значительное количество генетической информации в ДНК клетки-хозяина, таким образом, они являются одним из наиболее эффективных вариантов вектора для доставки генов. HIV, SIV и FIV являются примерами лентивирусов.

Термин «лентивирусный вектор» относится к вектору, полученному из по меньшей мере части лентивирусного генома, включая, в частности, самоинактивирующийся лентивирусный вектор, предложенный в статье Milone et al., Mol. Ther. 17(8): 1453-1464 (2009). Другие примеры лентивирусных векторов, которые могут быть использованы в клинической практике, включают, но не ограничиваются ими, например, технологию доставки генов LENTIVECTOR® от компании Oxford BioMedica, векторную систему LENTIMAX™ от компании Lentigen и тому подобное. Не применяемые в клинической практике виды лентивирусных векторов также доступны и известны специалистам в данной области.

Термин «гомологичные» или «идентичность» относится к идентичности последовательностей субъединиц между двумя полимерными молекулами, например, между двумя молекулами нуклеиновой кислоты, например, двумя молекулами ДНК или двумя молекулами РНК, или между двумя полипептидными молекулами. Если положение субъединицы в обеих из двух молекул занято одной и той же мономерной субъединицей, например, если положение в каждой из двух молекул ДНК занято остатком аденина, тогда они являются гомологичными или идентичными по данному положению. Гомология между двумя последовательностями напрямую зависит от числа совпадающих или гомологичных положений; например, если половина положений (например, пять положений в полимере длиной десять субъединиц) в двух последовательностях являются гомологичными, то две последовательности являются гомологичными на 50%; если 90% положений (например, 9 из 10), являются совпадающими или гомологичными, то две последовательности являются гомологичными на 90%.

«Гуманизированные» формы антител, отличных от человеческих (например, мышиных), представляют собой химерные иммуноглобулины, цепи иммуноглобулинов или их фрагменты (такие как Fv, Fab, Fab', F(ab')2, или другие антигенсвязывающие подпоследовательности антител), которые содержат минимальную последовательность, происходящую из иммуноглобулина, не принадлежащего человеку. По большей части, гуманизированные антитела и фрагменты антител представляют собой человеческие иммуноглобулины (реципиентное антитело или фрагмент антитела), в которых остатки из определяющей комплементарность области (CDR) реципиента заменены на остатки из CDR видов, отличных от человека (донорское антитело), например, мыши, крысы или кролика, имеющие нужную специфичность, аффинность и функциональную возможность. В некоторых случаях остатки каркасной области Fv (FR) человеческого иммуноглобулина заменены соответствующими остатками, не принадлежащими человеку. Более того, гуманизированное антитело/фрагмент антитела может содержать остатки, которые не встречаются ни в реципиентном антителе, ни в привнесенных последовательностях CDR или каркаса. Такие модификации способны дополнительно усовершенствовать и оптимизировать эффективность антитела или фрагмента антитела. Как правило, гуманизированное антитело или фрагмент этого антитела будет содержать практически все из по меньшей мере одного, и как правило, двух вариабельных доменов, в которых все или практически все из областей CDR, соответствующие таковым из иммуноглобулина, отличного от человеческого, и все или значительная часть из областей FR являются последовательностями человеческого иммуноглобулина. Гуманизированное антитело или фрагмент антитела может также содержать по меньшей мере часть константной области (Fc) иммуноглобулина, как правило, человеческого иммуноглобулина. Для получения более подробной информации, смотри Jones et al., Nature, 321: 522-525, 1986; Reichmann et al., Nature, 332: 323-329, 1988; Presta, Curr. Op. Struct. Biol., 2: 593-596, 1992.

Термин «полностью человеческий» относится к иммуноглобулину, такому как антитело или фрагмент антитела, в случае, когда целая молекула происходит из организма человека или состоит из аминокислотной последовательности, идентичной человеческой форме антитела или иммуноглобулина.

Термин «выделенный» означает измененный или удаленный из естественного окружения. Например, нуклеиновая кислота или пептид, естественным образом присутствующие в организме животного, не являются «выделенными», однако та же нуклеиновая кислота или тот же пептид, частично или полностью отделенные от присутствующих естественным образом в их окружении материалов, являются «выделенными». Выделенная нуклеиновая кислота или белок может существовать в практически очищенной форме или может существовать в неестественном для нее/него окружении, таком как, например, клетка-хозяин.

В контексте настоящего изобретения использованы следующие сокращения для часто встречающихся оснований нуклеиновой кислоты. «A» означает аденозин, «C» означает цитозин, «G» означает гуанозин, «T» означает тимидин и «U» означает уридин.

Термины «функционально связанные» или «транскрипционный контроль» относятся к функциональной связи между регуляторной последовательностью и гетерологичной нуклеотидной последовательностью, результатом чего является экспрессия последней. Например, первая нуклеотидная последовательность является функционально связанной со второй нуклеотидной последовательностью, если первая нуклеотидная последовательность находится в функциональной связи со второй нуклеотидной последовательностью. Например, промотор функционально связан с кодирующей последовательностью, если промотор влияет на транскрипцию или экспрессию кодирующей последовательности. Функционально связанные последовательности ДНК могут быть смежными друг с другом и, например, если необходимо соединить две кодирующие белок области, находиться в одной и той же рамке считывания.

Термин «парентеральное» введение иммуногенной композиции включает, например, подкожную (п/к), внутривенную (в/в), внутримышечную (в/м) или интрастернальную инъекцию, способы внутриопухолевого введения или инфузию.

Термины «нуклеиновая кислота» или «полинуклеотид» относятся к дезоксирибонуклеиновым кислотам (ДНК) или рибонуклеиновым кислотам (РНК), а также их полимерам, как в одноцепочечной, так и в двухцепочечной форме. Если нет конкретных ограничений, термин охватывает нуклеиновые кислоты, содержащие известные аналоги природных нуклеотидов, которые имеют свойства связывания, аналогичные таковым у эталонной нуклеиновой кислоты, и метаболизируются аналогично природным нуклеотидам. Если нет иных указаний, конкретная последовательность нуклеиновой кислоты также косвенно охватывает ее консервативно модифицированные варианты (например, замены вырожденных кодонов), аллели, ортологи, ОНП (SNP) и комплементарные последовательности, а также последовательность, указанную в явной форме. В частности, замены вырожденных кодонов можно осуществлять путем создания последовательностей, в которых в третьем положении одного или более выбранных (или всех) кодонов имеет место замена смешанными основаниями и/или остатками дезоксиинозина (Batzer et al., Nucleic Acid Res. 19: 5081 (1991); Ohtsuka et al., J. Biol. Chem. 260: 2605-2608 (1985) и Rossolini et al., Mol. Cell. Probes 8: 91-98 (1994)).

Термины «пептид», «полипептид» и «белок» используются взаимозаменяемо и относятся к соединению, состоящему из аминокислотных остатков, ковалентно связанных пептидными связями. Белок или пептид должен содержать по меньшей мере две аминокислоты, и никаких ограничений не накладывается на максимальное количестве аминокислот, которые могут составлять белковую или пептидную последовательность. Полипептиды включают любой пептид или белок, содержащий две или более аминокислот, связанных друг с другом пептидными связями. Используемый в настоящем документе термин относится как к коротким цепям, которые также обычно называются в данной области пептидами, олигопептидами и олигомерами, например, так и к более длинным цепям, как правило, называемым в данной области белками, которые бывают самых разных типов. «Полипептиды» включают, например, биологически активные фрагменты, в значительной степени гомологичные полипептиды, олигопептиды, гомодимеры, гетеродимеры, варианты полипептидов, модифицированные полипептиды, производные, аналоги, слитые белки, в числе прочих. Полипептид включает природный пептид, рекомбинантный пептид или их сочетание.

Термин «промотор» означает последовательность ДНК, узнаваемую синтетическим аппаратом клетки или привнесенным синтетическим аппаратом, необходимую для инициации специфической транскрипции полинуклеотидной последовательности.

Термин «промотор/регуляторная последовательность» означает нуклеотидную последовательность, которая необходима для экспрессии продукта гена, функционально связанного с промотором/регуляторной последовательностью. В некоторых случаях данная последовательность может представлять собой базовую последовательность промотора, а в других случаях данная последовательность может также включать последовательность энхансера и другие регуляторные элементы, необходимые для экспрессии продукта гена. Промотор/регуляторная последовательность может, например, быть последовательностью, которая приводит к экспрессии продукта гена тканеспецифичным образом.

Термин «конститутивный» промотор означает нуклеотидную последовательность, которая, будучи функционально связанной с полинуклеотидом, кодирующим или определяющим продукт гена, вызывает продуцирование в клетке продукта гена при большинстве или всех физиологических условиях в клетке.

Термин «индуцируемый» промотор означает нуклеотидную последовательность, которая, будучи функционально связанной с полинуклеотидом, кодирующим или определяющим продукт гена, вызывает продуцирование в клетке продукта гена практически только тогда, когда соответствующий промотору индуктор присутствует в клетке.

Термин «тканеспецифичный» промотор означает нуклеотидную последовательность, которая, будучи функционально связанной с полинуклеотидом, кодирующим или определяющим продукт гена, вызывает продуцирование в клетке продукта гена практически только в том случае, если клетка является клеткой ткани, тип которой соответствует промотору.

Термин «гибкий полипептидный линкер» или «линкер», используемый в контексте scFv, означает пептидный линкер, состоящий из таких аминокислот, как остатки глицина и/или серина, используемые отдельно или в сочетании для связывания вместе вариабельной области тяжелой цепи и вариабельной области легкой цепи. В одном варианте осуществления гибкий полипептидный линкер представляет собой Gly/Ser линкер и содержит аминокислотную последовательность (Gly-Gly-Gly-Ser)n, where n является положительным целым числом, равным или большим, чем 1. Например, n=1, n=2, n=3, n=4, n=5 и n=6, n=7, n=8, n=9 и n=10 (SEQ ID NO: 105). В одном варианте осуществления гибкие полипептидные линкеры включают, но не ограничиваются ими, (Gly4 Ser)4 (SEQ ID NO: 106) или (Gly4 Ser)3 (SEQ ID NO: 107). В другом варианте осуществления линкеры включают несколько повторов из (Gly2Ser), (GlySer) или (Gly3Ser) (SEQ ID NO: 108). В объем изобретения также входят линкеры, описанные в WO 2012/138475, содержание которого включено в настоящий документ посредством ссылки).

Используемый в настоящем документе термин «5'-кэп» (также называемый РНК кэп, РНК 7-метилгуанозиновый кэп или РНК m7G кэп) представляет собой модифицированный гуаниновый нуклеотид, который был добавлен «впереди» или на 5'-конце эукариотической матричной РНК вскоре после начала транскрипции. 5'-кэп состоит из концевой группы, которая связана с первым транскрибируемым нуклеотидом. Его присутствие является критическим для узнавания рибосомой и защиты от РНКаз. Добавление кэпа связано с транскрипцией и происходит котранскрипционно так, что каждое из событий влияет на другое. Вскоре после начала транскрипции 5'-конец синтезируемой мРНК связывается кэп-синтезирующим комплексом, связанным с РНК-полимеразой. Этот ферментативный комплекс катализирует химические реакции, которые необходимы для кэппирования мРНК. Синтез протекает как многостадийная биохимическая реакция. Кэппирующий фрагмент можно модифицировать для модулирования функциональных свойств мРНК, таких как ее стабильность или эффективность трансляции.

Используемый в настоящем документе термин «in vitro транскрибированная РНК» означает РНК, предпочтительно мРНК, которая была синтезирована in vitro. Как правило, in vitro транскрибированная РНК образуется из in vitro транскрипционного вектора. In vitro транскрипционный вектор содержит матрицу, используемую для создания in vitro транскрибированной РНК.

Используемый в настоящем документе термин «поли(A)» означает серию остатков аденозина, присоединенных в процессе полиаденилирования к мРНК. В предпочтительном варианте осуществления конструкции для временной экспрессии полиA составляет от 50 до 5000 (SEQ ID NO: 109), предпочтительно более 64, более предпочтительно более 100, наиболее предпочтительно более 300 или 400. Поли(A) последовательности можно модифицировать химически или ферментативно для модулирования функциональных свойств мРНК, таких как локализация, стабильность или эффективность трансляции.

Используемый в настоящем документе термин «полиаденилирование» означает ковалентное связывание полиаденилового фрагмента или его модифицированного варианта с молекулой матричной РНК. У эукариотических организмов большинство молекул матричной РНК (мРНК) являются полиаденилированными на 3'-конце. 3'-поли(A) последовательность представляет собой длинную последовательность адениновых нуклеотидов (часто нескольких сотен), добавленную к пре-мРНК за счет действия фермента полиаденилат полимеразы. У высших эукариот поли(A) последовательность добавлена к транскриптам, которые содержат определенную последовательность, сигнал полиаденилирования. Поли(A) последовательность и белок, связанный с ней, способствуют защите мРНК от деградации экзонуклеазами. Полиаденилирование также важно для терминации транскрипции, выхода мРНК из ядра и трансляции. Полиаденилирование происходит в ядре сразу после транскрипции ДНК в РНК, но, кроме того, также может происходить позже в цитоплазме. После завершения транскрипции цепь мРНК отщепляется за счет действия эндонуклеазного комплекса, связанного с РНК-полимеразой. Сайт расщепления, как правило, характеризуется наличием последовательности оснований AAUAAA рядом с сайтом расщепления. После отщепления мРНК остатки аденозина добавляются к свободному 3'-концу на сайте расщепления.

Используемый в настоящем документе термин «временная» относится к экспрессии неинтегрированного трансгена в течение нескольких часов, дней или недель, при этом период времени экспрессии является короче, чем период времени для экспрессии гена, если он интегрирован в геном или находится в стабильном плазмидном репликоне в клетке-хозяине.

Термин «путь сигнальной трансдукции» означает биохимическое взаимодействие между различными молекулами сигнальной трансдукции, которые играют роль в передаче сигнала из одной части клетки в другую часть клетки. Термин «рецептор клеточной поверхности» включает молекулы и комплексы молекул, способные получать сигнал и передавать сигнал через мембрану клетки.

Термин «субъект» включает живые организмы, в которых может быть индуцирован иммунный ответ (например, млекопитающих, человека).

Термин, «практически очищенная» клетка означает клетку, которая по существу свободна от клеток других типов. Практически очищенная клетка также означает клетку, которая была отделена от клеток других типов, с которыми она обычно связана в ее естественном состоянии. В некоторых случаях популяция практически очищенных клеток означает гомогенную популяцию клеток. В других случаях этот термин просто означает клетку, которая была отделена от клеток, с которыми она естественным образом связана в их природном состоянии. В некоторых аспектах клетки культивируют in vitro. В других аспектах клетки не культивируют in vitro.

Используемый в настоящем документе термин «терапевтический» означает лечебный. Терапевтический эффект получают путем ослабления, подавления, ремиссии или ликвидации болезненного состояния.

Используемый в настоящем документе термин «профилактика» означает предотвращение или превентивное лечение заболевания или болезненного состояния.

В контексте настоящего изобретения термины «опухолевый антиген» или «антиген гиперпролиферативного заболевания», или «антиген, ассоциированный с гиперпролиферативным заболеванием» относятся к антигенам, которые обычно характерны для определенных гиперпролиферативных заболеваний. В некоторых аспектах антигены гиперпролиферативного заболевания по настоящему изобретению получают из злокачественных опухолей, включая, но не ограничиваясь ими, первичную или метастатическую меланому, тимому, лимфому, саркому, рак легкого, рак печени, неходжскинскую лимфому, неходжкинскую лимфому, лейкозы, рак тела матки, рак шейки матки, рак мочевого пузыря, рак почки и аденокарциномы, такие как рак молочной железы, рак предстательной железы, рак яичников, рак поджелудочной железы и тому подобное.

Термин «трансфекция» или «трансформация» или «трансдукция» относится к процессу, посредством которого экзогенная нуклеиновая кислота переносится или вводится в клетку-хозяина. «Трансфицированная» или «трансформированная», или «трансдуцированная» клетка представляет собой клетку, которая была трансфицирована, трансформирована или трансдуцирована экзогенной нуклеиновой кислотой. Клетка включает первичную клетку субъекта и ее потомство.

Выражение «специфически связывает» относится к антителу, или лиганду, который узнает и связывает соответствующий белок-партнер по связыванию (например, стимулирующую и/или костимулирующую молекулу, присутствующую на T-клетке), присутствующий в образце, но при этом антитело или лиганд практически не узнает и не связывает другие молекулы в образце.

Диапазоны: в данном описании различные аспекты изобретения могут быть представлены в формате диапазона. Следует понимать, что описание в формате диапазона использовано лишь для удобства и краткости и не должно быть истолковано как негибкое ограничение объема изобретения. Соответственно, описание диапазона следует рассматривать как специально раскрывающее все возможные поддиапазоны, а также отдельные числовые значения в пределах этого диапазона. Например, описание такого диапазона, как от 1 до 6, следует рассматривать как специально раскрывающее такие поддиапазоны, как от 1 до 3, от 1 до 4, от 1 до 5, от 2 до 4, от 2 до 6, от 3 до 6 и так далее, а также отдельные числовые значения в пределах этого диапазона, например, 1, 2, 2,7, 3, 4, 5, 5,3 и 6. В качестве другого примера, такой диапазон, как 95-99% идентичности, включает нечто с идентичностью 95%, 96%, 97%, 98% или 99%, и включает такие поддиапазоны, как 96-99%, 96-98%, 96-97%, 97-99%, 97-98% и 98-99% идентичности. Это применимо независимо от ширины диапазона.

Описание

Настоящее изобретение относится к композициям и способам их применения для лечения такого заболевания, как рак, с использованием гуманизированных анти-CD19 химерных антигенных рецепторов (CAR).

В одном аспекте изобретение относится к ряду химерных антигенных рецепторов (CAR), содержащих антитело или фрагмент антитела, сконструированные для усиленного связывания с белком CD19. В одном аспекте изобретение относится к клетке (например, T-клетке), генетически измененной для экспрессии CAR, при этом CAR T-клетка («CART») проявляет противоопухолевые свойства. В одном аспекте клетка трансформирована CAR, и CAR экспрессируется на поверхности клетки. В некоторых вариантах осуществления клетка (например, Т-клетка) трансдуцирована вирусным вектором, кодирующим CAR. В некоторых вариантах осуществления вирусный вектор представляет собой ретровирусный вектор. В некоторых вариантах осуществления вирусный вектор представляет собой лентивирусный вектор. В некоторых таких вариантах осуществления клетка может стабильно экспрессировать CAR. В другом варианте осуществления клетка (например, T-клетка) трансфицирована нуклеиновой кислотой, например, мРНК, кДНК, ДНК, кодирующей CAR. В некоторых таких вариантах осуществления клетка может временно экспрессировать CAR.

В одном аспекте направленная против белка CD19 связывающая часть CAR представляет собой scFv фрагмент антитела. В одном аспекте такие фрагменты антитела являются функциональными в том отношении, что они сохраняют эквивалентную аффинность связывания, например, они связывают тот же антиген с эффективностью, сопоставимой с эффективностью IgG антитела, из которого они получены. В одном аспекте такие фрагменты антитела являются функциональными в том отношении, что они обеспечивают биологический ответ, который может включать, но не ограничивается ими, активацию иммунного ответа, ингибирование возникновения сигнальной трансдукции от его целевого антигена, ингибирование киназной активности и тому подобное, как будет понятно специалисту в данной области. В одном аспекте анти-CD19 антигенсвязывающий домен CAR представляет собой scFv фрагмент антитела, который является гуманизированным в сравнении с последовательностью scFv мышей, из которой он происходит. В одном аспекте исходная мышиная последовательность scFv представляет собой конструкцию CAR19, описанную в PCT публикации WO 2012/079000 и приведенную в настоящем документе как SEQ ID NO: 58.

В некоторых аспектах антитела по изобретению встроены в химерный антигенный рецептор (CAR). В одном аспекте CAR содержит полипептидную последовательность, приведенную как SEQ ID NO: 12 в PCT публикации WO 2012/079000 и приведенную в настоящем документе как SEQ ID NO: 58, при этом домен scFv заменен одной или более последовательностями, выбранными из SEQ ID NOS: 1-12. В одном аспекте домены scFv SEQ ID NOS: 1-12 являются гуманизированными вариантами домена scFv SEQ ID NO: 59, который представляет собой scFv фрагмент антитела мыши, который специфически связывается с человеческим CD19. Гуманизация этого мышиного scFv может быть желательной для клинического применения, когда специфичные для мыши остатки могут индуцировать человеческий иммунный ответ на мышиный антиген (HAMA) у пациентов, получающих лечение при помощи CART19, например, лечение T-клетками, трансдуцированными конструкцией CAR19.

В одном аспекте анти-CD19 связывающий домен, например, гуманизированный scFv, часть CAR по изобретению, кодируется трансгеном, последовательность которого была оптимизирована по кодонам для экспрессии в клетке млекопитающего. В одном аспекте полная конструкция CAR по изобретению кодируется трансгеном, полная последовательность которого была оптимизирована по кодонам для экспрессии в клетке млекопитающего. Оптимизация по кодонам опирается на то открытие, что частота встречаемости синонимичных кодонов (то есть, кодонов, которые кодируют одну и ту же аминокислоту) в кодирующей ДНК имеет отклонения у разных видов. Такая вырожденность кодонов приводит к тому, что один и тот же полипептид может кодироваться различными нуклеотидными последовательностями. Разнообразные способы оптимизации кодонов известны в данной области и включают, например, способы, описанные по меньшей мере в патентах США с номерами 5786464 и 6114148.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 1.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 2.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 3.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 4.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 5.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 6.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 7.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 8.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 9.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 10.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 11.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 12.

В одном аспекте CAR по изобретению сочетают в себе антигенсвязывающий домен специфического антитела с внутриклеточной сигнальной молекулой. Например, в некоторых аспектах внутриклеточная сигнальная молекула включает, но не ограничивается ими, сигнальные модули CD3-дзета цепь, 4-1BB и CD28, а также их сочетания. В одном аспекте антигенсвязывающий домен связывается с CD19. В одном аспекте CD19 CAR представляет собой CAR, выбранный из последовательностей, приведенных в одной или более из SEQ ID NOS: 31-42. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 31. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 32. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 33. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 34. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 35. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 36. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 37. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 38. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 39. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 40. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 41. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 42.

Кроме того, настоящее изобретение относится к композициям CD19 CAR и их использованию в лекарственных средствах или способах лечения, в числе прочих заболеваний, рака или любых злокачественных новообразований, или аутоиммунных заболеваний, в которые вовлечены клетки или ткани, экспрессирующие CD19.

В одном аспекте CAR по изобретению можно использовать для уничтожения CD19-экспрессирующих нормальных клеток, таким образом, они подходят для клеточной симптоматической терапии перед трансплантацией клеток. В одном аспекте CD19-экспрессирующая нормальная клетка представляет собой CD19-экспрессирующую нормальную стволовую клетку, и трансплантация клеток представляет собой трансплантацию стволовых клеток.

В одном аспекте изобретение относится к клетке (например, T-клетке), генетически измененной для экспрессии химерного антигенного рецептора (CAR), при этом CAR T-клетка («CART») проявляет противоопухолевые свойства. Предпочтительным антигеном является CD19. В одном аспекте антигенсвязывающий домен CAR содержит частично гуманизированный фрагмент анти-CD19 антитела. В одном аспекте антигенсвязывающий домен CAR содержит частично гуманизированный фрагмент анти-CD19 антитела, представляющий собой scFv. Соответственно, изобретение относится к CD19 CAR, который содержит гуманизированный анти-CD19 связывающий домен и введен генно-инженерными методами в T-клетку, а также способам его использования для адоптивной терапии.

В одном аспекте CD19 CAR содержит по меньшей мере один внутриклеточный домен, выбранный из группы, включающей сигнальный домен CD137 (4-1BB), сигнальный домен CD28, сигнальный домен CD3-дзета, а также любые их сочетания. В одном аспекте CD19 CAR содержит по меньшей мере один внутриклеточный сигнальный домен из одной или более костимулирующих молекул, отличных от CD137 (4-1BB) или CD28.

Химерный антигенный рецептор (CAR)

Настоящее изобретение относится к рекомбинантной конструкции ДНК, содержащей последовательности, кодирующие CAR, при этом CAR содержит гуманизированный фрагмент антитела, который специфически связывается с CD19, например, человеческим CD19, причем последовательность фрагмента антитела граничит с, и находится в одной рамке считывания с нуклеотидной последовательностью, кодирующей внутриклеточный сигнальный домен. Внутриклеточный сигнальный домен может содержать костимулирующий сигнальный домен и/или основной сигнальный домен, например, дзета-цепь. Костимулирующий сигнальный домен означает часть CAR, содержащую по меньшей мере часть внутриклеточного домена костимулирующей молекулы.

В конкретных аспектах конструкция CAR по изобретению содержит домен scFv, выбранный из группы, состоящей из SEQ ID NOS: 1-12, при этом перед scFv может, необязательно, находиться лидерная последовательность, такая как SEQ ID NO: 13, а после scFv может, необязательно, находиться шарнирная последовательность, такая как SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или SEQ ID NO: 49, трансмембранная область, такая как SEQ ID NO: 15, внутриклеточный сигнальный домен, который включает SEQ ID NO: 16 или SEQ ID NO: 51, и последовательность CD3-дзета, которая включает SEQ ID NO: 17 или SEQ ID NO: 43, при этом домены являются смежными и находятся в одной рамке считывания, в результате чего образуется слитый белок. Также включена в изобретение нуклеотидная последовательность, кодирующая полипептид каждого из scFv фрагментов, выбранная из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12. Также включена в изобретение нуклеотидная последовательность, кодирующая полипептид каждого из scFv фрагментов, выбранная из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ IS NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, и каждый из доменов SEQ ID NOS: 13-17, плюс кодируемый слитый белок CD19 CAR по изобретению. В одном аспекте иллюстративные конструкции CD19 CAR содержат необязательную лидерную последовательность, внеклеточный антигенсвязывающий домен, шарнир, трансмембранный домен и внутриклеточный стимулирующий домен. В одном аспекте иллюстративная конструкция CD19 CAR содержит необязательную лидерную последовательность, внеклеточный антигенсвязывающий домен, шарнир, трансмембранный домен, внутриклеточный костимулирующий домен и внутриклеточный стимулирующий домен. Конкретные конструкции CD19 CAR, содержащие гуманизированные домены scFv по изобретению, приведены в виде SEQ ID NOS: 31-42.

Полноразмерные последовательности CAR также приведены в настоящем документе в SEQ ID NOS: 31-42, как показано в таблице 3.

Иллюстративная лидерная последовательность приведена в SEQ ID NO: 13. Иллюстративная последовательность шарнира/спейсера приведена в SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или SEQ ID NO: 49. Иллюстративная последовательность трансмембранного домена приведена в SEQ ID NO: 15. Иллюстративная последовательность внутриклеточного сигнального домена белка 4-1BB приведена в SEQ ID NO: 16. Иллюстративная последовательность внутриклеточного сигнального домена CD27 приведена в SEQ ID NO: 51. Иллюстративная последовательность домена CD3-дзета приведена в SEQ ID NO: 17 или SEQ ID NO: 43.

В одном аспекте настоящее изобретение относится к конструкции рекомбинантной нуклеиновой кислоты, содержащей молекулу нуклеиновой кислоты, кодирующую CAR, при этом молекула нуклеиновой кислоты содержит нуклеотидную последовательность, кодирующую анти-CD19 связывающий домен, например, описанный в настоящем документе, которая граничит с, и находится в одной рамке считывания с нуклеотидной последовательностью, кодирующей внутриклеточный сигнальный домен. В одном аспекте анти-CD19 связывающий домен выбран из одной или более из SEQ ID NOS: 1-12. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 последовательности, приведенной в одной или более из SEQ ID NOS: 61-72. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 61. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 62. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 63. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 64. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 65. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 66. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 67. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 68. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 69. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 70. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 71. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 72.

В одном аспекте настоящее изобретение относится к конструкции рекомбинантной нуклеиновой кислоты, содержащей трансген, кодирующий CAR, при этом молекула нуклеиновой кислоты содержит нуклеотидную последовательность, кодирующую анти-CD19 связывающий домен, выбранную из одной или более из SEQ ID NOS: 61-72, при этом последовательность граничит с, и находится в одной рамке считывания с нуклеотидной последовательностью, кодирующей внутриклеточный сигнальный домен. Иллюстративный внутриклеточный сигнальный домен, который можно использовать в CAR, включает, но не ограничивается ими, один или более внутриклеточных сигнальных доменов, например, CD3-дзета, CD28, 4-1BB и тому подобное. В некоторых случаях CAR может содержать любое сочетание из CD3-дзета, CD28, 4-1BB и тому подобного. В одном аспекте нуклеотидная последовательность конструкции CAR по изобретению выбрана из одной или более из SEQ ID NOS: 85-96. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 85. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 86. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 87. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 88. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 89. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 90. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 91. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 92. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 93. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 94. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 95. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 96. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 97. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 98. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 99.

Нуклеотидные последовательности, кодирующие нужные молекулы, можно получать с использованием рекомбинантных методов, известных в данной области, таких как, например, скрининг библиотек из клеток, экспрессирующих ген, извлечение гена из вектора, который, как известно, содержит его, или выделение непосредственно из клеток и тканей, содержащих ген, с использованием стандартных методик. Альтернативно, интересующую нуклеиновую кислоту можно получать синтетическими методами, а не клонированием.

Настоящее изобретение включает ретровирусные и лентивирусные векторные конструкции, экспрессирующие CAR, которые можно непосредственно трансдуцировать в клетку.

Настоящее изобретение также включает конструкцию РНК, которую можно непосредственно трансфицировать в клетку. Метод получения мРНК для использования в трансфекции включает in vitro транскрипцию (IVT) матрицы со специально разработанными праймерами, с последующим добавлением полиA для получения конструкции, содержащей 3' и 5'-нетранслируемую последовательность («UTR»), 5'-кэп и/или внутренний участок связывания рибосомы (IRES), нуклеиновую кислоту, которая должна быть экспрессирована, и полиA последовательность, как правило, длиной 50-2000 оснований (SEQ ID NO: 118). Полученная таким образом РНК может эффективно трансфицировать различные типы клеток. В одном варианте осуществления матрица включает последовательности для CAR. В одном варианте осуществления вектор РНК CAR трансдуцируют в T-клетку методом электропорации.

Антигенсвязывающий домен

В одном аспекте CAR по изобретению содержит специфичный в отношении мишени связывающий элемент, иначе называемый антигенсвязывающим доменом. Выбор фрагмента зависит от типа и числа лигандов, которые определяют поверхность клетки-мишени. Например, антигенсвязывающий домен может быть выбран для узнавания лиганда, который действует как маркер клеточной поверхности на клетка-мишенях, ассоциированный с конкретным болезненным состоянием. Так, примеры маркеров клеточной поверхности, которые могут действовать как лиганды для антигенсвязывающего домена в CAR по изобретению, включают маркеры, ассоциированные с вирусными, бактериальными и паразитарными инфекциями, аутоиммунными заболеваниями и раковыми клетками.

В одном аспекте опосредованный CAR T-клеточный ответ может быть направлен на интересующий антиген за счет конструирования антигенсвязывающего домена, который специфически связывает желаемый антиген с CAR.

В одном аспекте часть CAR, содержащая антигенсвязывающий домен, содержит антигенсвязывающий домен, направленный на CD19. В одном аспекте антигенсвязывающий домен направлен на CD19 человека. В одном аспекте антигенсвязывающий домен CAR имеет такую же или сходную специфичность связывания, что и фрагмент FMC63 scFv, описанный в статье Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997).

Антигенсвязывающий домен может быть любым доменом, который связывается с антигеном, включая, но не ограничиваясь ими, моноклональное антитело, поликлональное антитело, рекомбинантное антитело, человеческое антитело, гуманизированное антитело, а также его функциональный фрагмент, включая, но не ограничиваясь ими, однодоменное антитело, такое как вариабельный домен тяжелой цепи (VH), вариабельный домен легкой цепи (VL) и вариабельный домен (VHH) нанотела, производного от антител верблюдовых, а также альтернативный каркас, известный в данной области, который действует как антигенсвязывающий домен, например, рекомбинантный домен фибронектина, и тому подобное. В некоторых случаях полезно, если антигенсвязывающий домен происходит из организма того же вида, для которого в конечном итоге будет использован CAR. Например, в случае использования для человека, может быть полезным, если антигенсвязывающий домен CAR будет содержать человеческие или гуманизированные остатки в антигенсвязывающем домене антитела или фрагмента антитела.

Таким образом, в одном аспекте антигенсвязывающий домен содержит гуманизированное антитело или фрагмент антитела. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, и/или одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированный анти-CD19 связывающий домен имеет две вариабельные области тяжелой цепи, каждая из которых содержит HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область легкой цепи, описанную в настоящем документе (например, в таблице 3), и/или гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3), например, по меньшей мере две гуманизированные вариабельные области тяжелой цепи, описанные в настоящем документе (например, в таблице 3). В одном варианте осуществления анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в таблице 3. В одном варианте осуществления анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая гуманизированный анти-CD19 связывающий домен, содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, и вариабельная область легкой цепи, содержащая аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, присоединена к вариабельной области тяжелой цепи, содержащей аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, через линкер, например, линкер, описанный в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 3 или 4 (SEQ ID NO: 53). Вариабельная область легкой цепи и вариабельная область тяжелой цепи в scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном аспекте область антигенсвязывающего домена содержит одну или более последовательностей, выбранных из SEQ ID NOS: 1-12. В одном аспекте гуманизированный CAR выбирают из одной или более последовательностей, выбранных из SEQ ID NOS: 31-42. В некоторых аспектах антитело, отличное от человеческого, является гуманизированным, при этом определенные последовательности или области антитела модифицированы для увеличения сходства с антителом, естественным образом продуцируемым в организме человека, или его фрагментом. В одном аспекте антигенсвязывающий домен является гуманизированным.

Гуманизированное антитело можно получать с использованием различных методов, известных в данной области, включая, но не ограничиваясь ими, трансплантацию CDR (смотри, например, Европейский патент № EP 239400, международную патентную публикацию № WO 91/09967 и патенты США №№ 5225539, 5530101 и 5585089, полное содержание каждого из которых включено в настоящий документ посредством ссылки), облицовку или изменение поверхности (смотри, например, Европейские патенты №№ EP 592106 и EP 519596, Padlan, 1991, Molecular Immunology, 28(4/5): 489-498; Studnicka et al., 1994, Protein Engineering, 7(6): 805-814; и Roguska et al., 1994, PNAS, 91: 969-973, полное содержание каждого из которых включено в настоящий документ посредством ссылки), перетасовку цепей (смотри, например, патент США № 5565332, полное содержание которого включено в настоящий документ посредством ссылки), а также способы, раскрытые, например, в публикации патентной заявки США № US 2005/0042664, публикации патентной заявки США US 2005/0048617, патенте США № 6407213, патенте США № 5766886, международной патентной публикации № WO 9317105, Tan et al., J. Immunol., 169: 1119-25 (2002), Caldas et al., Protein Eng., 13(5): 353-60 (2000), Morea et al., Methods, 20(3): 267-79 (2000), Baca et al., J. Biol. Chem., 272(16): 10678-84 (1997), Roguska et al., Protein Eng., 9(10): 895-904 (1996), Couto et al., Cancer Res., 55 (23 Supp): 5973s-5977s (1995), Couto et al., Cancer Res., 55(8): 1717-22 (1995), Sandhu J.S., Gene, 150(2): 409-10 (1994) и Pedersen et al., J. Mol. Biol., 235(3): 959-73 (1994), полное содержание которых включено в настоящий документ посредством ссылки. Часто каркасные остатки в каркасных областях будут заменены соответствующим остатком из антитела-донора CDR для изменения, например, улучшения, связывания антигена. Эти замены в каркасе определяют методами, хорошо известными в данной области, например, путем моделирования взаимодействий CDR и каркасных остатков для идентификации каркасных остатков, важных для связывания антигена, и сравнения последовательностей для идентификации необычных каркасных остатков в конкретных положениях. (Смотри, например, Queen et al., патент США № 5585089 и Riechmann et al., 1988, Nature, 332: 323, полное содержание которых включено в настоящий документ посредством ссылки).

Гуманизированное антитело или фрагмент антитела имеет один или более аминокислотных остатков, оставшихся в нем из источника, отличного от человека. Эти не принадлежащие человеку аминокислотные остатки часто называют «импортированными» остатками, которые, как правило, получены из «импортированного» вариабельного домена. Как описано в настоящем документе, гуманизированные антитела или фрагменты антител содержат одну или более CDR из молекул иммуноглобулина, отличного от человеческого, и каркасные области, в которых аминокислотные остатки, составляющие каркас, получены полностью или в основном из последовательностей зародышевой линии человека. Множество методов гуманизации антител или фрагментов антител хорошо известны в данной области, и гуманизацию, по существу, можно выполнять, следуя методу Winter и соавторов (Jones et al., Nature, 321: 522-525 (1986); Riechmann et al., Nature, 332: 323-327 (1988); Verhoeyen et al., Science, 239: 1534-1536 (1988)), заменяя CDR или последовательности CDR грызунов на соответствующие последовательности человеческого антитела, то есть, выполняя трансплантацию CDR (EP 239400, PCT публикация № WO 91/09967 и патенты США №№ 4816567, 6331415, 5225539, 5530101, 5585089, 6548640, полное содержание которых включено в настоящий документ посредством ссылки). В таких гуманизированных антителах и фрагментах антител, значительно меньше, чем интактный вариабельный домен человека, заменен соответствующей последовательностью из видов, отличных от человека. Гуманизированные антитела часто представляют собой человеческие антитела, в которых некоторые остатки CDR и возможно некоторые остатки каркаса (FR) заменены остатками из аналогичных участков в антителах грызунов. Гуманизацию антител и фрагментов антител также можно выполнять путем облицовки или изменения поверхности (EP 592106, EP 519596, Padlan, 1991, Molecular Immunology, 28(4/5): 489-498, Studnicka et al., Protein Engineering, 7(6): 805-814 (1994) и Roguska et al., PNAS, 91: 969-973 (1994)), или перетасовки цепей (патент США № 5565332), полное содержание которых включено в настоящий документ посредством ссылки.

Выбор человеческих вариабельных доменов, как легкой, так и тяжелой цепей, для использования в создании гуманизированных антител имеет целью снижение антигенности. В соответствии с так называемым методом «наилучшего соответствия» проводят скрининг последовательности вариабельного домена антитела грызунов против полной библиотеки известных последовательностей вариабельных доменов человека. Затем человеческие последовательности, которые ближе всего к последовательностям грызунов, выбирают в качестве человеческого каркаса (FR) для гуманизированного антитела (Sims et al., J. Immunol., 151: 2296 (1993), Chothia et al., J. Mol. Biol., 196: 901 (1987), полное содержание которых включено в настоящий документ посредством ссылки). В другом методе используют конкретный каркас, выведенный из консенсусной последовательности всех человеческих антител конкретной подгруппы легких или тяжелых цепей. Один и тот же каркас можно использовать для нескольких разных гуманизированных антител (смотри, например, Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997), Carter et al., Proc. Natl. Acad. Sci. USA, 89: 4285 (1992), Presta et al., J. Immunol., 151: 2623 (1993), полное содержание которых включено в настоящий документ посредством ссылки). В некоторых вариантах осуществления каркасная область, например, все четыре каркасные области вариабельной области тяжелой цепи происходят из последовательности зародышевой линии VH4_4-59. В одном варианте осуществления каркасная область может содержать одну, две, три, четыре или пять модификаций, например, замен, например, из аминокислоты в соответствующей мышиной последовательности (например, SEQ ID NO: 58). В одном варианте осуществления каркасная область, например, все четыре каркасные области вариабельной области легкой цепи происходят из последовательности зародышевой линии VK3_1,25. В одном варианте осуществления каркасная область может содержать одну, две, три, четыре или пять модификаций, например, замен, например, из аминокислоты в соответствующей мышиной последовательности (например, SEQ ID NO: 58).

В некоторых аспектах часть композиции CAR по изобретению, которая содержит фрагмент антитела, является гуманизированной с сохранением высокой аффинности в отношении целевого антигена и других полезных биологических свойств. В соответствии с одним аспектом изобретения, гуманизированные антитела и фрагменты антител получают методом анализа родительских последовательностей и различных концептуальных гуманизированных продуктов с использованием трехмерных моделей родительских и гуманизированных последовательностей. Трехмерные модели иммуноглобулинов обычно доступны и знакомы специалистам в данной области. Также доступны компьютерные программы, которые иллюстрируют и демонстрируют возможные трехмерные конформационные структуры выбранных последовательностей иммуноглобулинов-кандидатов. Изучение этих проекций позволяет анализировать вероятную роль остатков в функционировании последовательности иммуноглобулина-кандидата, например, анализировать остатки, которые влияют на способность иммуноглобулина-кандидата связывать целевой антиген. Таким образом, остатки FR можно выбирать и объединять с последовательностями реципиента и импортированными последовательностями так, что достигается желательная характеристика антитела или фрагмента антитела, например, повышенная аффинность в отношении целевого антигена. Как правило, остатки CDR непосредственно и в наиболее значительной степени оказывают влияние на связывание антигена.

Гуманизированное антитело или фрагмент антитела может сохранять такую же антигенную специфичность, что и исходное антитело, например, в настоящем изобретении способность связывать человеческий CD19. В некоторых вариантах осуществления гуманизированное антитело или фрагмент антитела может иметь улучшенную аффинность и/или специфичность связывания с человеческим CD19.

В одном аспекте анти-CD19 связывающий домен характеризуется конкретными функциональными особенностями или свойствами антитела или фрагмента антитела. Например, в одном аспекте часть композиции CAR по изобретению, которая содержит антигенсвязывающий домен, специфически связывает человеческий CD19. В одном аспекте антигенсвязывающий домен имеет такую же или аналогичную специфичность связывания с человеческим CD19, что и scFv FMC63, описанный в статье Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997). В одном аспекте изобретение относится к антигенсвязывающему домену, содержащему антитело или фрагмент антитела, при этом связывающий домен антитела специфически связывается с белком CD19 или его фрагментом, причем антитело или фрагмент антитела содержит вариабельный домен легкой цепи и/или вариабельный домен тяжелой цепи, который содержит аминокислотную последовательность SEQ ID NO: 1-12. В одном аспекте антигенсвязывающий домен содержит аминокислотную последовательность scFv, выбранную из SEQ ID NOs: 1-12. В некоторых аспектах scFv граничит с, и находится в одной рамке считывания с лидерной последовательностью. В одном аспекте лидерная последовательность представляет собой полипептидную последовательность, приведенную в SEQ ID NO: 13.

В одном аспекте анти-CD19 связывающий домен представляет собой фрагмент, например, одноцепочечный вариабельный фрагмент (scFv). В одном аспекте анти-CD19 связывающий домен представляет собой Fv, Fab, (Fab')2 или бифункциональное (например, биспецифическое) гибридное антитело (например, Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)). В одном аспекте антитела и их фрагменты по изобретению связывают белок CD19 с соответствующей дикому типу или улучшенной аффинностью.

В некоторых случаях scFv фрагменты можно получать методом, известным в данной области (смотри, например, Bird et al., (1988) Science 242: 423-426 и Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85: 5879-5883). Молекулы scFv можно получать путем связывания вместе VH и VL областей с использованием гибких полипептидных линкеров. Молекулы scFv содержат линкер (например, Ser-Gly линкер) с оптимизированной длиной и/или аминокислотным составом. Длина линкера может сильно влиять на то, как вариабельные области scFv укладываются и взаимодействуют. Действительно, при использовании короткого полипептидного линкера (например, длиной 5-10 аминокислот) предотвращается внутрицепочечная укладка. Межцепочечная укладка также необходима для сведения вместе двух вариабельных областей для образования функционального эпитопсвязывающего сайта. Примеры ориентации и размеров линкера можно найти, например, в статье Hollinger et al. 1993 Proc Natl Acad. Sci. U.S.A. 90: 6444-6448, публикациях патентных заявок США №№ 2005/0100543, 2005/0175606, 2007/0014794 и PCT публикациях №№ WO 2006/020258 и WO 2007/024715, содержание которых включено в настоящий документ посредством ссылки.

ScFv может содержать линкер из по меньшей мере 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50 или более аминокислотных остатков между VL и VH областями. Последовательность линкера может содержать любую природную аминокислоту. В некоторых вариантах осуществления последовательность линкера содержит аминокислоты глицин и серин. В другом варианте осуществления последовательность линкера содержит группы повторов из глицина и серина, такие как (Gly4Ser)n, где n является положительным целым числом, равным или большим чем 1 (SEQ ID NO: 18). В одном варианте осуществления линкер может представлять собой (Gly4Ser)4 (SEQ ID NO: 106) или (Gly4Ser)3 (SEQ ID NO: 107). Вариации в длине линкера могут способствовать сохранению или усилению активности, что приводит к высокой эффективности в исследованиях активности.

Стабильность и мутации

Стабильность анти-CD19 связывающего домена, например, молекулы scFv (например, растворимого scFv), можно оценивать в сравнении с биофизическими свойствами (например, термической стабильностью) обычной контрольной молекулы scFv или полноразмерного антитела. В одном варианте осуществления гуманизированный scFv имеет термическую стабильность, которая превышает на примерно 0,1, примерно 0,25, примерно 0,5, примерно 0,75, примерно 1, примерно 1,25, примерно 1,5, примерно 1,75, примерно 2, примерно 2,5, примерно 3, примерно 3,5, примерно 4, примерно 4,5, примерно 5, примерно 5,5, примерно 6, примерно 6,5, примерно 7, примерно 7,5, примерно 8, примерно 8,5, примерно 9, примерно 9,5, примерно 10 градусов, примерно 11 градусов, примерно 12 градусов, примерно 13 градусов, примерно 14 градусов, или примерно 15 градусов Цельсия термическую стабильность контрольной связывающей молекулы (например, обычной молекулы scFv) в описанных анализах.

Повышенная термическая стабильность анти-CD19 связывающего домена, например, scFv, впоследствии передается целой конструкции CART19, что приводит к улучшению терапевтических свойств конструкции CART19. Термическая стабильность анти-CD19 связывающего домена, например, scFv, может быть повышена по меньшей мере примерно на 2°C или 3°C по сравнению с обычным антителом. В одном варианте осуществления анти-CD19 связывающий домен, например, scFv, имеет повышенную на 1°C термическую стабильность по сравнению с обычным антителом. В другом варианте осуществления анти-CD19 связывающий домен, например, scFv, имеет повышенную на 2°C термическую стабильность по сравнению с обычным антителом. В другом варианте осуществления scFv имеет повышенную на 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15°C термическую стабильность по сравнению с обычным антителом. Сравнения можно проводить, например, между молекулами scFv, раскрытыми в настоящем документе, и молекулами scFv, или Fab-фрагментами антитела, из которого были получены VH и VL scFv. Термическую стабильность можно измерять методами, известными в данной области. Например, в одном варианте осуществления можно измерять Tm. Методы измерения Tm и другие методы определения стабильности белков описаны более подробно ниже.

Мутации в scFv (возникающие вследствие гуманизации или прямого мутагенеза растворимого scFv) изменяют стабильность scFv и повышают общую стабильность scFv и конструкции CART19. Стабильность гуманизированного scFv сравнивают со стабильностью мышиного scFv, используя такие показатели, как Tm, температура денатурации и температура агрегации.

Связывающую способность мутантных scFv можно определять с использованием анализов, описанных в примерах.

В одном варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит по меньшей мере одну мутацию, возникающую в результате процесса гуманизации, так, что мутантный scFv придает повышенную стабильность конструкции CART19. В другом варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит по меньшей мере 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 мутаций, возникающих в результате процесса гуманизации, так, что мутантный scFv придает повышенную стабильность конструкции CART19.

Методы оценки стабильности белков

Стабильность антигенсвязывающего домена можно оценивать с использованием, например, методов, описанных ниже. Такие методы позволяют определять множественные температурные конформационные переходы с уничтожением складок, при которых наименее стабильный домен либо разворачивается в первую очередь, либо ограничивает общий порог стабильности мульдоменной единицы, которая разворачивается согласованно (например, мультидоменный белок, который демонстрирует один конформационный переход с уничтожением складок). Наименее стабильный домен можно определять с помощью целого ряда дополнительных методов. Можно проводить мутагенез для исследования того, который домен ограничивает общую стабильность. Кроме того, можно изучать устойчивость к протеазе мультидоменного белка в условиях, когда известно, что наименее стабильный домен будет действительно развернут, методами ДСК или другими спектроскопическими методами (Fontana, et al., (1997) Fold. Des., 2: R17-26; Dimasi et al. (2009) J. Mol. Biol. 393: 672-692). После того, как идентифицирован наименее стабильный домен, последовательность, кодирующую этот домен (или ее часть), можно использовать в качестве тестовой последовательности в методах.

a) Термическая стабильность

Термическую стабильность композиций можно анализировать с использованием ряда неограничивающих биофизических или биохимических методов, известных в данной области. В конкретных вариантах осуществления термическую стабильность оценивают методом аналитической спектроскопии.

Иллюстративным методом аналитической спектроскопии является дифференциальная сканирующая калориметрия (ДСК). В ДСК используют калориметр, который чувствителен к поглощению тепла, сопровождающему разворачивание большинства белков или доменов белков (смотри, например, Sanchez-Ruiz, et al., Biochemistry, 27: 1648-52, 1988). Для определения термической стабильности белка образец белка вставляют в калориметр и температуру повышают до тех пор, пока Fab или scFv не разворачивается. Температура, при которой белок разворачивается, является показателем общей стабильности белка.

Другим иллюстративным методом аналитической спектроскопии является спектроскопия кругового дихроизма (КД). Методом КД спектрометрии измеряют оптическую активность композиции в зависимости от повышения температуры. Методом спектроскопии кругового дихроизма (КД) измеряют разницу в поглощении левополяризованного света и правополяризованного света, которая возникает вследствие структурной асимметрии. Нарушенная или развернутая структура приводит к КД-спектрам, сильно отличающимся от спектра упорядоченной или свернутой структуры. КД-спектр отражает чувствительность белков к денатурирующему воздействию повышающейся температуры и, таким образом, является показателем термической стабильности белка (смотри van Mierlo and Steemsma, J. Biotechnol., 79(3): 281-98, 2000).

Другим иллюстративным методом аналитической спектроскопии для измерения термической стабильности является флуоресцентная эмиссионная спектроскопия (смотри van Mierlo and Steemsma, выше). Другим иллюстративным методом аналитической спектроскопии для измерения термической стабильности является спектроскопия ядерного магнитного резонанса (ЯМР) (смотри, например, van Mierlo and Steemsma, выше).

Термическую стабильность композиции можно измерять биохимическими методами. Иллюстративным биохимическим методом для оценки термической стабильности является анализ температурного воздействия. В «анализе температурного воздействия» композицию подвергают воздействию диапазона повышенных температур в течение заданного периода времени. Например, в одном варианте осуществления тестируемые молекулы scFv или молекулы, содержащие молекулы scFv, подвергают воздействию диапазона повышающихся температур, например, в течение 1-1,5 часов. Затем анализируют активность белка в соответствующем биохимическом анализе. Например, если белок представляет собой связывающий белок (например, scFv или scFv-содержащий полипептид), связывающую активность связывающего белка можно определять функциональным или количественным методом ELISA.

Такой анализ можно выполнять в высокопроизводительном формате и такие анализы с использованием E. coli и высокопроизводительного скрининга описаны в разделе «Примеры». Библиотеку анти-CD19 связывающих доменов, например, вариантов scFv, можно создавать с использованием методов, известных в данной области. Можно индуцировать экспрессию анти-CD19 связывающего домена, например, scFv, и анти-CD19 связывающий домен, например, scFv, можно подвергать воздействию повышенных температур. Подвергнутые воздействию тестовые образцы можно анализировать на связывание, и эти анти-CD19 связывающие домены, например, scFv, которые являются стабильными, можно нарабатывать в большом количестве и далее характеризовать.

Термическую стабильность оценивают путем измерения температуры плавления (Tm) композиции с использованием любого из вышеуказанных методов (например, методов аналитической спектроскопии). Температура плавления представляет собой температуру в средней точке кривой теплового перехода, в которой 50% молекул композиции находятся в свернутом состоянии (смотри, например, Dimasi et al. (2009) J. Mol Biol. 393: 672-692). В одном варианте осуществления значение Tm для анти-CD19 связывающего домена, например, scFv, составляет примерно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C. В одном варианте осуществления значение Tm для IgG составляет примерно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C. В одном варианте осуществления значение Tm для мультивалентного антитела составляет примерно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C.

Термическую стабильность также оценивают путем измерения удельной теплоемкости или теплоемкости (Cp) композиции с использованием метода аналитической калориметрии (например, ДСК). Удельная теплоемкость композиции представляет собой энергию (например, в ккал/моль), необходимую для повышения температуры 1 моля воды на 1°C. Высокое значение Cp является показателем денатурированной или неактивной белковой композиции. Изменение теплоемкости (ΔCp) композиции измеряют путем определения удельной теплоемкости композиции до и после ее теплового перехода. Термическую стабильность можно также оценивать путем измерения или определения других параметров термодинамической стабильности, включая свободную энергию Гиббса для разворачивания (ΔG), энтальпию разворачивания (ΔΗ) или энтропию разворачивания (ΔS). Один или более из вышеуказанных биохимических анализов (например, анализ температурного воздействия) используют для определения температуры (то есть, значения Tc), при которой 50% композиции сохраняет свою активность (например, связывающую активность).

Кроме того, мутации в анти-CD19 связывающем домене, например, scFv, приводят к изменению термической стабильности анти-CD19 связывающего домена, например, scFv, по сравнению с не мутантным анти-CD19 связывающим доменом, например, scFv. Когда гуманизированный анти-CD19 связывающий домен, например, scFv, включен в конструкцию CART19, анти-CD19 связывающий домен, например, гуманизированный scFv, придает термическую стабильность всей конструкции анти-CD19 CART. В одном варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит одну мутацию, которая придает термическую стабильность анти-CD19 связывающему домену, например, scFv. В другом варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит несколько мутаций, которые придают термическую стабильность анти-CD19 связывающему домену, например, scFv. В одном варианте осуществления несколько мутаций в анти-CD19 связывающем домене, например, scFv, оказывают дополнительное влияние на термическую стабильность анти-CD19 связывающего домена, например, scFv.

b) % Агрегации

Стабильность композиции можно определять путем измерения ее тенденции к агрегации. Агрегацию можно измерять с помощью ряда неограничивающих биохимических или биофизических методов. Например, агрегацию композиции можно оценивать методом хроматографии, например, эксклюзионной хроматографии (ЭХ) (SEC). При ЭХ молекулы разделяются в зависимости от размеров. Колонка заполнена полутвердыми гранулами полимерного геля, внутрь которых проникают ионы и небольшие молекулы, но не крупные молекулы. Когда белковую композицию наносят сверху на колонку, плотно свернутые белки (то есть, не агрегированные белки) распределяются в большем объеме растворителя, чем возможно для крупных белковых агрегатов. Следовательно, крупные агрегаты быстрее проходят через колонку и, таким образом, смесь можно разделять или фракционировать на компоненты. Каждую фракцию можно отдельно количественно определять (например, при помощи рассеяния света), когда она элюируется с геля. Соответственно, % агрегации в композиции можно определять путем сравнения концентрации фракции с общей концентрацией белка, нанесенного на гель. Стабильные композиции элюируются с колонки в виде практически единственной фракции и выглядят как практически один пик на профиле элюции или хроматограмме.

c) Аффинность связывания

Стабильность композиции можно оценивать путем определения аффинности связывания мишени. Множество разных методов определения аффинности связывания известны в данной области. В иллюстративном методе определения аффинности связывания используют поверхностный плазмонный резонанс. Поверхностный плазмонный резонанс это оптическое явление, которое позволяет анализировать в режиме реального времени биоспецифические взаимодействия путем обнаружения изменений в концентрациях белка в биосенсорной матрице, например, с использованием системы BIAcore (Pharmacia Biosensor AB, Uppsala, Sweden и Piscataway, N.J.). Для более подробной информации смотри Jonsson, U., et al. (1993) Ann. Biol. Clin. 51: 19-26, Jonsson, U., et al. (1991) Biotechniques 11: 620-627, Johnsson, B., et al. (1995) J. Mol. Recognit. 8: 125-131 и Johnnson, B., et al. (1991) Anal. Biochem. 198: 268-277.

В одном аспекте антигенсвязывающий домен в CAR содержит аминокислотную последовательность, которая гомологична аминокислотной последовательности антигенсвязывающего домена, описанной в настоящем документе, и антигенсвязывающий домен сохраняет желательные функциональные свойства фрагментов анти-CD19 антитела, описанных в настоящем документе. В одном конкретном аспекте композиция CAR по изобретению содержит фрагмент антитела. В другом аспекте этот фрагмент антитела представляет собой scFv.

В различных аспектах антигенсвязывающий домен в CAR сконструирован путем модификации одной или более аминокислот в одной или обеих вариабельных областях (например, VH и/или VL), например, в одной или более областях CDR и/или в одной или более каркасных областях. В одном конкретном аспекте композиция CAR по изобретению содержит фрагмент антитела. В другом аспекте этот фрагмент антитела представляет собой scFv.

Любому специалисту в данной области будет понятно, что антитело или фрагмент антитела по изобретению можно дополнительно модифицировать таким образом, что они будут отличаться по аминокислотной последовательности (например, от дикого типа), но не по желательной активности. Например, можно осуществлять дополнительные нуклеотидные замены, ведущие к аминокислотным заменам в «несущественных» аминокислотных остатках в белке. Например, несущественный аминокислотный остаток в молекуле можно заменять другим аминокислотным остатком из того же семейства боковых цепей. В другом варианте осуществления последовательность аминокислот можно заменять структурно сходной последовательностью, которая отличается по порядку и/или составу членов семейства боковых цепей, например, можно выполнять консервативную замену, при которой аминокислотный остаток заменяют аминокислотным остатком, имеющим аналогичную боковую цепь.

Семейства аминокислотных остатков, имеющих аналогичные боковые цепи, известны в данной области, включая аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислотными боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин).

Процент идентичности в контексте двух или более нуклеотидных или полипептидных последовательностей определяют для двух или более последовательностей, которые являются одинаковыми. Две последовательности являются «в значительной степени идентичными», если две последовательности имеют определенный процент аминокислотных остатков или нуклеотидов, которые являются одинаковыми (например, 60% идентичности, необязательно, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности на протяжении определенной области или, если не указано конкретно, на протяжении всей последовательности), при сравнении и выравнивании для максимального соответствия в окне сравнения, или определенной области, что количественно определяют с использованием одного из следующих алгоритмов сравнения последовательностей или при выравнивании вручную и визуальном осмотре. Необязательно, идентичность существует на протяжении области, имеющей в длину по меньшей мере примерно 50 нуклеотидов (или 10 аминокислот), или более предпочтительно, на протяжении области, имеющей в длину от 100 до 500 или 1000, или более нуклеотидов (или 20, 50, 200 или более аминокислот).

Для сравнения последовательностей, как правило, одну последовательность принимают за эталонную последовательность, с которой сравнивают тестируемую последовательность. При использовании алгоритма сравнения последовательностей тестируемую и эталонную последовательности вводят в компьютер, задают координаты подпоследовательностей, если необходимо, и задают параметры программы для сравнения последовательностей. Можно использовать параметры по умолчанию программы или задавать альтернативные параметры. Алгоритм сравнения последовательностей затем рассчитывает процент идентичности последовательностей для тестируемых последовательностей относительно эталонной последовательности, на основании параметров программы. Способы выравнивания последовательностей для сравнения хорошо известны в данной области. Оптимальное выравнивание последовательностей для сравнения можно проводить, например, с помощью алгоритма локальной гомологии Смита-Уотермана, (1970) Adv. Appl. Math. 2:482c, алгоритма глобального выравнивания Нидлмана-Вунша, (1970) J. Mol. Biol. 48: 443, методом поиска сходства Пирсона-Липмана, (1988) Proc. Nat'l. Acad. Sci. USA 85: 2444, с помощью компьютерных реализаций этих алгоритмов (GAP, BESTFIT, FASTA и TFASTA в пакете программ Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI) или с использованием выравнивания вручную и визуального осмотра (смотри, например, Brent et al., (2003) Current Protocols in Molecular Biology).

Двумя примерами алгоритмов, которые подходят для определения процентной идентичности последовательностей и сходства последовательностей, являются алгоритмы BLAST и BLAST 2.0, которые описаны в Altschul et al., (1977) Nuc. Acids Res. 25: 3389-3402 и Altschul et al., (1990) J. Mol. Biol. 215: 403-410, соответственно. Программное обеспечение для выполнения анализов BLAST является общедоступным через Национальный центр биотехнологической информации.

Процент идентичности между двумя аминокислотными последовательностями можно также определять с использованием алгоритма, описанного в статье E. Meyers and W. Miller, (1988) Comput. Appl. Biosci. 4: 11-17, который включен в программу ALIGN (версия 2.0), с использованием таблицы весов замен остатков PAM120, штрафа на продолжение делеции 12 и штрафа на внесение делеции 4. Кроме того, процент идентичности между двумя аминокислотными последовательностями можно определять с использованием алгоритма Нидлмана-Вунша (1970) J. Mol. Biol. 48: 444-453), который включен в программу GAP в пакете программ GCG (доступно на сайте www.gcg.com), с использованием либо матрицы Blossom 62, либо матрицы PAM250, и штрафом на внесение делеции 16, 14, 12, 10, 8, 6 или 4 и штрафом на продолжение делеции 1, 2, 3, 4, 5 или 6.

В одном аспекте настоящего изобретения предусмотрены модификации исходной аминокислотной последовательности антитела или фрагмента (например, scFv), при которых получают функционально эквивалентные молекулы. Например, VH или VL анти-CD19 связывающего домена, например, scFv, содержащиеся в CAR, могут быть модифицированы, с сохранением по меньшей мере примерно 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности с исходной каркасной областью VH или VL анти-CD19 связывающего домена, например, scFv. По настоящему изобретению предусмотрены модификации во всей конструкции CAR, например, модификации в одной или более аминокислотных последовательностях разных доменов конструкции CAR, для получения функционально эквивалентных молекул. Конструкция CAR может быть модифицирована с сохранением по меньшей мере примерно 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности с исходной конструкцией CAR.

Трансмембранный домен

Что касается трансмембранного домена, в различных вариантах осуществления может быть сконструирован CAR, который содержит трансмембранный домен, присоединенный к внеклеточному домену CAR. Трансмембранный домен может содержать одну или более дополнительных аминокислот, прилегающих к трансмембранной области, например, одну или более аминокислот, связанных с внеклеточной областью белка, из которого получен трансмембранная область (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, вплоть до 15 аминокислот из внеклеточной области), и/или одну или более дополнительных аминокислот, связанных с внутриклеточной областью белка, из которого получен трансмембранный белок (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, вплоть до 15 аминокислот из внутриклеточной области). В одном аспекте используют трансмембранный домен, который представляет собой домен, связанный с одним из других доменов CAR. В некоторых случаях трансмембранный домен можно выбирать или модифицировать путем аминокислотной замены, чтобы избежать связывания таких доменов с трансмембранными доменами тех же или других поверхностных мембранных белков, например, чтобы свести к минимуму взаимодействия с другими членами рецепторного комплекса. В одном аспекте трансмембранный домен способен к гомодимеризации с другим CAR на поверхности CART-клетки. В другом аспекте аминокислотную последовательность трансмембранного домена можно модифицировать или заменять с тем, чтобы свести к минимуму взаимодействия со связывающими доменами естественного партнера по связыванию, присутствующего в той же самой CART.

Трансмембранный домен можно получать либо из природного, либо из рекомбинантного источника. Если источник является природным, домен можно получать из любого связанного с мембраной или трансмембранного белка. В одном аспекте трансмембранный домен способен передавать сигнал внутриклеточному домену(ам) после того, как CAR связался с мишенью. Трансмембранный домен, особенно полезный для данного изобретения, может содержать по меньшей мере трансмембранную область(и) из, например, альфа, бета или дзета-цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.

В некоторых случаях трансмембранный домен может быть присоединен к внеклеточной области CAR, например, антигенсвязывающему домену CAR, через шарнир, например, шарнир из человеческого белка. Например, в одном варианте осуществления шарнир может представлять собой шарнир из Ig (иммуноглобулина) человека, например, шарнир IgG4 или шарнир CD8a. В одном варианте осуществления шарнир или спейсер содержит (например, состоит из) аминокислотную последовательность SEQ ID NO: 14. В одном аспекте трансмембранный домен содержит (например, состоит из) трансмембранный домен SEQ ID NO: 15.

В одном аспекте шарнир или спейсер представляет собой шарнир IgG4. Например, в одном варианте осуществления шарнир или спейсер представляет собой шарнир с аминокислотной последовательностью

ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKM (SEQ ID NO: 45).

В некоторых вариантах осуществления шарнир или спейсер представляет собой шарнир, кодируемый нуклеотидной последовательностью

GAGAGCAAGTACGGCCCTCCCTGCCCCCCTTGCCCTGCCCCCGAGTTCCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGTGTGGTGGTGGACGTGTCCCAGGAGGACCCCGAGGTCCAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCCCGGGAGGAGCAGTTCAATAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAATACAAGTGTAAGGTGTCCAACAAGGGCCTGCCCAGCAGCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTCGGGAGCCCCAGGTGTACACCCTGCCCCCTAGCCAAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTGGACAAGAGCCGGTGGCAGGAGGGCAACGTCTTTAGCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGGGCAAGATG (SEQ ID NO: 46).

В одном аспекте шарнир или спейсер представляет собой шарнир IgD. Например, в одном варианте осуществления шарнир или спейсер представляет собой шарнир с аминокислотной последовательностью

RWPESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTPECPSHTQPLGVYLLTPAVQDLWLRDKATFTCFVVGSDLKDAHLTWEVAGKVPTGGVEEGLLERHSNGSQSQHSRLTLPRSLWNAGTSVTCTLNHPSLPPQRLMALREPAAQAPVKLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPATYTCVVSHEDSRTLLNASRSLEVSYVTDH (SEQ ID NO: 47).

В некоторых вариантах осуществления шарнир или спейсер представляет собой шарнир, кодируемый нуклеотидной последовательностью

AGGTGGCCCGAAAGTCCCAAGGCCCAGGCATCTAGTGTTCCTACTGCACAGCCCCAGGCAGAAGGCAGCCTAGCCAAAGCTACTACTGCACCTGCCACTACGCGCAATACTGGCCGTGGCGGGGAGGAGAAGAAAAAGGAGAAAGAGAAAGAAGAACAGGAAGAGAGGGAGACCAAGACCCCTGAATGTCCATCCCATACCCAGCCGCTGGGCGTCTATCTCTTGACTCCCGCAGTACAGGACTTGTGGCTTAGAGATAAGGCCACCTTTACATGTTTCGTCGTGGGCTCTGACCTGAAGGATGCCCATTTGACTTGGGAGGTTGCCGGAAAGGTACCCACAGGGGGGGTTGAGGAAGGGTTGCTGGAGCGCCATTCCAATGGCTCTCAGAGCCAGCACTCAAGACTCACCCTTCCGAGATCCCTGTGGAACGCCGGGACCTCTGTCACATGTACTCTAAATCATCCTAGCCTGCCCCCACAGCGTCTGATGGCCCTTAGAGAGCCAGCCGCCCAGGCACCAGTTAAGCTTAGCCTGAATCTGCTCGCCAGTAGTGATCCCCCAGAGGCCGCCAGCTGGCTCTTATGCGAAGTGTCCGGCTTTAGCCCGCCCAACATCTTGCTCATGTGGCTGGAGGACCAGCGAGAAGTGAACACCAGCGGCTTCGCTCCAGCCCGGCCCCCACCCCAGCCGGGTTCTACCACATTCTGGGCCTGGAGTGTCTTAAGGGTCCCAGCACCACCTAGCCCCCAGCCAGCCACATACACCTGTGTTGTGTCCCATGAAGATAGCAGGACCCTGCTAAATGCTTCTAGGAGTCTGGAGGTTTCCTACGTGACTGACCATT (SEQ ID NO: 48).

В одном аспекте трансмембранный домен может быть рекомбинантным, в этом случае он будет содержать преимущественно гидрофобные остатки, такие как лейцин и валин. В одном аспекте триплет из фенилаланина, триптофана и валина может присутствовать на каждом конце рекомбинантного трансмембранного домена.

Необязательно, короткий олиго- или полипептидный линкер, длиной от 2 до 10 аминокислот может быть связующим звеном между трансмембранным доменом и цитоплазматической областью CAR. Дуплет глицин-серин является особенно подходящим линкером. Например, в одном аспекте линкер содержит аминокислотную последовательность GGGGSGGGGS (SEQ ID NO: 49). В некоторых вариантах осуществления линкер кодируется нуклеотидной последовательностью GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO: 50).

Цитоплазматический домен

Цитоплазматический домен или область CAR включает внутриклеточный сигнальный домен. Внутриклеточный сигнальный домен, как правило, отвечает за активацию по меньшей мере одной из нормальных эффекторных функций иммунной клетки, в которую введен CAR. Термин «эффекторная функция» означает специализированную функцию клетки. Эффекторной функцией T-клетки, например, может быть цитолитическая активность или хелперная активность, включая секрецию цитокинов. Таким образом, термин «внутриклеточный сигнальный домен» означает часть белка, которая передает сигнал эффекторной функции и направляет клетку на выполнение специализированной функции. Хотя, как правило, можно использовать целый внутриклеточный сигнальный домен, во многих случаях нет необходимости в использовании всей цепи. В случае использования укороченной части внутриклеточного сигнального домена, такую укороченную часть можно использовать вместо интактной цепи, при условии, что она передает сигнал эффекторной функции. Таким образом, термин «внутриклеточный сигнальный домен» должен включать любую укороченную часть внутриклеточного сигнального домена, достаточную для передачи сигнала эффекторной функции.

Примеры внутриклеточных сигнальных доменов для использования в CAR по изобретению включают цитоплазматические последовательности T-клеточного рецептора (TCR) и корецепторов, которые действуют совместно, инициируя передачу сигнала после взаимодействия антигена с рецептором, а также любое производное или вариант этих последовательностей и любую рекомбинантную последовательность, имеющую такую же функциональную способность.

Известно, что сигналы, генерируемые только через TCR, недостаточны для полной активации T-клетки и что также необходим вспомогательный и/или костимулирующий сигнал. Таким образом, можно сказать, что активация T-клетки опосредована двумя разными классами цитоплазматических сигнальных последовательностей: теми, которые инициируют антиген-зависимую основную активацию через TCR (основные внутриклеточные сигнальные домены), и теми, которые действуют независимым от антигена образом для обеспечения вспомогательного или костимулирующего сигнала (вспомогательный цитоплазматический домен, например, костимулирующий домен).

Основной сигнальный домен регулирует основную активацию комплекса TCR либо стимулирующим образом, либо ингибирующим образом. Основные внутриклеточные сигнальные домены, которые действуют стимулирующим образом, могут содержать сигнальные мотивы, известные как тирозин-содержащие мотивы активации иммунных рецепторов, или ITAM.

Примеры ITAM-содержащих основных внутриклеточных сигнальных доменов, которые особенно полезны для настоящего изобретения, включают домены TCR-дзета, FcR-гамма, FcR-бета, CD3-гамма, CD3-дельта, CD3-эпсилон, CD5, CD22, CD79a, CD79b и CD66d. В одном варианте осуществления CAR по изобретению содержит внутриклеточный сигнальный домен, например, основной сигнальный домен CD3-дзета.

В одном варианте осуществления основной сигнальный домен содержит модифицированный домен ITAM, например, мутантный домен ITAM, который имеет измененную (например, повышенную или пониженную) активность по сравнению с природным доменом ITAM. В одном варианте осуществления основной сигнальный домен представляет собой содержащий модифицированный ITAM основной внутриклеточный сигнальный домен, например, содержащий оптимизированный и/или укороченный ITAM основной внутриклеточный сигнальный домен. В одном из вариантов осуществления основной сигнальный домен содержит один, два, три, четыре или более мотивов ITAM.

Внутриклеточный сигнальный домен CAR может представлять собой сигнальный домен CD3-дзета, как таковой, или он может быть объединен с любым другим нужным внутриклеточным сигнальным доменом(ами), полезными в контексте CAR по изобретению. Например, внутриклеточный сигнальный домен CAR может содержать часть цепи CD3-дзета и костимулирующий сигнальный домен. Костимулирующий сигнальный домен означает часть CAR, содержащую внутриклеточный домен костимулирующей молекулы. Костимулирующая молекула представляет собой молекулу клеточной поверхности, отличную от рецептора антигена или его лигандов, которая необходима для эффективного ответа лимфоцитов на антиген. Примеры таких молекул включают CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD1, ICOS, ассоциированный с функцией лимфоцитов антиген-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3 и лиганд, который специфически связывается с CD83, и тому подобное. Например, показано, что костимуляция CD27 усиливает рост, эффекторную функцию и выживаемость человеческих CART-клеток in vitro и увеличивает персистенцию и противоопухолевую активность человеческих T-клеток in vivo (Song et al. Blood, 2012, 119(3): 696-706).

Внутриклеточные сигнальные последовательности в цитоплазматической части CAR по изобретению могут быть связаны друг с другом в случайном или определенном порядке. Необязательно, короткий олиго- или полипептидный линкер, например, длиной от 2 до 10 аминокислот (например, 2, 3, 4, 5, 6, 7, 8, 9 или 10 аминокислот) может являться связующим звеном между внутриклеточными сигнальными последовательностями. В одном варианте осуществления дуплет глицин-серин может быть использован в качестве подходящего линкера. В одном варианте осуществления одна аминокислота, например, аланин, глицин, может быть использована в качестве подходящего линкера.

В одном аспекте внутриклеточный сигнальный домен сконструирован для содержания двух или более, например, 2, 3, 4, 5 или более, костимулирующих сигнальных доменов. В одном из вариантов осуществления два или более, например, 2, 3, 4, 5 или более, костимулирующих сигнальных доменов разделены молекулой линкера, например, молекулой линкера, описанного в настоящем документе. В одном варианте осуществления внутриклеточный сигнальный домен содержит два костимулирующих сигнальных домена. В некоторых вариантах осуществления молекула линкера представляет собой остаток глицина. В некоторых вариантах осуществления, линкер представляет собой остаток аланина.

В одном аспекте внутриклеточный сигнальный домен сконструирован для содержания сигнального домена CD3-дзета и сигнального домена CD28. В одном аспекте внутриклеточный сигнальный домен сконструирован для содержания сигнального домена CD3-дзета и сигнального домена 4-1BB. В одном аспекте сигнальный домен 4-1BB представляет собой сигнальный домен SEQ ID NO: 16. В одном аспекте сигнальный домен CD3-дзета представляет собой сигнальный домен SEQ ID NO: 17.

В одном аспекте внутриклеточный сигнальный домен сконструирован для содержания сигнального домена CD3-дзета и сигнального домена CD27. В одном аспекте сигнальный домен CD27 содержит аминокислотную последовательность

QRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP (SEQ ID NO: 51). В одном аспекте сигнальный домен CD27 кодируется нуклеотидной последовательностью

AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCC (SEQ ID NO: 52).

В одном аспекте CAR-экспрессирующая клетка, описанная в настоящем документе, может дополнительно содержать второй CAR, например, второй CAR, который содержит другой антигенсвязывающий домен, например, для той же мишени (CD19) или другой мишени (например, CD123). В одном варианте осуществления, если CAR-экспрессирующая клетка содержит два или более разных CAR, антигенсвязывающие домены разных CAR могут быть такими, что антигенсвязывающие домены не взаимодействуют друг с другом. Например, клетка, экспрессирующая первый и второй CAR, может иметь антигенсвязывающий домен первого CAR, например, в виде фрагмента, например, scFv, который не образует связь с антигенсвязывающим доменом второго CAR, например, антигенсвязывающий домен второго CAR представляет собой VHH.

В другом аспекте CAR-экспрессирующая клетка, описанная в настоящем документе, может дополнительно экспрессировать другой агент, например, агент, который повышает активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агент может представлять собой агент, который ингибирует ингибирующую молекулу. Ингибирующие молекулы, например, PD1, могут в некоторых вариантах осуществления уменьшать способность CAR-экспрессирующей клетки осуществлять иммунный эффекторный ответ. Примеры ингибирующих молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR бета. В одном варианте осуществления агент, который ингибирует ингибирующую молекулу, содержит первый полипептид, например, ингибирующую молекулу, связанный со вторым полипептидом, который обеспечивает положительный сигнал для клетки, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления агент содержит первый полипептид, например, ингибирующую молекулу, такую как PD1, LAG3, CTLA4, CD160, BTLA, LAIR1, TEVI3, 2B4 и TIGIT, или фрагмент любой из них (например, по меньшей мере часть внеклеточного домена любой из них), и второй полипептид, который представляет собой внутриклеточный сигнальный домен, описанный в настоящем документе (например, содержащий костимулирующий домен (например, 4-1BB, CD27 или CD28, например, как описано в настоящем документе) и/или основной сигнальный домен (например, сигнальный домен CD3-дзета, описанный в настоящем документе). В одном варианте осуществления агент содержит первый полипептид молекулы PD1 или ее фрагмент (например, по меньшей мере часть внеклеточного домена PD1) и второй полипептид внутриклеточного сигнального домена, описанного в настоящем документе (например, сигнального домена CD28, описанного в настоящем документе, и/или сигнального домена CD3-дзета, описанного в настоящем документе). PD1 представляет собой ингибирующий член семейства рецепторов CD28, которое также включает CD28, CTLA-4, ICOS и BTLA. PD-1 экспрессируется на активированных B-клетках, T-клетках и миелоидных клетках (Agata et al. 1996 Int. Immunol 8: 765-75). Показано, что два лиганда для PD1, PD-L1 и PD-L2 подавляют активацию T-клеток при связывании с PD1 (Freeman et al. 2000 J Exp Med 192: 1027-34, Latchman et al. 2001 Nat Immunol 2: 261-8, Carter et al. 2002 Eur J Immunol 32: 634-43). PD-L1 присутствует в больших количествах в злокачественных опухолях человека (Dong et al. 2003 J Mol Med 81: 281-7, Blank et al. 2005 Cancer Immunol. Immunother 54: 307-314, Konishi et al. 2004 Clin Cancer Res 10: 5094). Иммунная супрессия может быть отменена путем ингибирования локального взаимодействия PD1 с PD-L1.

В одном варианте осуществления агент содержит внеклеточный домен (ECD) ингибирующей молекулы, например, белок программируемой клеточной гибели 1 (PD1) может быть слит с трансмембранным доменом и внутриклеточными сигнальными доменами, такими как 4-1BB и CD3-дзета (также называемый в настоящем документе PD1 CAR). В одном варианте осуществления PD1 CAR, при использовании в сочетании с CD19 CAR, описанным в настоящем документе, улучшает персистенцию T-клетки. В одном варианте осуществления CAR представляет собой PD1 CAR, содержащий внеклеточный домен PD1, указанный подчеркиванием в SEQ ID NO: 121. В одном варианте осуществления PD1 CAR содержит аминокислотную последовательность SEQ ID NO: 121.

Malpvtalllplalllhaarppgwfldspdrpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqdcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvterraevptahpspsprpagqfqtlvtttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr (SEQ ID NO: 121).

В одном варианте осуществления PD1 CAR содержит аминокислотную последовательность, приведенную ниже (SEQ ID NO: 119).

pgwfldspdrpwnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqdcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvterraevptahpspsprpagqfqtlvtttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr (SEQ ID NO: 119).

В одном варианте осуществления агент содержит нуклеотидную последовательность, кодирующую PD1 CAR, например, PD1 CAR, описанный в настоящем документе. В одном варианте осуществления нуклеотидная последовательность для PD1 CAR приведена ниже, с подчеркнутым PD1 ECD, ниже в SEQ ID NO: 120

atggccctccctgtcactgccctgcttctccccctcgcactcctgctccacgccgctagaccacccggatggtttctggactctccggatcgcccgtggaatcccccaaccttctcaccggcactcttggttgtgactgagggcgataatgcgaccttcacgtgctcgttctccaacacctccgaatcattcgtgctgaactggtaccgcatgagcccgtcaaaccagaccgacaagctcgccgcgtttccggaagatcggtcgcaaccgggacaggattgtcggttccgcgtgactcaactgccgaatggcagagacttccacatgagcgtggtccgcgctaggcgaaacgactccgggacctacctgtgcggagccatctcgctggcgcctaaggcccaaatcaaagagagcttgagggccgaactgagagtgaccgagcgcagagctgaggtgccaactgcacatccatccccatcgcctcggcctgcggggcagtttcagaccctggtcacgaccactccggcgccgcgcccaccgactccggccccaactatcgcgagccagcccctgtcgctgaggccggaagcatgccgccctgccgccggaggtgctgtgcatacccggggattggacttcgcatgcgacatctacatttgggctcctctcgccggaacttgtggcgtgctccttctgtccctggtcatcaccctgtactgcaagcggggtcggaaaaagcttctgtacattttcaagcagcccttcatgaggcccgtgcaaaccacccaggaggaggacggttgctcctgccggttccccgaagaggaagaaggaggttgcgagctgcgcgtgaagttctcccggagcgccgacgcccccgcctataagcagggccagaaccagctgtacaacgaactgaacctgggacggcgggaagagtacgatgtgctggacaagcggcgcggccgggaccccgaaatgggcgggaagcctagaagaaagaaccctcaggaaggcctgtataacgagctgcagaaggacaagatggccgaggcctactccgaaattgggatgaagggagagcggcggaggggaaaggggcacgacggcctgtaccaaggactgtccaccgccaccaaggacacatacgatgccctgcacatgcaggcccttccccctcgc (SEQ ID NO: 120).

В другом аспекте настоящее изобретение относится к популяции CAR-экспрессирующих клеток, например, CART-клеток. В некоторых вариантах осуществления популяция CAR-экспрессирующих клеток содержит смесь клеток, экспрессирующих разные CAR. Например, в одном варианте осуществления популяция CART-клеток может содержать первую клетку, экспрессирующую CAR, имеющий анти-CD19 связывающий домен, описанный в настоящем документе, и вторую клетку, экспрессирующую CAR, имеющий другой анти-CD19 связывающий домен, например, анти-CD19 связывающий домен, описанный в настоящем документе, который отличается от анти-CD19 связывающего домена в CAR, экспрессируемом первой клеткой. В качестве другого примера, популяция CART-клеток может содержать первую клетку, экспрессирующую CAR, который содержит анти-CD19 связывающий домен, например, описанный в настоящем документе, и вторую клетку, экспрессирующую CAR, который содержит антигенсвязывающий домен для мишени, отличной от CD19 (например, CD123). В одном варианте осуществления популяция CAR-экспрессирующих клеток содержит, например, первую клетку, экспрессирующую CAR, который содержит основной внутриклеточный сигнальный домен, и вторую клетку, экспрессирующую CAR, который содержит вспомогательный сигнальный домен.

В другом аспекте настоящее изобретение относится к популяции клеток, при этом по меньшей мере одна клетка в популяции экспрессирует CAR, имеющий анти-CD19 домен, описанный в настоящем документе, и вторая клетка экспрессирует другой агент, например, агент, который повышает активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агент может представлять собой агент, который ингибирует ингибирующую молекулу. Ингибирующие молекулы, например, могут в некоторых вариантах осуществления уменьшать способность CAR-экспрессирующей клетки осуществлять иммунный эффекторный ответ. Примеры ингибирующих молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR бета. В одном варианте осуществления агент, который ингибирует ингибирующую молекулу, содержит первый полипептид, например, ингибирующую молекулу, связанный со вторым полипептидом, который обеспечивает положительный сигнал для клетки, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления агент содержит первый полипептид, например, ингибирующую молекулу, такую как PD1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR бета или фрагмент любой из них (например, по меньшей мере часть внеклеточного домена любой из них) и второй полипептид, который представляет собой внутриклеточный сигнальный домен, описанный в настоящем документе (например, содержащий костимулирующий домен (например, 4-1BB, CD27 или CD28, например, как описано в настоящем документе), и/или основной сигнальный домен (например, сигнальный домен CD3-дзета, описанный в настоящем документе). В одном варианте осуществления агент содержит первый полипептид молекулы PD1 или ее фрагмент (например, по меньшей мере часть внеклеточного домена PD1) и второй полипептид внутриклеточного сигнального домена, описанного в настоящем документе (например, сигнального домена CD28, описанного в настоящем документе, и/или сигнального домена CD3-дзета, описанного в настоящем документе).

Трансфекция РНК

В настоящем документе описаны способы получения in vitro транскрибированной РНК CAR. Настоящее изобретение также включает кодирующую CAR конструкцию РНК, которая может быть непосредственно трансфицирована в клетку. Способ получения мРНК для использования в трансфекции может включать in vitro транскрипцию (IVT) матрицы со специально разработанными праймерами, с последующим добавлением полиA, для получения конструкции, содержащей 3' и 5'-нетранслируемую последовательность («UTR»), 5'-кэп и/или внутренний участок связывания рибосомы (IRES), нуклеиновую кислоту, которая должна быть экспрессирована, и полиA последовательность, как правило, длиной 50-2000 оснований (SEQ ID NO: 118). Полученная таким образом РНК может эффективно трансфицировать различные типы клеток. В одном аспекте матрица содержит последовательности для CAR.

В одном аспекте анти-CD19 CAR кодируется матричной РНК (мРНК). В одном аспекте мРНК, кодирующую анти-CD19 CAR, вводят в T-клетку для получения CART-клетки.

В одном варианте осуществления in vitro транскрибированную РНК CAR можно вводить в клетку в форме временной трансфекции. РНК получают путем in vitro транскрипции с использованием полученной с помощью полимеразной цепной реакции (ПЦР) матрицы. Интересующую ДНК из любого источника можно непосредственно превращать при помощи ПЦР в матрицу для in vitro синтеза мРНК с использованием соответствующих праймеров и РНК-полимеразы. Источником ДНК может быть, например, последовательность геномной ДНК, плазмидной ДНК, фаговой ДНК, кДНК, синтетической ДНК или любой другой подходящий источник ДНК. Желательной матрицей для in vitro транскрипции является CAR по настоящему изобретению. Например, матрица для РНК CAR содержит внеклеточную область, содержащую одноцепочечный вариабельный домен противоопухолевого антитела; шарнирную область, трансмембранный домен (например, трансмембранный домен CD8a) и цитоплазматическую область, которая включает внутриклеточный сигнальный домен, например, содержащий сигнальный домен CD3-дзета и сигнальный домен 4-1BB.

В одном варианте осуществления ДНК, используемая для ПЦР, содержит открытую рамку считывания. ДНК может быть из природной последовательности ДНК из генома организма. В одном варианте осуществления нуклеиновая кислота может содержать некоторые или все из 5' и/или 3' нетранслируемых областей (UTR). Нуклеиновая кислота может содержать экзоны и интроны. В одном варианте осуществления ДНК, используемая для ПЦР, представляет собой последовательность нуклеиновой кислоты человека. В другом варианте осуществления ДНК, используемая для ПЦР, представляет собой последовательность нуклеиновой кислоты человека, содержащую 5' и 3'-UTR. Альтернативно, ДНК может быть искусственной последовательностью ДНК, которая обычно не экспрессируется в природных организмах. Иллюстративная искусственная последовательность ДНК представляет собой последовательность, которая содержит части генов, лигированные вместе, с образованием открытой рамки считывания, которая кодирует слитый белок. Части ДНК, которые лигированы вместе, могут быть из одного организма или из более чем одного организма.

ПЦР используют для создания матрицы для in vitro транскрипции мРНК, которую используют для трансфекции. Методы проведения ПЦР хорошо известны в данной области. Праймеры для использования в ПЦР разработаны для содержания областей, которые в значительной степени комплементарны областям ДНК, используемым в качестве матрицы для ПЦР. Используемая в настоящем документе фраза «в значительной степени комплементарны» относится к последовательностям нуклеотидов, в которых большинство или все из оснований в последовательности праймера являются комплементарными, или одно или более оснований являются некомплементарными или несовпадающими. В значительной степени комплементарные последовательности способны к отжигу или гибридизации с намеченной ДНК-мишенью в условиях отжига, используемых для ПЦР. Праймеры могут быть разработаны так, чтобы быть в значительной степени комплементарными любой части ДНК-матрицы. Например, праймеры могут быть разработаны для амплификации части нуклеиновой кислоты, которая обычно транскрибируется в клетках (открытая рамка считывания), включая 5' и 3'-UTR. Праймеры также могут быть разработаны для амплификации части нуклеиновой кислоты, которая кодирует конкретный интересующий домен. В одном варианте осуществления праймеры разработаны для амплификации кодирующей области человеческой кДНК, включая все или часть 5' и 3'-UTR. Праймеры, полезные для ПЦР, можно получать синтетическими методами, которые хорошо известны в данной области. «Прямые праймеры» представляют собой праймеры, которые содержат область нуклеотидов, в значительной степени комплементарных нуклеотидам на ДНК-матрице, находящимся выше последовательности ДНК, которая должна быть амплифицирована. В настоящем документе определение «выше» относится к 5'-направлению ДНК-последовательности, которая должна быть амплифицирована, относительно кодирующей цепи. «Обратные праймеры» представляют собой праймеры, которые содержат область нуклеотидов, в значительной степени комплементарных двухцепочечной ДНК-матрице, находящейся ниже последовательности ДНК, которая должна быть амплифицирована. В настоящем документе определение «ниже» относится к 3'-направлению ДНК-последовательности, которая должна быть амплифицирована, относительно кодирующей цепи.

Любую ДНК-полимеразу, применимую для ПЦР, можно использовать в способах, раскрытых в настоящем документе. Реагенты и полимераза коммерчески доступны из ряда источников.

Также можно использовать химические структуры, обладающие способностью повышать стабильность и/или эффективность трансляции. РНК предпочтительно имеет 5' и 3'-UTR. В одном варианте осуществления 5'-UTR имеет длину от одного до 3000 нуклеотидов. Длину последовательностей 5' и 3'-UTR, добавляемых к кодирующей области, можно изменять различными методами, включая, но не ограничиваясь ими, разработку праймеров для ПЦР, которые отжигаются с разными областями UTR. С использованием такого подхода любой специалист в данной области сможет модифицировать длину 5' и 3'-UTR, необходимую для достижения оптимальной эффективности трансляции после трансфекции транскрибированной РНК.

5' и 3'-UTR могут быть природными, эндогенными 5' и 3'-UTR для интересующей нуклеиновой кислоты. Альтернативно, последовательности UTR, которые не являются эндогенными для интересующей нуклеиновой кислоты, можно добавлять путем включения последовательностей UTR в прямой и обратный праймеры или путем любой другой модификации матрицы. Использование последовательностей UTR, которые не являются эндогенными для интересующей нуклеиновой кислоты, может быть полезным для модификации стабильности и/или эффективности трансляции РНК. Например, известно, что AU-богатые элементы в последовательностях 3'-UTR могут снижать стабильность мРНК. Вследствие этого, можно выбирать или разрабатывать 3'-UTR для повышения стабильности транскрибированной РНК, исходя из свойств UTR, которые хорошо известны в данной области.

В одном варианте осуществления 5'-UTR может содержать последовательность Козак (Kozak) эндогенной нуклеиновой кислоты. Альтернативно, если 5'-UTR, которая не является эндогенной для интересующей нуклеиновой кислоты, добавляют с помощью ПЦР, как описано выше, консенсусную последовательность Козак можно переконструировать путем добавления последовательности 5'-UTR. Последовательности Козак могут повышать эффективность трансляции некоторых транскриптов РНК, но, судя по всему, не являются необходимыми для всех РНК с точки зрения обеспечения эффективной трансляции. Необходимость последовательностей Козак для многих мРНК известна в данной области. В других вариантах осуществления 5'-UTR может представлять собой 5'-UTR РНК-вирусов, РНК геном которых стабилен в клетках. В других вариантах осуществления различные аналоги нуклеотидов можно использовать в 3' или 5'-UTR для предохранения от деградации мРНК экзонуклеазами.

Чтобы сделать возможным синтез РНК с ДНК-матрицы без необходимости в клонировании генов, промотор транскрипции должен быть присоединен к ДНК-матрице выше последовательности, которая должна быть транскрибирована. Если последовательность, которая действует как промотор для РНК-полимеразы, добавляют к 5'-концу прямого праймера, промотор РНК-полимеразы включается в ПЦР-продукт выше открытой рамки считывания, которая должна быть транскрибирована. В одном предпочтительном варианте осуществления промотор представляет собой промотор полимеразы T7, описанный в другом разделе настоящего документа. Другие полезные промоторы включают, но не ограничиваются ими, промоторы РНК-полимеразы T3 и SP6. Консенсусные нуклеотидные последовательности для промоторов T7, T3 и SP6 известны в данной области.

В предпочтительном варианте осуществления мРНК имеет как кэп на 5'-конце, так и 3'-поли(A) последовательность, которые определяют связывание рибосомы, инициацию трансляции и стабильность мРНК в клетке. На кольцевой ДНК-матрице, например, плазмидной ДНК, РНК-полимераза образует длинный конкатемерный продукт, который не подходит для экспрессии в эукариотических клетках. Транскрипция плазмидной ДНК, линеаризованной на конце 3'-UTR, приводит к образованию мРНК нормального размера, которая неэффективна в эукариотической трансфекции, даже при ее полиаденилировании после транскрипции.

На линейной ДНК-матрице РНК-полимераза фага T7 способна удлинять 3'-конец транскрипта за пределами последнего основания матрицы (Schenborn and Mierendorf, Nuc Acids Res., 13: 6223-36 (1985), Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-65 (2003).

Общепринятым методом интегрирования участков полиA/T в ДНК-матрицу является молекулярное клонирование. Однако последовательность полиA/T, интегрированная в плазмидную ДНК, может приводить к нестабильности плазмиды, поэтому плазмидные ДНК-матрицы, полученные из бактериальных клеток, часто сильно испорчены делециями и другими аберрациями. Это делает процедуры клонирования не только трудоемкими и отнимающими много времени, но часто ненадежными. Поэтому способ, позволяющий конструировать ДНК-матрицы с 3'-участком полиA/T без клонирования, крайне желателен.

Сегмент полиA/T транскрипционной ДНК-матрицы можно получать в процессе ПЦР, используя обратный праймер, содержащий полиT-последовательность, такую как последовательность 100T (SEQ ID NO: 110) (размер может составлять 50-5000 T (SEQ ID NO: 111)), или после ПЦР любым другим способом, включая, но не ограничиваясь ими, лигирование ДНК или in vitro рекомбинацию. Поли(A)-последовательности также способствуют стабильности молекул РНК и уменьшают их деградацию. Как правило, длина поли(A)-последовательности положительно коррелирует со стабильностью транскрибированной РНК. В одном варианте осуществления поли(A)-последовательность содержит от 100 до 5000 остатков аденозина (SEQ ID NO: 112).

Поли(A)-последовательности молекул РНК можно дополнительно удлинять после in vitro транскрипции, используя поли(A)-полимеразу, такую как полиA-полимераза E. coli (E-PAP). В одном варианте осуществления увеличение длины поли(A)-последовательности с 100 нуклеотидов до 300-400 нуклеотидов (SEQ ID NO: 113) приводит к примерно двукратному увеличению эффективности трансляции РНК. Кроме того, присоединение различных химических групп к 3'-концу может повышать стабильность мРНК. Такой присоединяемый фрагмент может содержать модифицированные/искусственные нуклеотиды, аптамеры и другие соединения. Например, аналоги АТФ можно включать в поли(A)-последовательность с использованием поли(A)-полимеразы. Аналоги АТФ могут дополнительно повышать стабильность РНК.

Наличие 5'-кэпов также способствует стабильности молекул РНК. В предпочтительном варианте осуществления РНК, полученные способами, раскрытыми в настоящем документе, содержат 5’-кэп. 5’-кэп получают с использованием методов, известных в данной области и описанных в настоящем документе (Cougot, et al., Trends in Biochem. Sci., 29: 436-444 (2001), Stepinski, et al., RNA, 7: 1468-95 (2001); Elango, et al., Biochim. Biophys. Res. Commun., 330: 958-966 (2005)).

Молекулы РНК, полученные способами, раскрытыми в настоящем документе, могут также содержать последовательность внутреннего участка связывания рибосомы (IRES). Последовательность IRES может быть любой вирусной, хромосомной или искусственно сконструированной последовательностью, которая инициирует независимое от кэпа связывание рибосомы с мРНК и способствует инициации трансляции. Можно добавлять любые растворенные вещества, подходящие для электропорации клеток, которые могут включать факторы, способствующие проницаемости и жизнеспособности клеток, такие как сахара, пептиды, липиды, белки, антиоксиданты и сурфактанты.

РНК можно вводить в целевые клетки с использованием любого из ряда различных методов, например, коммерчески доступных методов, которые включают, но не ограничиваются ими, электропорацию (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard Instruments, Boston, Mass.) или Gene Pulser II (BioRad, Denver, Colo.), Multiporator (Eppendort, Hamburg Germany), опосредованную катионными липосомами трансфекцию с использованием липофекции, полимерную инкапсуляцию, опосредованную пептидами трансфекцию или биолистические системы доставки частиц, такие как «генные пушки» (смотри, например, Nishikawa, et al. Hum Gene Ther., 12(8): 861-70 (2001).

Конструкции нуклеиновой кислоты, кодирующие CAR

Настоящее изобретение также относится к молекулам нуклеиновой кислоты, кодирующим одну или более конструкций CAR, описанных в настоящем документе. В одном аспекте молекула нуклеиновой кислоты предоставлена в виде транскрипта матричной РНК. В одном аспекте молекула нуклеиновой кислоты предоставлена в виде конструкции ДНК.

Соответственно, в одном аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей химерный антигенный рецептор (CAR), при этом CAR содержит анти-CD19 связывающий домен (например, гуманизированный анти-CD19 связывающий домен), трансмембранный домен и внутриклеточный сигнальный домен, содержащий стимулирующий домен, например, костимулирующий сигнальный домен и/или основной сигнальный домен, например, дзета-цепь. В одном варианте осуществления анти-CD19 связывающий домен представляет собой анти-CD19 связывающий домен, описанный в настоящем документе, например, анти-CD19 связывающий домен, который содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления трансмембранный домен представляет собой трансмембранный домен белка, выбранного из группы, состоящей из альфа, бета или дзета-цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154. В одном варианте осуществления трансмембранный домен содержит последовательность SEQ ID NO: 15 или последовательность, имеющую 95-99% идентичности с ней. В одном варианте осуществления анти-CD19 связывающий домен связан с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной в настоящем документе. В одном варианте осуществления кодируемая шарнирная область содержит SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или SEQ ID NO: 49, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления выделенная молекула нуклеиновой кислоты дополнительно содержит последовательность, кодирующую костимулирующий домен. В одном варианте осуществления костимулирующий домен представляет собой функциональный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137). В одном варианте осуществления костимулирующий домен содержит последовательность SEQ ID NO: 16 или последовательность, имеющую 95-99% идентичности с ней. В одном варианте осуществления внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и функциональный сигнальный домен CD3-дзета. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 или SEQ ID NO: 51, или последовательность, имеющую 95-99% идентичности с ними, и последовательность SEQ ID NO: 17 или SEQ ID NO: 43, или последовательность, имеющую 95-99% идентичности с ними, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессируются в одной и той же рамке считывания и в виде одной полипептидной цепи.

В другом аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей конструкцию CAR, содержащую лидерную последовательность SEQ ID NO: 13, домен scFv, имеющий последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12 (или последовательность, имеющую 95-99% идентичности с ними), шарнирную область SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или SEQ ID NO: 49 (или последовательность, имеющую 95-99% идентичности с ними), трансмембранный домен, имеющий последовательность SEQ ID NO: 15 (или последовательность, имеющую 95-99% идентичности с ней), костимулирующий домен 4-1BB, имеющий последовательность SEQ ID NO: 16, или костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 51 (или последовательность, имеющую 95-99% идентичности с ней), и стимулирующий домен CD3-дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 43 (или последовательность, имеющую 95-99% идентичности с ними).

В другом аспекте изобретение относится к выделенной молекуле полипептида, кодируемой молекулой нуклеиновой кислоты. В одном варианте осуществления выделенная молекула полипептида содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 и SEQ ID NO: 42, или последовательность, имеющую 95-99% идентичности с ними.

В другом аспекте изобретение относится к молекуле нуклеиновой кислоты, кодирующей молекулу химерного антигенного рецептора (CAR), который содержит анти-CD19 связывающий домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий стимулирующий домен, и при этом указанный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними.

В одном варианте осуществления кодируемая молекула CAR дополнительно содержит последовательность, кодирующую костимулирующий домен. В одном варианте осуществления костимулирующий домен представляет собой функциональный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18) и 4-1BB (CD137). В одном варианте осуществления костимулирующий домен содержит последовательность SEQ ID NO: 16. В одном варианте осуществления трансмембранный домен представляет собой трансмембранный домен белка, выбранного из группы, состоящей из альфа, бета или дзета-цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154. В одном варианте осуществления трансмембранный домен содержит последовательность SEQ ID NO: 15. В одном варианте осуществления внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и функциональный сигнальный домен дзета. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 и последовательность SEQ ID NO: 17, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессируются в одной и той же рамке считывания и в виде одной полипептидной цепи. В одном варианте осуществления анти-CD19 связывающий домен связан с трансмембранным доменом с помощью шарнирной области. В одном варианте осуществления шарнирная область содержит SEQ ID NO: 14. В одном варианте осуществления шарнирная область содержит SEQ ID NO: 45 или SEQ ID NO: 47, или SEQ ID NO: 49.

В другом аспекте изобретение относится к кодируемой молекуле CAR, содержащей лидерную последовательность SEQ ID NO: 13, домен scFv, имеющий последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID N0:11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними, шарнирную область SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или SEQ ID NO: 49, трансмембранный домен, имеющий последовательность SEQ ID NO: 15, костимулирующий домен 4-1BB, имеющий последовательность SEQ ID NO: 16, или костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 51, и стимулирующий домен CD3-дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления кодируемая молекула CAR содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 и SEQ ID NO: 42, или последовательность, имеющую 95-99% идентичности с ними.

Нуклеотидные последовательности, кодирующие нужные молекулы, можно получать с использованием рекомбинантных методов, известных в данной области, таких как, например, скрининг библиотек из клеток, экспрессирующих ген, извлечение гена из вектора, который, как известно, содержит его, или выделение непосредственно из клеток и тканей, содержащих ген, с использованием стандартных методик. Альтернативно, интересующую нуклеиновую кислоту можно получать синтетическими методами, а не клонированием.

Настоящее изобретение также относится к векторам, в которые вставлена ДНК по настоящему изобретению. Векторы, полученные из ретровирусов, таких как лентивирус, являются подходящими инструментами для достижения долгосрочного переноса генов, поскольку они делают возможной долговременную стабильную интеграцию трансгена и его распространение в дочерние клетки. Ленивирусные векторы имеют дополнительное преимущество относительно векторов, полученных из онко-ретровирусов, таких как вирусы мышиного лейкоза, в том, что они способны трансдуцировать не пролиферирующие клетки, такие, как гепатоциты. Они также имеют дополнительное преимущество в виде низкой иммуногенности.

В другом варианте осуществления вектор, содержащий нуклеиновую кислоту, кодирующую желаемый CAR по изобретению, представляет собой аденовирусный вектор (A5/35). В другом варианте осуществления экспрессию нуклеиновых кислот, кодирующих CAR, можно осуществлять с использованием транспозонов, таких как «спящая красавица», CRISPR-Cas9 и нуклеазы «цинковые пальцы». Смотри ниже статью June et al. 2009, Nature Reviews Immunology 9,10: 704-716, содержание которой включено в настоящий документ посредством ссылки.

В кратком изложении, экспрессия природных или синтетических нуклеиновых кислот, кодирующих CAR, как правило, достигается путем функционального связывания нуклеиновой кислоты, кодирующей полипептид CAR или его части, с промотором и включения конструкции в экспрессионный вектор. Векторы могут быть подходящими для репликации и интеграции в клетках эукариот. Типичные клонирующие векторы содержат терминаторы транскрипции и трансляции, последовательности инициации и промоторы, полезные для регуляции экспрессии нужной последовательности нуклеиновой кислоты.

Экспрессионные конструкции по настоящему изобретению можно также использовать для иммунизации нуклеиновой кислотой и генной терапии с использованием стандартных протоколов доставки генов. Методы доставки генов известны в данной области. Смотри, например, патенты США №№ 5399346, 5580859, 5589466, полное содержание которых включено в настоящий документ посредством ссылки. В другом варианте осуществления изобретение относится к вектору для генной терапии.

Нуклеиновую кислоту можно клонировать в ряд различных векторов. Например, нуклеиновую кислоту можно клонировать в вектор, включая, но не ограничиваясь ими, плазмиду, фагмиду, производное фага, животный вирус и космиду. Векторы, представляющие особый интерес, включают экспрессионные векторы, реплицируемые векторы, зондообразующие векторы и секвенирующие векторы.

Далее, экспрессионный вектор может быть введен в клетку в форме вирусного вектора. Технология вирусных векторов хорошо известна в данной области и описана, например, в Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY, и в других руководствах по вирусологии и молекулярной биологии. Вирусы, полезные в качестве векторов, включают, но не ограничиваются ими, ретровирусы, аденовирусы, аденоассоциированные вирусы, герпесвирусы и лентивирусы. Как правило, подходящий вектор содержит точку начала репликации, функциональную в по меньшей мере одном организме, последовательность промотора, удобные сайты эндонуклеаз рестрикции и один или более селективных маркеров (например, WO 01/96584, WO 01/29058 и патент США № 6326193).

Множество систем на основе вирусов разработано для переноса генов в клетки млекопитающих. Например, ретровирусы являются удобной платформой для систем доставки генов. Выбранный ген может быть вставлен в вектор и упакован в ретровирусные частицы с использованием методик, известных в данной области. Затем рекомбинантный вирус может быть выделен и доставлен в клетки субъекта либо in vivo, либо ex vivo. Множество ретровирусных систем известно в данной области. В некоторых вариантах осуществления используют аденовирусные векторы. Множество аденовирусных векторов известно в данной области. В одном варианте осуществления используют лентивирусные векторы.

Дополнительные промоторные элементы, например, энхансеры, регулируют частоту инициации транскрипции. Как правило, они расположены в области 30-110 п.н. выше сайта инициации, хотя показано, что многие промоторы содержат функциональные элементы также и ниже сайта инициации. Пространство между промоторными элементами часто бывает гибким, так что промоторная функция сохраняется, если элементы инвертированы или сдвинуты относительно друг друга. В промоторе тимидинкиназы (tk) пространство между промоторными элементами может быть увеличено до 50 п.н., прежде чем активность начинает снижаться. Похоже, что в зависимости от промотора отдельные элементы могут действовать либо совместно, либо независимо, активируя транскрипцию.

Примером промотора, который способен экспрессировать трансген CAR в T-клетках млекопитающих, является промотор EF1a. Природный промотор EF1a управляет экспрессией альфа-субъединицы комплекса фактора элонгации 1, который отвечает за ферментативную доставку аминоацил-тРНК к рибосоме. Промотор EF1a широко используется в экспрессионных плазмидах в клетках млекопитающих и показано, что он является эффективным для управления экспрессией CAR с трансгенов, клонированных в лентивирусный вектор. Смотри, например, Milone et al., Mol. Ther. 17(8): 1453-1464 (2009). В одном аспекте промотор EF1a содержит последовательность, приведенную в SEQ ID NO: 100.

Другим примером промотора является последовательность предраннего промотора цитомегаловируса (CMV). Эта последовательность промотора представляет собой последовательность сильного конститутивного промотора, способного обеспечивать высокие уровни экспрессии любой полинуклеотидной последовательности, функционально связанной с ним. Однако также можно использовать и другие последовательности конститутивных промоторов, включая, но не ограничиваясь ими, ранний промотор вируса обезьян 40 (SV40), промотор вируса опухоли молочной железы мышей (MMTV), промотор длинного концевого повтора (LTR) вируса иммунодефицита человека (ВИЧ), промотор MoMuLV, промотор вируса птичьего лейкоза, предранний промотор вируса Эпштейна-Барр, промотор вируса саркомы Рауса, а также промоторы генов человека, такие как, но не ограничиваясь ими, промотор актина, промотор миозина, промотор фактора элонгации 1α, промотор гемоглобина и промотор креатинкиназы. Кроме того, изобретение не должно быть ограничено использованием конститутивных промоторов. Индуцируемые промоторы также предусмотрены как часть изобретения. Использование индуцируемых промоторов обеспечивает молекулярный переключатель, способный включать экспрессию полинуклеотидной последовательности, которая функционально связана с ним, когда такая экспрессия желательна, или выключать экспрессию, когда экспрессия нежелательна. Примеры индуцируемых промоторов включают, но не ограничиваются ими, промотор металлотионина, промотор глюкокортикоида, промотор прогестерона и промотор тетрациклина.

Для оценки экспрессии полипептида CAR или его части экспрессионный вектор, вводимый в клетку, может также содержать или ген селективного маркера, или репортерный ген, или оба, для облегчения идентификации и отбора экспрессирующих клеток из популяции клеток, которые предположительно трансфицированы или инфицированы при помощи вирусных векторов. В других аспектах селективный маркер можно размещать на отдельном фрагменте ДНК и использовать в процедуре совместной трансфекции. Как гены селективных маркеров, так и репортерные гены могут быть фланкированы соответствующими регуляторными последовательностями, делающими возможной экспрессию в клетках-хозяевах. Полезные селективные маркеры включают, например, гены устойчивости к антибиотикам, такие как neo, и тому подобные.

Репортерные гены используют для идентификации потенциально трансфицированных клеток и для оценки функциональности регуляторных последовательностей. Как правило, репортерный ген представляет собой ген, который не присутствует или не экспрессируется организмом или тканью реципиента и который кодирует полипептид, экспрессия которого проявляется некоторыми легко обнаруживаемыми свойствами, например, ферментативной активностью. Экспрессию репортерного гена анализируют в соответствующее время после того, как ДНК была введена в реципиентные клетки. Подходящие репортерные гены могут включать гены, кодирующие люциферазу, бета-галактозидазу, хлорамфеникол-ацетилтрансферазу, секретируемую щелочную фосфатазу, или ген зеленого флуоресцентного белка (например, Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Подходящие системы экспрессии хорошо известны и могут быть получены с использованием известных методов или приобретены коммерческим путем. Как правило, конструкция с минимальной 5'-фланкирующей областью, демонстрирующий наивысший уровень экспрессии репортерного гена, идентифицируют как промотор. Такие промоторные области могут быть связаны с репортерным геном и использованы для оценки агентов на способность модулировать управляемую промотором транскрипцию.

Методы введения и экспрессии генов в клетке известны в данной области. В контексте экспрессионного вектора, вектор можно легко вводить в клетку-хозяина, например, клетки млекопитающих, бактерий, дрожжей или насекомых, любым методом, известным в данной области. Например, экспрессионный вектор можно переносить в клетку-хозяина физическими, химическими или биологическими методами.

Физические методы введения полинуклеотида в клетку-хозяина включают осаждение фосфатом кальция, липофекцию, бомбардировку частицами, микроинъекцию, электропорацию и тому подобное. Методы получения клеток, содержащих векторы и/или экзогенные нуклеиновые кислоты, хорошо известны в данной области. Смотри, например, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY. Предпочтительным методом введения полинуклеотида в клетку-хозяина является трансфекция с помощью фосфата кальция.

Биологические методы введения интересующего полинуклеотида в клетку-хозяина включают использование ДНК и РНК векторов. Вирусные векторы, и особенно ретровирусные векторы, стали наиболее распространенным средством для введения генов в клетки млекопитающих, например, клетки человека. Другие вирусные векторы можно получать из лентивирусов, поксвирусов, вируса простого герпеса I, аденовирусов и аденоассоциированных вирусов, и тому подобных. Смотри, например, патенты США №№ 5350674 и 5585362.

Химические средства для введения полинуклеотида в клетку-хозяина включают коллоидные дисперсные системы, такие как макромолекулярные комплексы, нанокапсулы, микросферы, гранулы и системы на основе липидов, включая эмульсии типа масло-в-воде, мицеллы, смешанные мицеллы и липосомы. Иллюстративной коллоидной системой для использования в качестве средства доставки in vitro и in vivo, является липосома (например, искусственный мембранный везикул). Доступны и другие современные методы доставки нуклеиновых кислот, такие как доставка полинуклеотидов с направленными на цель наночастицами или другие подходящие системы доставки субмикронных размеров.

В случае использования невирусной системы доставки иллюстративным средством доставки является липосома. Использование липидных препаратов предусмотрено для введения нуклеиновых кислот в клетку-хозяина (in vitro, ex vivo или in vivo). В другом аспекте нуклеиновую кислоту можно связывать с липидом. Нуклеиновая кислота, связанная с липидом, может быть инкапсулирована в водную внутреннюю область липосомы, заключена в липидный бислой липосомы, присоединена к липосоме через связующую молекулу, которая связана как с липосомой, так и с олигонуклеотидом, заключена в липосому, находиться в комплексе с липосомой, быть диспергирована в растворе, содержащем липид, смешана с липидом, объединена с липидом, содержаться в виде суспензии в липиде, содержаться в, или образовывать комплекс с мицеллами, либо быть иным образом связанной с липидом. Композиции липида, смеси липид/ДНК или липид/экспрессионный вектор не имеют ограничения в отношении какой-либо конкретной структуры в растворе. Например, они могут присутствовать в двухслойной структуре, в виде мицелл или иметь «деформированную» структуру. Они могу также быть просто рассеяны в растворе, возможно, образуя агрегаты, неодинаковые по размеру или форме. Липиды представляют собой жирные вещества, которые могут быть природными или синтетическими. Например, липиды включают жирные капли, которые естественным образом возникают в цитоплазме, а также класс соединений, которые включают алифатические углеводороды с длинной цепью и их производные, такие как жирные кислоты, спирты, амины, аминоспирты и альдегиды.

Подходящие для использования липиды можно получать из коммерческих источников. Например, димиристилфосфатидилхолин («DMPC») можно приобретать у Sigma, St. Louis, MO; дицетилфосфат («DCP») можно приобретать у K & K Laboratories (Plainview, NY); холестерин («Choi») можно приобретать у Calbiochem-Behring; димиристилфосфатидилглицерин («DMPG») и другие липиды можно приобретать у Avanti Polar Lipids, Inc. (Birmingham, AL.). Маточные растворы липидов в хлороформе или смеси хлороформ/метанол можно хранить при температуре примерно -20°C. Хлороформ используют в качестве единственного растворителя, поскольку он испаряется легче, чем метанол. «Липосома» является общим термином, охватывающим различные одно- и многослойные липидные везикулы, образованные путем создания замкнутых липидных бислоев или агрегатов. Липосомы можно охарактеризовать как имеющие везикулярные структуры с фосфолипидной двухслойной мембраной и содержащейся внутри водной средой. Многослойные липосомы имеют несколько липидных слоев, разделенных водной средой. Они образуются спонтанно, когда фосфолипиды суспендируют в избытке водного раствора. Липидные компоненты претерпевают само-перегруппировку перед образованием замкнутых структур и заключением воды и растворенных веществ между липидными бислоями (Ghosh et al., 1991 Glycobiology 5: 505-10). Однако композиции, имеющие структуры в растворе, отличающиеся от нормальных везикулярных структур, также включены в объем изобретения. Например, липиды могут принимать мицеллярную структуру или просто существовать в виде неоднородных агрегатов липидных молекул. Предусмотрены также комплексы липофектамин-нуклеиновая кислота.

Независимо от метода, используемого для введения экзогенных нуклеиновых кислот в клетку-хозяина или иным образом подвергания клетки воздействию ингибитора по настоящему изобретению, можно выполнять различные анализы для подтверждения присутствия последовательности рекомбинантной ДНК в клетке-хозяине. Такие анализы включают, например, «молекулярно-биологические» анализы, хорошо известные специалистам в данной области, такие как саузерн- и нозерн-блоттинг, ОТ-ПЦР и ПЦР; «биохимические» анализы, такие как обнаружение присутствия или отсутствия конкретного пептида, например, иммунологическими методами (различные ELISA и вестерн-блоттинг), или анализы, описанные в настоящем документе, для идентификации агентов, попадающих в объем изобретения.

Кроме того, настоящее изобретение относится к вектору, содержащему кодирующую CAR молекулу нуклеиновой кислоты. В одном аспекте вектор CAR может быть напрямую трансдуцирован в клетку, например, T-клетку. В одном аспекте вектор представляет собой клонирующий или экспрессионный вектор, например, вектор, включающий, но не ограничивающийся ими, одну или более плазмид (например, экспрессионных плазмид, клонирующих векторов, миниколец, минивекторов, двойных микрохромосом), ретровирусные и лентивирусные векторные конструкции. В одном аспекте вектор способен экспрессировать конструкцию CAR в T-клетках млекопитающих. В одном аспекте T-клетка млекопитающих представляет собой человеческую T-клетку.

Источники T-клеток

Перед наращиванием и генетической модификацией T-клетки получают от субъекта. Термин «субъект» относится к живым организмам, у которых может быть индуцирован иммунный ответ (например, млекопитающим). Примеры субъектов включают людей, собак, кошек, мышей, крыс и трансгенные разновидности животных. T-клетки можно получать из различных источников, включая мононуклеарные клетки периферической крови, костный мозг, ткань лимфатических узлов, пуповинную кровь, ткань тимуса, ткань из инфицированного участка, асциты, плевральный выпот, ткань селезенки и опухоли. В некоторых аспектах настоящего изобретения можно использовать любое количество T-клеточных линий, доступных в данной области. В некоторых аспектах настоящего изобретения T-клетки можно получать из образца крови субъекта с использованием различных методик, известных специалисту в данной области, например разделения при помощи фиколла (Ficoll™). В одном предпочтительном аспекте клетки из циркулирующей крови индивидуума получают путем афереза. Продукт афереза, как правило, содержит лимфоциты, включая T-клетки, моноциты, гранулоциты, B-клетки, другие ядросодержащие белые кровяные клетки, эритроциты и тромбоциты. В одном аспекте клетки, собранные в процессе афереза, могут быть промыты для удаления фракции плазмы и для переноса клеток в соответствующий буфер или среду для последующих этапов обработки. В одном аспекте изобретения клетки промывают фосфатно-солевым буфером (PBS). В альтернативном аспекте в промывающем растворе отсутствует кальций и может отсутствовать магний, или могут отсутствовать многие, если не все, двухвалентные катионы. Начальные этапы активации в отсутствие кальция могут приводить к усиленной активации. Как специалисты в данной области легко поймут, этап промывания можно выполнять методами, известными специалистам в данной области, например, с использованием полуавтоматической «проточной» центрифуги (например, Cobe 2991 cell processor, Baxter CytoMate или Haemonetics Cell Saver 5) в соответствии с инструкциями изготовителя. После промывания клетки можно ресуспендировать в различных биосовместимых буферах, таких как, например, не содержащий Ca, не содержащий Mg PBS, PlasmaLyte A или другой солевой раствор с буфером или без буфера. Альтернативно, нежелательные компоненты образца после афереза можно удалять и клетки непосредственно ресуспендировать в культуральной среде.

В одном аспекте T-клетки выделяют из лимфоцитов периферической крови путем лизиса эритроцитов и истощения моноцитов, например, центрифугированием в градиенте перколла (PERCOLL™) или проточным элютриационным центрифугированием. Конкретные субпопуляции T-клеток, такие как CD3+, CD28+, CD4+, CD8+, CD45RA+ и CD45RO+ T-клетки, можно дополнительно выделять методами положительной или отрицательной селекции. Например, в одном аспекте T-клетки выделяют путем инкубации с анти-CD3/анти-CD28 (например, 3x28)-конъюгированными гранулами, такими как DYNABEADS® M-450 CD3/CD28 T, в течение периода времени, достаточного для положительной селекции нужных T-клеток. В одном аспекте период времени составляет примерно 30 минут. В следующем аспекте период времени находится в диапазоне от 30 минут до 36 часов или более, включая все целочисленные значения в этом диапазоне. В следующем аспекте период времени составляет по меньшей мере 1, 2, 3, 4, 5 или 6 часов. В еще одном предпочтительном аспекте период времени составляет от 10 до 24 часов. В одном аспекте период времени инкубации составляет 24 часа. Более длительные времена инкубации можно использовать для выделения T-клеток в любой ситуации, когда присутствует небольшое количество T-клеток по сравнению с клетками других типов, например, при выделении инфильтрирующих опухоль лимфоцитов (TIL) из опухолевой ткани или в случае образцов, полученных от индивидуумов с иммунной недостаточностью. Кроме того, использование более длинных периодов инкубации может повысить эффективность захвата CD8+ T-клеток. Таким образом, просто за счет сокращения или увеличения времени инкубации T-клеткам дают возможность связываться с CD3/CD28 гранулами, и/или за счет увеличения или уменьшения соотношения гранул и T-клеток (как описано далее в настоящем документе) можно предпочтительно отбирать субпопуляции T-клеток по положительному или отрицательному принципу в начале культивирования или в любые моменты времени в процессе культивирования. Кроме того, за счет увеличения или уменьшения соотношения анти-CD3 и/или анти-CD28 антител на гранулах или другой поверхности можно предпочтительно отбирать субпопуляции T-клеток по положительному или отрицательному принципу в начале культивирования или в любые моменты времени в процессе культивирования. Специалисту в данной области будет понятно, что в контексте данного изобретения можно также использовать несколько раундов отбора. В некоторых аспектах может быть желательным выполнение процедуры отбора и использование «неотобранных» клеток в процессе активации и наращивания. «Неотобранные» клетки можно также подвергать дальнейшим раундам отбора.

Обогащение популяции T-клеток путем отрицательной селекции можно осуществлять, используя сочетание антител, направленных на поверхностные маркеры, уникальные для отобранных по отрицательному принципу клеток. Одним из способов является сортировка клеток и/или отбор путем «отрицательной» магнитной иммуноадгезии или проточной цитометрии, в которой используют коктейль моноклональных антител, направленных на поверхностные клеточные маркеры, присутствующие на клетках, отбираемых по отрицательному принципу. Например, для обогащения CD4+ клеток методом отрицательной селекции коктейль моноклональных антител, как правило, содержит антитела к CD14, CD20, CD11b, CD16, HLA-DR и CD8. В некоторых аспектах может быть желательным обогащение или положительная селекция на регуляторные T-клетки, которые, как правило, экспрессируют CD4+, CD25+, CD62Lhi, GITR+ и FoxP3+. Альтернативно, в некоторых аспектах регуляторные T-клетки истощают с помощью анти-C25-конъюгированных гранул или другого аналогичного метода селекции.

В одном варианте осуществления можно отбирать популяцию T-клеток, которые экспрессируют один или более из IFN-γ, TNFα, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, гранзима B и перфорина, или другие соответствующие молекулы, например, другие цитокины. Методы скрининга на клеточную экспрессию можно выбирать, например, из методов, описанных в PCT публикации № WO 2013/126712.

Для выделения нужной популяции клеток с помощью положительной или отрицательной селекции можно варьировать концентрацию клеток и размер поверхности (например, частиц, таких как гранулы). В некоторых аспектах может быть желательным значительное уменьшение объема, в котором гранулы и клетки смешивают вместе (например, увеличение концентрации клеток), для обеспечения максимального контакта клеток и гранул. Например, в одном аспекте используют концентрацию 2 миллиарда клеток/мл. В одном аспекте используют концентрацию 1 миллиард клеток/мл. В следующем аспекте используют концентрацию более чем 100 миллионов клеток/мл. В следующем аспекте используют концентрацию клеток, составляющую 10, 15, 20, 25, 30, 35, 40, 45 или 50 миллионов клеток/мл. В еще одном аспекте используют концентрацию клеток, составляющую 75, 80, 85, 90, 95, или 100 миллионов клеток/мл. В следующих аспектах можно использовать концентрации 125 или 150 миллионов клеток/мл. Использование высоких концентраций может приводить к увеличенному выходу клеток, активации клеток и размножению клеток. Кроме того, использование высоких концентраций клеток позволяет более эффективно захватывать клетки, которые могут слабо экспрессировать интересующие целевые антигены, например, CD28-отрцательные T-клетки, или в случае образцов, в которых присутствует много клеток опухолей (например, лейкозная кровь, опухолевая ткань и так далее). Такие популяции клеток могут иметь терапевтическое значение, и их получение может быть желательным. Например, использование высоких концентраций клеток позволяет более эффективно отбирать CD8+ T-клетки, которые, как правило, отличаются слабой экспрессией CD28.

В связанном аспекте может быть желательным использование более низких концентраций клеток. В результате значительного разбавления смеси T-клеток и связывающей поверхности (например, частиц, таких как гранулы) взаимодействие между частицами и клетками сводится к минимуму. Это позволяет отбирать клетки, которые экспрессируют большие количества нужных антигенов, которые должны связываться с частицами. Например, CD4+ T-клетки экспрессируют высокие уровни CD28 и более эффективно захватываются, чем CD8+ T-клетки, в низкой концентрации. В одном аспекте используемая концентрация клеток составляет 5×106/мл. В других аспектах используемая концентрация может составлять от примерно 1×105/мл до 1×106/мл, включая любое целочисленное значение в этом диапазоне.

В других аспектах клетки можно инкубировать на ротаторе в течение различного времени при различных скоростях, либо при температуре 2-10°C, либо при комнатной температуре.

T-клетки для стимуляции можно также замораживать после этапа промывания. Без привязки к какой-либо теории, замораживание и последующий этап оттаивания приводит к получению более однородного продукта за счет удаления гранулоцитов и в некоторой степени моноцитов из клеточной популяции. После этапа промывания, который удаляет плазму и тромбоциты, клетки можно суспендировать в растворе для замораживания. При том, что многие растворы для замораживания и параметры известны в данной области и будут полезны в данном контексте, один из методов включает использование PBS, содержащего 20% ДМСО и 8% человеческого сывороточного альбумина, или культуральной среды, содержащей 10% декстрана 40 и 5% декстрозы, 20% человеческого сывороточного альбумина и 7,5% ДМСО, или 31,25% Plasmalyte-A, 31,25% декстрозы 5%, 0,45% NaCl, 10% декстрана 40 и 5% декстрозы, 20% человеческого сывороточного альбумина и 7,5% ДМСО, или другой подходящей среды для замораживания клеток, содержащей, например, Hespan и PlasmaLyte A, затем клетки замораживают при температуре -80°C со скоростью 1° в минуту и хранят в паровой фазе в резервуаре с жидким азотом. Можно использовать и другие методы контролируемого замораживания, а также неконтролируемое замораживание сразу при температуре -20°C или в жидком азоте.

В некоторых аспектах криоконсервированные клетки размораживают и промывают, как описано в настоящем документе, и оставляют на один час при комнатной температуре перед активацией с использованием способов по настоящему изобретению.

В контексте изобретения также предусмотрен сбор образцов крови или продукта афереза от субъекта за некоторое время до того, когда могут понадобиться размноженные клетки, описанные в настоящем документе. Таким образом, источник клеток, которые будут наращиваться, может быть получен в любой необходимый момент времени, и нужные клетки, такие как T-клетки, могут быть выделены и заморожены для более позднего использования в T-клеточной терапии для целого ряда заболеваний или состояний, на которые благоприятно подействует T-клеточная терапия, например, для таких, которые описаны в настоящем документе. В одном аспекте образец крови или продукт афереза получают от, в целом, здорового субъекта. В некоторых аспектах образец крови или продукт афереза получают от, в целом, здорового субъекта, который имеет риск развития заболевания, но у которого пока не развилось заболевание, и интересующие клетки выделяют и замораживают для более позднего использования. В некоторых аспектах T-клетки можно наращивать, замораживать и использовать позже. В некоторых аспектах образцы собирают у пациента вскоре после диагностирования конкретного заболевания, описанного в настоящем документе, но до проведения какого-либо лечения. В следующем аспекте клетки выделяют из образца крови или продукта афереза, полученного от субъекта, до применения каких-либо соответствующих методов лечения, в том числе, но без ограничения, лечения такими средствами, как натализумаб, эфализумаб, противовирусные средства, химиотерапия, облучение, иммунодепрессанты, такие как циклоспорин, азатиоприн, метотрексат, микофенолят и FK506, антитела или другие иммуноаблативные средства, такие как кампат, анти-CD3 антитела, цитоксан, флударабин, циклоспорин, FK506, рапамицин, микофеноловая кислота, стероиды, FR901228 и облучение.

В других аспектах настоящего изобретения T-клетки получают от пациента непосредственно после лечения, которое оставляет субъекта с функциональными T-клетками. В связи с этим, было отмечено, что после определенного противоракового лечения, в частности, лечения лекарственными средствами, которые повреждают иммунную систему, вскоре после лечения во время периода, когда пациенты, как правило, восстанавливаются после лечения, качество полученных T-клеток может быть оптимальным или улучшенным с точки зрения способности к размножению ex vivo. Аналогично, после ex vivo манипуляции с использованием способов, описанных в настоящем документе, эти клетки могут быть в предпочтительном состоянии для более эффективного приживления и размножения in vivo. Таким образом, в контексте настоящего изобретения предусмотрен сбор клеток крови, включая T-клетки, дендритные клетки или другие клетки гематопоэтической линии дифференцировки, во время этой фазы восстановления. Кроме того, в некоторых аспектах режимы мобилизации (например, мобилизации при помощи GM-CSF) и кондиционирования можно использовать для создания такого состояния у субъекта, которое способствует репопуляции, рециркуляции, регенерации и/или размножению клеток конкретных типов, особенно в течение определенного окна времени после терапии. Иллюстративные типы клеток включают T-клетки, B-клетки, дендритные клетки, а также другие клетки иммунной системы.

Активация и наращивание T-клеток

T-клетки можно активировать и наращивать, как правило, с использованием методов, описанных, например, в патентах США 6352694, 6534055, 6905680, 6692964, 5858358, 6887466, 6905681, 7144575, 7067318, 7172869, 7232566, 7175843, 5883223, 6905874, 6797514, 6867041 и публикации патентной заявки США № 20060121005.

Как правило, T-клетки по изобретению можно наращивать в условиях контакта с поверхностью, к которой присоединено средство, стимулирующее ассоциированный с комплексом CD3/TCR сигнал и лиганд, стимулирующий костимулирующую молекулу на поверхности T-клеток. В частности, популяции T-клеток можно стимулировать, как описано в настоящем документе, например, путем контакта с анти-CD3 антителом или его антигенсвязывающим фрагментом, или анти-CD2 антителом, иммобилизованным на поверхности, или путем контакта с активатором протеинкиназы C (например, бриостатином) в сочетании с кальциевым ионофором. Для костимуляции вспомогательной молекулы на поверхности T-клеток используют лиганд, связывающий вспомогательную молекулу. Например, можно создавать контакт популяции T-клеток с анти-CD3 антителом и анти-CD28 антителом в условиях, подходящих для стимуляции пролиферации T-клеток. Для стимуляции пролиферации либо CD4+ T-клеток, либо CD8+ T-клеток используют анти-CD3 антитело и анти-CD28 антитело. Примеры анти-CD28 антител, которые можно использовать, включают 9.3, B-T3, XR-CD28 (Diaclone, Besançon, France), а также и другие методы, общеизвестные в данной области (Berg et al., Transplant Proc. 30(8): 3975-3977, 1998, Haanen et al., J. Exp. Med. 190(9): 13191328, 1999, Garland et al., J. Immunol Meth. 227(1-2): 53-63, 1999).

В некоторых аспектах основной стимулирующий сигнал и костимулирующий сигнал для T-клетки можно обеспечивать в соответствии с разными протоколами. Например, агенты, обеспечивающие каждый сигнал, могут быть в растворе или связаны с поверхностью. В случае связывания с поверхностью агенты могут быть связаны с одной и той же поверхностью (то есть, в «цис» конфигурации) или на отдельных поверхностях (то есть, в «транс» конфигурации). Альтернативно, один агент может быть связан с поверхностью и другой агент может находиться в растворе. В одном аспекте агент, обеспечивающий костимулирующий сигнал, связан с клеточной поверхностью и агент, обеспечивающий основной сигнал активации, находится в растворе или связан с поверхностью. В некоторых аспектах оба агента могут находиться в растворе. В одном аспекте агенты могут находиться в растворимой форме и затем быть сшиты с поверхностью, например, клетки, экспрессирующей Fc-рецепторы или антитело или другое связующее средство, которое будет связываться с агентами. В этом отношении, смотри, например, публикации патентных заявок США №№ 20040101519 и 20060034810 для получения информации об искусственных антигенпредставляющих клетках (иАПК), предусмотренных для использования в активации и наращивании T-клеток по настоящему изобретению.

В одном аспекте два агента иммобилизованы на гранулах, либо на одной и той же грануле, то есть, «цис», либо на отдельных гранулах, то есть, «транс». В качестве примера, агент, обеспечивающий основной сигнал активации, представляет собой анти-CD3 антитело или его антигенсвязывающий фрагмент и агент, обеспечивающий костимулирующий сигнал, представляет собой анти-CD28 антитело или его антигенсвязывающий фрагмент; и оба агента совместно иммобилизованы на одной и той же грануле в эквивалентных молекулярных количествах. В одном аспекте используют соотношение 1:1 каждого из антител, связанных с гранулами, для размножения CD4+ T-клеток и роста T-клеток. В некоторых аспектах настоящего изобретения используют соотношение анти-CD3:CD28 антител, связанных с гранулами, такое, что наблюдается повышенное размножение T-клеток по сравнению с размножением, наблюдаемым при использовании соотношения 1:1. В одном конкретном аспекте наблюдается увеличение от примерно 1 до примерно 3 раз по сравнению с размножением, наблюдаемым при использовании соотношения 1:1. В одном аспекте соотношение анти-CD3:CD28 антител, связанных с гранулами, находится в диапазоне от 100: 1 до 1: 100, включая все целочисленные значения в этом диапазоне. В одном аспекте настоящего изобретения с частицами связано большее количество анти-CD28 антитела, чем анти-CD3 антитела, то есть, соотношение CD3:CD28 составляет менее единицы. В некоторых аспектах изобретения соотношение анти-CD28 антитела и анти-CD3 антитела, связанных с гранулами, составляет более чем 2:1. В одном конкретном аспекте используют соотношение CD3:CD28 антител, связанных с гранулами, равное 1:100. В одном аспекте используют соотношение CD3:CD28 антител, связанных с гранулами, равное 1:75. В следующем аспекте используют соотношение CD3:CD28 антител, связанных с гранулами, равное 1:50. В одном аспекте используют соотношение CD3:CD28 антител, связанных с гранулами, равное 1:30. В одном предпочтительном аспекте используют соотношение CD3:CD28 антител, связанных с гранулами, равное 1:10. В одном аспекте используют соотношение CD3:CD28 антител, связанных с гранулами, равное 1:3. В еще одном аспекте используют соотношение CD3:CD28 антител, связанных с гранулами, равное 3:1.

Можно использовать частицы и клетки в соотношении, составляющем от 1:500 до 500:1, включая любые целочисленные значения в этом диапазоне, для стимуляции T-клеток или других целевых клеток. Как легко поймут специалисты в данной области, соотношение частиц и клеток может зависеть от размера частиц относительно целевой клетки. Например, гранулы небольшого размера могут связывать лишь несколько клеток, тогда как более крупные гранулы могут связывать много клеток. В некоторых аспектах соотношение клеток и частиц находится в диапазоне от 1:100 до 100:1, включая любые целочисленные значения в этом диапазоне, и в следующих аспектах соотношение, составляющее от 1:9 до 9:1, включая любые целочисленные значения в этом диапазоне, также можно использовать для стимуляции T-клеток. Соотношение анти-CD3- и анти-CD28-конъюгированных частиц и T-клеток, которое приводит к стимуляции T-клеток, может варьироваться, как указано выше, однако некоторые предпочтительные значения включают 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1 и 15:1, с одним предпочтительным соотношением частиц и T-клеток, составляющим по меньшей мере 1:1. В одном аспекте используют соотношение частиц и клеток, составляющее 1:1 или менее. В одном конкретном аспекте предпочтительное соотношение частицы: клетки составляет 1:5. В следующих аспектах соотношение частиц и клеток может варьироваться в зависимости от дня стимуляции. Например, в одном аспекте соотношение частиц и клеток составляет от 1:1 до 10:1 в первый день и дополнительные частицы добавляют к клеткам каждый день или через день после этого в течение вплоть до 10 дней, с конечным соотношением, составляющим от 1:1 до 1:10 (из расчета количества клеток в день добавления). В одном конкретном аспекте соотношение частиц и клеток составляет 1:1 в первый день стимуляции и его доводят до 1:5 в третий и пятый дни стимуляции. В одном аспекте частицы добавляют ежедневно или через день до конечного соотношения 1:1 в первый день и 1:5 в третий и пятый дни стимуляции. В одном аспекте соотношение частиц и клеток составляет 2:1 в первый день стимуляции и его доводят до 1:10 в третий и пятый дни стимуляции. В одном аспекте частицы добавляют ежедневно или через день до конечного соотношения 1:1 в первый день и 1:10 в третий и пятый дни стимуляции. Специалисту в данной области будет понятно, что различные другие соотношения могут быть подходящими для использования по настоящему изобретению. В частности, соотношение будет зависеть от размера частиц и от размера и типа клеток. В одном аспекте наиболее типичные используемые соотношения составляют около 1:1, 2:1 и 3:1 в первый день.

В других аспектах настоящего изобретения клетки, такие как T-клетки, объединяют с покрытыми агентами гранулами, затем гранулы и клетки разделяют и после этого клетки культивируют. В альтернативном аспекте перед культивированием покрытые агентами гранулы и клетки не разделяют, а культивируют вместе. В следующем аспекте гранулы и клетки сначала концентрируют путем приложения силы, такой как магнитная сила, что приводит к усиленному связыванию поверхностных маркеров клеток, вызывающему стимуляцию клеток.

В качестве примера, белки клеточной поверхности могут быть связаны за счет того, что парамагнитные гранулы, с которыми связаны анти-CD3 и анти-CD28 (3x28 гранулы), контактируют с T-клетками. В одном аспекте клетки (например, 104-109 T-клеток) и гранулы (например, DYNABEADS® M-450 CD3/CD28 T парамагнитные гранулы в соотношении 1:1) объединяют в буфере, например, PBS (без двухвалентных катионов, таких как кальций и магний). Опять-таки, специалисты в данной области легко поймут, что можно использовать клетки в любой концентрации. Например, целевая клетка может быть очень редкой в образце и составлять только 0,01% от образца или весь образец (то есть, 100%) может представлять собой интересующую целевую клетку. Соответственно, любое количество клеток попадает в контекст настоящего изобретения. В некоторых аспектах может быть желательным значительное уменьшение объема, в котором частицы и клетки смешивают вместе (то есть, увеличение концентрации клеток), для обеспечения максимального контакта клеток и частиц. Например, в одном аспекте используют концентрацию примерно 2 миллиарда клеток/мл. В одном аспекте используют концентрацию более чем 100 миллионов клеток/мл. В следующем аспекте используют концентрацию клеток 10, 15, 20, 25, 30, 35, 40, 45, или 50 миллионов клеток/мл. В еще одном аспекте используют концентрацию клеток 75, 80, 85, 90, 95 или 100 миллионов клеток/мл. В следующих аспектах можно использовать концентрации 125 или 150 миллионов клеток/мл. Использование высоких концентраций может приводить к увеличенному выходу клеток, активации клеток и размножению клеток. Кроме того, использование высоких концентраций клеток позволяет более эффективно захватывать клетки, которые могут слабо экспрессировать интересующие целевые антигены, например, CD28-отрцательные T-клетки. Такие популяции клеток могут иметь терапевтическое значение, и в некоторых аспектах их получение может быть желательным. Например, использование высоких концентраций клеток позволяет более эффективно отбирать CD8+ T-клетки, которые, как правило, отличаются слабой экспрессией CD28.

В одном аспекте настоящего изобретения смесь можно культивировать от нескольких часов (примерно 3 часов) до примерно 14 дней, включая любое целочисленное количество часов в этом диапазоне. В одном аспекте смесь можно культивировать в течение 21 дня. В одном аспекте изобретения гранулы и T-клетки культивируют вместе в течение примерно восьми дней. В одном аспекте гранулы и T-клетки культивируют вместе в течение 2-3 дней. Также может быть желательным использование нескольких циклов стимуляции так, что время культивирования T-клеток может составлять 60 дней или более. Условия, подходящие для культивирования Т-клеток, включают соответствующую среду (например, минимальную поддерживающую среду или среду RPMI 1640, или X-vivo 15 (Lonza)), которая может содержать факторы, необходимые для пролиферации и жизнеспособности, включая сыворотку (например, эмбриональную бычью сыворотку или человеческую сыворотку), интерлейкин-2 (IL-2), инсулин, IFN-γ, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFβ и TNF-α, или любые другие добавки для роста клеток, известные квалифицированным специалистам. Другие добавки для роста клеток включают, но не ограничиваются ими, сурфактант, плазманат и восстанавливающие средства, такие как N-ацетилцистеин и 2-меркаптоэтанол. Среда может включать RPMI 1640, AIM-V, DMEM, MEM, α-MEM, F-12, X-Vivo 15 и X-Vivo 20, Optimizer, с добавленными аминокислотами, пируватом натрия и витаминами, либо без сыворотки, либо с добавлением соответствующего количества сыворотки (или плазмы) или определенного набора гормонов и/или некоторого количества цитокина(ов), достаточного для роста и размножения T-клеток. Антибиотики, например, пенициллин и стрептомицин, включают только в экспериментальные культуры, но не в культуры клеток, которые предстоит вводить субъекту. Целевые клетки поддерживают в условиях, необходимых для подержания роста, например, при соответствующей температуре (например, 37°C) и атмосфере (например, воздух плюс 5% CO2).

T-клетки, которые были стимулированы в течение разного времени, могут иметь различные характеристики. Например, типичная кровь или мононуклеарные клетки периферической крови, полученные при аферезе, содержат популяцию хелперных T-клеток (TH, CD4+), которая больше, чем популяция цитотоксических или супрессорных T-клеток (TC, CD8+). Ex vivo размножение T-клеток путем стимуляции рецепторов CD3 и CD28 приводит к популяции T-клеток, которая до примерно 8-9 дня состоит преимущественно из TH-клеток, при этом после примерно 8-9 дня популяция T-клеток содержит все большее и большее количество TC-клеток. Соответственно, в зависимости от цели лечения, инфузия субъекту популяции T-клеток, содержащей в основном TH-клетки, может иметь определенные преимущества. Аналогично, если была выделена подгруппа антигенспецифических TC-клеток, может быть выгодным размножение этой подгруппы в большей степени.

Далее, в дополнение к маркерам CD4 и CD8, другие фенотипические маркеры варьируются значительно, но, по большей части, воспроизводимо в течение процесса размножения клеток. Таким образом, такая воспроизводимость дает возможность точно подбирать активированные T-клетки для определенных целей.

После завершения конструирования CD19 CAR можно использовать различные анализы для оценки активности молекулы, такие как, но не ограничиваясь ими, способность T-клеток к размножению после стимуляции антигеном, поддержание размножения T-клеток в отсутствие повторной стимуляции и противораковая активность в соответствующих in vitro моделях и животных моделях. Анализы для оценки эффектов CD19 CAR описаны более подробно ниже.

Вестерн-блот анализ экспрессии CAR в первичных T-клетках можно использовать для обнаружения наличия мономеров и димеров. Смотри, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Очень кратко, T-клетки (1:1 смесь CD4+ и CD8+ T-клеток), экспрессирующие CAR, наращивают in vitro в течение более 10 дней, с последующим лизисом и электрофорезом в SDS-ПААГ в восстанавливающих условиях. CAR, содержащие полноразмерный TCR-ζ цитоплазматический домен и эндогенную TCR-ζ цепь, обнаруживают вестерн-блоттингом с использованием антитела к TCR-ζ цепи. Такие же наборы T-клеток используют для анализа методом электрофореза в SDS-ПААГ в не восстанавливающих условиях для оценки образования ковалентно связанного димера.

In vitro размножение CAR+ T-клеток после стимуляции антигеном можно количественно определять методом проточной цитометрии. Например, смесь CD4+ и CD8+ T-клеток стимулируют αCD3/αCD28 иАПК, с последующей трансдукцией лентивирусными векторами, экспрессирующими GFP под контролем промоторов, которые предстоит анализировать. Иллюстративные промоторы включают промоторы гена CMV IE, EF-1, убикитина C или фосфоглицерокиназы (PGK). Флуоресценцию GFP оценивают в день 6 культивирования в подгруппах CD4+ и/или CD8+ T-клеток методом проточной цитометрии. Смотри, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Альтернативно, смесь CD4+ и CD8+ T-клеток стимулируют покрытыми αCD3/αCD28 магнитными гранулами в день 0 и трансдуцируют CAR в день 1 при помощи бицистронного лентивирусного вектора, экспрессирующего CAR наряду с eGFP, с использованием последовательности пропуска рибосомы 2A. Культуры повторно стимулируют либо CD19+ K562 клетками (K562-CD19), клетками K562 дикого типа (K562 дикого типа), либо клетками K562, экспрессирующими hCD32 и 4-1BBL, в присутствии анти-CD3 и анти-CD28 антител (K562-BBL-3/28) после промывания. Экзогенный IL-2 добавляют к культурам через день в концентрации 100 МЕ/мл. GFP+ T-клетки подсчитывают методом проточной цитометрии, используя подсчет на основе гранул. Смотри, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009).

Также можно измерять устойчивое размножение CAR+ T-клеток в отсутствие повторной стимуляции. Смотри, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Вкратце, измеряют средний объем T-клеток (фл) в день 8 культивирования, используя счетчик частиц Coulter Multisizer III, после стимуляции покрытыми αCD3/αCD28 магнитными гранулами в день 0 и трансдукции указанным CAR в день 1.

Животные модели также можно использовать для измерения активности CART. Например, можно использовать модель ксенотрансплантата у иммунодефицитных мышей для лечения первичного пре-B-ALL человека с использованием человеческих CD19-специфических CAR+ T-клеток. Смотри, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Очень кратко, после развития ALL мышей произвольно распределяли по группам лечения. Различные количества сконструированных с αCD19-ζ и αCD19-ΒΒ-ζ T-клеток вводили совместной инъекцией в соотношении 1:1 мышам NOD-SCID-γ-/-, несущим B-ALL. Количество копий вектора αCD19-ζ и αCD19-ΒΒ-ζ в ДНК из селезенки мышей оценивали в различные моменты времени после инъекции T-клеток. Животных оценивали на признаки лейкоза с недельными интервалами. Измеряли количество CD19+ B-ALL бластных клеток в периферической крови у мышей, которым инъецировали αCD19-ζ CAR+ T-клетки или суррогатные трансдуцированные T-клетки. Кривые выживаемости для групп сравнивали, используя логарифмический ранговый критерий. Кроме того, также можно анализировать абсолютное количество CD4+ и CD8+ T-клеток в периферической крови через 4 недели после инъекции T-клеток мышам NOD-SCID-γ-/-. Мышам инъецировали лейкозные клетки и через 3 недели инъецировали T-клетки, сконструированные для экспрессии CAR, при помощи бицистронного лентивирусного вектора, кодирующего CAR, связанный с eGFP. T-клетки нормировали до 45-50% содержания вводимых GFP+ T-клеток, смешивая с суррогатными трансдуцированными клетками перед инъекцией, что подтверждали методом проточной цитометрии. Животных оценивали на признаки лейкоза с 1-недельными интервалами. Кривые выживаемости для групп, получающих CAR+ T-клетки, сравнивали, используя логарифмический ранговый критерий.

Можно оценивать зависящий от дозы ответ на лечение CAR. Смотри, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Например, периферическую кровь собирали через 35-70 дней после развития лейкоза у мышей, получавших в день 21 инъекцию CAR T-клеток, эквивалентного количества суррогатных трансдуцированных T-клеток, или не получавших T-клетки. У мышей из каждой группы рандомизированно брали кровь для определения количества CD19+ ALL бластных клеток в периферической крови и затем их умерщвляли в дни 35 и 49. Оставшихся животных оценивали в дни 57 и 70.

Методы оценки пролиферации клеток и продуцирования цитокинов описаны ранее, например, в Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Вкратце, оценку опосредованной CAR пролиферации проводили в микропланшетах для титрования путем смешивания промытых T-клеток с клетками K562, экспрессирующими CD19 (K19) или CD32 и CD137 (KT32-BBL), для конечного соотношения T-клетки: 562 клетки, равного 2:1. Клетки K562 перед использованием облучали гамма-излучением. Моноклональные анти-CD3 (клон OKT3) и анти-CD28 (клон 9,3) антитела добавляли в культуры с KT32-BBL клетками в качестве положительного контроля для стимуляции пролиферации T-клеток, поскольку эти сигналы поддерживают долгосрочное размножение CD8+ T-клеток ex vivo. T-клетки подсчитывали в культурах методом проточной цитометрии с использованием флуоресцентных гранул CountBright™ (Invitrogen, Carlsbad, CA) в соответствии с инструкциями изготовителя. CAR+ T-клетки идентифицировали по экспрессии GFP, используя T-клетки, сконструированные с помощью лентивирусных векторов, экспрессирующих связанный с eGFP-2A CAR. В случае CAR+ T-клеток, не экспрессирующих GFP, CAR+ T-клетки обнаруживали с помощью биотинилированного рекомбинантного белка CD19 и вторичного конъюгата авидин-PE. Также одновременно определяли экспрессию CD4+ и CD8+ на T-клетках с помощью специфических моноклональных антител (BD Biosciences). Количественное определение цитокинов проводили в супернатантах, собранных через 24 часа после повторной стимуляции, используя набор полистирольных гранул с моноклональными антителами против TH1/TH2 цитокинов человека (BD Biosciences, San Diego, CA), в соответствии с инструкциями изготовителя. Флуоресценцию оценивали с использованием проточного цитометра FACScalibur, и данные анализировали в соответствии с инструкциями изготовителя.

Цитотоксичность можно оценивать стандартным анализом высвобождения 51Cr. Смотри, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Вкратце, целевые клетки (линии K562 и первичные про-B-ALL клетки) нагружали 51Cr (в виде NaCrO4, New England Nuclear, Boston, MA) при температуре 37°C в течение 2 часов с частым помешиванием, дважды промывали полной средой RPMI и высевали в микропланшеты для титрования. Эффекторные T-клетки смешивали с целевыми клетками в лунках в полной среде RPMI при различных соотношениях эффекторные клетки: целевые клетки (E:T). Также готовили дополнительные лунки, содержащие только среду (спонтанное высвобождение, SR) или 1% раствор детергента тритон-X 100 (полное высвобождение, TR). Через 4 часа инкубации при температуре 37°C собирали супернатант из каждой лунки. Затем количественно определяли высвобожденный 51Cr с использованием счетчика гамма-частиц (Packard Instrument Co., Waltham, MA). Эксперимент для каждого из условий выполняли по меньшей мере в тройном повторе, и процент лизиса рассчитывали, используя формулу: % лизиса=(ER-SR)/(TR-SR), где ER соответствует среднему значению 51Cr, высвобожденного в случае каждого из экспериментальных условий.

Можно использовать технологии визуализации для оценки специфической направленной миграции и пролиферации CAR клеток у животных с модельными опухолями. Такие анализы описаны, например, в Barrett et al., Human Gene Therapy 22: 1575-1586 (2011). Вкратце, мышам NOD/SCID/γc-/- (NSG) вводили в/в инъекцией клетки Nalm-6, с последующим введением через 7 дней T-клеток спустя 4 часа после введения в них методом электропорации конструкций CAR. T-клетки были стабильно трансфицированы лентивирусной конструкцией для экспрессии люциферазы светляков, и была проведена визуализация мышей на биолюминесценцию. Альтернативно, терапевтическую эффективность и специфичность одной инъекции CAR+ T-клеток на модели ксенотрансплантата клеток Nalm-6 можно измерять следующим образом: мышам NSG вводили инъекцией клетки Nalm-6, трансдуцированные для стабильной экспрессии люциферазы светляков, с последующей, через 7 дней, однократной инъекцией в хвостовую вену T-клеток с введенным в них методом электропорации CD19 CAR. Проводили визуализацию животных в различные моменты времени после инъекции. Например, можно получать тепловые карты фотонной плотности лейкозных клеток, положительных по люциферазе светляков, в репрезентативных мышах в день 5 (за 2 до лечения) и день 8 (через 24 часа после введения CAR+ ЛПК).

Другие анализы, включая те, которые описаны в разделе «Примеры» в настоящем документе, а также те, которые известны в данной области, также можно использовать для оценки конструкции CD19 CAR по изобретению.

Терапевтическое применение

Ассоциированные с CD19 заболевания и/или нарушения

В одном аспекте изобретение относится к способам лечения заболевания, ассоциированного с экспрессией CD19. В одном аспекте изобретение относится к способам лечения заболевания, при котором часть опухоли является отрицательной в отношении CD19 и часть опухоли является положительной в отношении CD19. Например, CAR по изобретению является полезным для лечения субъектов, которые прошли лечение от заболевания, ассоциированного с повышенной экспрессией CD19, при этом субъект, который получил лечение от повышенных уровней CD19, имеет заболевание, ассоциированное с повышенными уровнями CD19.

В одном аспекте изобретение относится к вектору, содержащему CD19 CAR, функционально связанный с промотором для экспрессии в T-клетках млекопитающих. В одном аспекте изобретение относится к рекомбинантной T-клетке, экспрессирующей CD19 CAR, для применения в лечении экспрессирующих CD19 опухолей, при этом рекомбинантная T-клетка, экспрессирующая CD19 CAR, называется CD19 CART. В одном аспекте CD19 CART по изобретению способна контактировать с клеткой опухоли за счет по меньшей мере одного CD19 CAR по изобретению, экспрессированного на ее поверхности, так, что CART нацеливается на клетку опухоли и рост опухоли ингибируется.

В одном аспекте изобретение относится к способу ингибирования роста экспрессирующей CD19 клетки опухоли, включающему создание контакта клетки опухоли с CD19 CAR T-клеткой по настоящему изобретению так, что CART активируется в ответ на антиген и нацеливается на раковую клетку, при этом рост опухоли ингибируется.

В одном аспекте изобретение относится к способу лечения рака у субъекта. Способ включает введение субъекту CD19 CAR T-клетки по настоящему изобретению так, что происходит лечение рака у субъекта. Примером рака, который можно лечить CD19 CAR T-клеткой по изобретению, является рак, ассоциированный с экспрессией CD19. В одном аспекте рак, ассоциированный с экспрессией CD19, представляет собой рак крови. В одном аспекте рак крови представляет собой лейкоз или лимфому. В одном аспекте рак, ассоциированный с экспрессией CD19, включает формы рака и злокачественных новообразований, в том числе, но не ограничиваясь ими, например, одну или более форм острого лейкоза, включая, но не ограничиваясь ими, например, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одну или более форм хронического лейкоза, включая, но не ограничиваясь ими, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL). Другие формы рака крови или патологические состояния крови, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и тому подобное. Кроме того, заболевания, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, ассоциированные с экспрессией CD19.

В некоторых вариантах осуществления рак, который можно лечить при помощи CD19 CAR, например, описанного в настоящем документе, представляет собой множественную миелому. Множественная миелома является раком крови, характеризующимся накоплением клона плазматических клеток в костном мозге. Современные методы лечения для множественной миеломы включают, но не ограничиваются ими, лечение леналидомидом, который представляет собой аналог талидомида. Леналидомид имеет активности, которые включают противоопухолевую активность, ингибирование ангиогенеза и иммуномодуляцию. Как правило, считается, что клетки миеломы отрицательны в отношении экспрессии CD19, согласно данным проточной цитометрии. Настоящее изобретение также включает доказательство того, что небольшой процент опухолевых клеток миеломы экспрессирует CD19, что продемонстрировано в примере 6. Таким образом, в некоторых вариантах осуществления C19 CAR, например, описанный в настоящем документе, можно использовать для нацеливания на клетки миеломы. В некоторых вариантах осуществления лечение при помощи CD19 CAR можно использовать в сочетании с одним или несколькими видами дополнительного лечения, например, лечения леналидомидом.

Изобретение включает вид клеточной терапии, при котором T-клетки генетически модифицированы для экспрессии химерного антигенного рецептора (CAR), и CAR T-клетку вводят инфузией реципиенту, который нуждается в этом. Введенная инфузией клетка способна уничтожать клетки опухоли у реципиента. В отличие от лечения антителами, CAR-модифицированные T-клетки способны реплицироваться in vivo, результатом чего является долгосрочная персистенция, что может приводить к устойчивому контролю опухоли. В различных аспектах T-клетки, введенные пациенту, или их потомки, сохраняются в организме пациента в течение по меньшей мере четырех месяцев, пяти месяцев, шести месяцев, семи месяцев, восьми месяцев, девяти месяцев, десяти месяцев, одиннадцати месяцев, двенадцати месяцев, тринадцати месяцев, четырнадцати месяцев, пятнадцати месяцев, шестнадцати месяцев, семнадцати месяцев, восемнадцати месяцев, девятнадцати месяцев, двадцати месяцев, двадцати одного месяца, двадцати двух месяцев, двадцати трех месяцев, двух лет, трех лет, четырех лет или пяти лет после введения Т-клетки пациенту.

Изобретение также включает вид клеточной терапии, при котором T-клетки модифицированы, например, in vitro транскрибированной РНК для временной экспрессии химерного антигенного рецептора (CAR), и CAR T-клетку вводят инфузией реципиенту, который нуждается в этом. Введенная инфузией клетка способна уничтожать клетки опухоли у реципиента. Таким образом, в различных аспектах T-клетки, введенные пациенту, присутствуют в течение менее чем одного месяца, например, три недели, две недели, одну неделю, после введения T-клетки пациенту.

Без привязки к какой-либо конкретной теории, противоопухолевый иммунный ответ, вызванный CAR-модифицированными T-клетками, может быть активным или пассивным иммунным ответом, или альтернативно, может быть связан с прямым, а не с непрямым иммунным ответом. В одном аспекте трансдуцированные CAR T-клетки демонстрируют специфическую секрецию провоспалительных цитокинов и сильную цитолитическую активность в ответ на человеческие раковые клетки, экспрессирующие CD19, устойчивы к ингибированию растворимым CD19, опосредуют неспецифический цитолиз и опосредуют регрессию сформировавшейся опухоли человека. Например, лишенные антигена клетки опухолей в гетерогенной зоне экспрессирующей CD19 опухоли могут быть восприимчивы к непрямому уничтожению CD19-перенаправленными T-клетками, которые ранее реагировали на соседние антиген-положительные раковые клетки.

В одном аспекте полностью человеческие CAR-модифицироанные T-клетки по изобретению могут быть одним из видов вакцины для ex vivo иммунизации и/или in vivo терапии млекопитающего. В одном аспекте млекопитающее является человеком.

Что касается ex vivo иммунизации, по меньшей мере одно из следующих событий происходит in vitro перед введением клетки млекопитающему: i) размножение клеток, ii) введение нуклеиновой кислоты, кодирующей CAR, в клетки или iii) криоконсервация клеток.

Ex vivo процедуры хорошо известны в данной области и более подробно обсуждаются ниже. Вкратце, клетки получают от млекопитающего (например, человека) и генетически модифицируют (то есть, трансдуцируют или трансфицируют in vitro) вектором, экспрессирующим CAR, раскрытым в настоящем документе. CAR-модифицированную клетку можно вводить млекопитающему-реципиенту для достижения терапевтического эффекта. Млекопитающим-реципиентом может быть человек, и CAR-модифицированная клетка может быть аутологичной для реципиента. Альтернативно, клетки могут быть аллогенными, сингенными или ксеногенными для реципиента.

Метод ex vivo наращивания гемопоэтических стволовых клеток и клеток-предшественников, описанный в патенте США № 5199942, содержание которого включено в настоящий документ посредством ссылки, можно применять к клеткам по настоящему изобретению. Другие подходящие методы известны в данной области, вследствие этого, настоящее изобретение не ограничено каким-либо конкретным методом ex vivo наращивания клеток. Вкратце, ex vivo культивирование и наращивание T-клеток включает: (1) получение CD34+ гемопоэтических стволовых клеток и клеток-предшественников от млекопитающего из собранной периферической крови или эксплантатов костного мозга и (2) наращивание таких клеток ex vivo. В дополнение к клеточным факторам роста, описанным в патенте США № 5199942, и другие факторы, такие как flt3-L, IL-1, IL-3 и c-kit лиганд, можно использовать для культивирования и наращивания клеток.

Помимо использования вакцины на основе клеток в условиях ex vivo иммунизации, настоящее изобретение также относится к композициям и способам для in vivo иммунизации с целью вызывания иммунного ответа, направленного против антигена, у пациента.

Как правило, клетки, активированные и размноженные, как описано в настоящем документе, можно использовать для лечения и предотвращения заболеваний, которые возникают у индивидуумов с иммунной недостаточностью. В частности, CAR-модифицированные T-клетки по изобретению используют для лечения заболеваний, нарушений и состояний, ассоциированных с экспрессией CD19. В некоторых аспектах клетки по изобретению используют для лечения пациентов, имеющих риск развития заболеваний, нарушений и состояний, ассоциированных с экспрессией CD19. Таким образом, настоящее изобретение относится к способам лечения или предотвращения заболеваний, нарушений и состояний, ассоциированных с экспрессией CD19, включающим введение субъекту, который нуждается в этом, терапевтически эффективного количества CAR-модифицированных T-клеток по изобретению.

В одном аспекте CART-клетки по изобретению можно использовать для лечения пролиферативного заболевания, такого как рак или злокачественное новообразование, или предракового состояния, такого как миелодисплазия, миелодиспластический синдром или предлейкоз. В одном аспекте рак представляет собой рак крови. В одном аспекте рак крови представляет собой лейкоз или лимфому. В одном аспекте CART-клетки по изобретению можно использовать для лечения различных форм рака и злокачественных новообразований, таких как, но не ограничиваясь ими, например, острые лейкозы, включая, но не ограничиваясь ими, например, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одну или более форм хронического лейкоза, включая, но не ограничиваясь ими, например, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL); другие формы рака крови или патологические состояния крови, включая, но не ограничиваясь ими, например, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и тому подобное. Кроме того, заболевания, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, ассоциированные с экспрессией CD19. Не относящиеся к раку состояния, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, аутоиммунные заболевания (например, волчанку), воспалительные нарушения (аллергию и астму) и трансплантацию.

CAR-модифицированные T-клетки по настоящему изобретению можно вводить либо отдельно, либо в виде фармацевтической композиции в сочетании с разбавителями и/или другими компонентами, такими как IL-2 или другие цитокины или популяции клеток.

Рак крови

Раковые заболевания крови представляют собой такие формы рака, как лейкоз и злокачественные лимфопролиферативные состояния, которые поражают кровь, костный мозг и лимфатическую систему.

Лейкоз можно подразделять на острый лейкоз и хронический лейкоз. Острый лейкоз, в свою очередь, можно подразделять на острый миелогенный лейкоз (AML) и острый лимфобластный лейкоз (ALL). Хронический лейкоз включает хронический миелогенный лейкоз (CML) и хронический лимфоцитарный лейкоз (CLL). Другие родственные состояния включают миелодиспластические синдромы (MDS, ранее известные как «предлейкоз»), представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови и риск перехода в AML.

Настоящее изобретение относится к композициям и способам для лечения рака. В одном аспекте рак представляет собой рак крови, включая, но не ограничиваясь ими, лейкоз или лимфому. В одном аспекте CART-клетки по изобретению можно использовать для лечения разных форм рака и злокачественных новообразований, таких как, но не ограничиваясь ими, например, острые лейкозы в том числе, но не ограничиваясь ими, например, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одну или более форм хронического лейкоза, включая, но не ограничиваясь ими, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL); другие формы рака крови или патологические состояния крови, включая, но не ограничиваясь ими, например, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и тому подобное. Кроме того, заболевания, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, ассоциированные с экспрессией CD19.

Настоящее изобретение также относится к способам ингибирования пролиферации или уменьшения популяции CD19-экспрессирующих клеток, включающим создание контакта популяции клеток, содержащей CD19-экспрессирующую клетку, с анти-CD19 CART-клеткой по изобретению, которая связывается с CD19-экспрессирующей клеткой. В конкретном аспекте настоящее изобретение относится к способам ингибирования пролиферации или уменьшения популяции CD19-экспресирующих раковых клеток, включающим создание контакта популяции CD19-экспресирующих раковых клеток с анти-CD19 CART-клеткой по изобретению, которая связывается с CD19-экспрессирующей клеткой. В одном аспекте настоящее изобретение относится к способам ингибирования пролиферации или уменьшения популяции CD19-экспресирующих раковых клеток, включающим создание контакта популяции CD19-экспресирующих раковых клеток с анти-CD19 CART-клеткой по изобретению, которая связывается с CD19-экспрессирующей клеткой. В некоторых аспектах анти-CD19 CART-клетка по изобретению уменьшает количество, численность, объем или процент клеток и/или раковых клеток на по меньшей мере 25%, по меньшей мере 30%, по меньшей мере 40%, по меньшей мере 50%, по меньшей мере 65%, по меньшей мере 75%, по меньшей мере 85%, по меньшей мере 95% или по меньшей мере 99% у субъекта, страдающего, или у животного с модельным, миелоидным лейкозом или другой формой рака, ассоциированного с экспрессирующими CD19 клетками, по сравнению с отрицательным контролем. В одном аспекте субъект является человеком.

Настоящее изобретение также относится к способам предотвращения, лечения и/или контроля заболевания, ассоциированного с CD19-экспрессирующими клетками (например, рака крови или атипичного рака, ассоциированного с экспрессией CD19), включающим введение субъекту, который нуждается в этом, анти-CD19 CART-клетки по изобретению, которая связывается с CD19-экспрессирующей клеткой. В одном аспекте субъект является человеком. Неограничивающие примеры заболеваний, ассоциированных с CD19-экспрессирующими клетками, включают аутоиммунные заболевания (такие как волчанка), воспалительные заболевания (такие как аллергия и астма) и рак (такой как разные формы рака крови или атипичные формы рака, ассоциированного с экспрессией CD19).

Настоящее изобретение также относится к способам предотвращения, лечения и/или контроля заболевания, ассоциированного с CD19-экспрессирующими клетками, включающим введение субъекту, который нуждается в этом, анти-CD19 CART-клетки по изобретению, которая связывается с CD19-экспрессирующей клеткой. В одном аспекте субъект является человеком.

Настоящее изобретение относится к способам предотвращения рецидива рака, ассоциированного с CD19-экспрессирующими клетками, включающим введение субъекту, который нуждается в этом, анти-CD19 CART-клетки по изобретению, которая связывается с CD19-экспрессирующей клеткой. В одном аспекте способы включают введение субъекту, который нуждается в этом, эффективного количества анти-CD19 CART-клетки, описанной в настоящем документе, которая связывается с CD19-экспрессирующей клеткой, в сочетании с эффективным количеством другого терапевтического средства.

Комбинированные методы лечения

CAR-экспрессирующую клетку, описанную в настоящем документе, можно использовать в сочетании с другими известными средствами и методами лечения. Используемый в настоящем документе термин «в сочетании» означает, что субъект получает два (или более) различных терапевтических средства в то время, когда субъект страдает заболеванием, например, два или более терапевтических средства вводят после того, как у субъекта было диагностировано заболевание, и до того, как заболевание было излечено или устранено, или лечение было прекращено по другим причинам. В некоторых вариантах осуществления введение одного терапевтического средства все еще продолжается, когда начинается введение другого, так что их введение перекрывается. В настоящем документе это иногда называется «одновременным» или «совместным введением». В других вариантах осуществления введение одного терапевтического средства прекращается прежде, чем начинается введение другого терапевтического средства. В некоторых вариантах осуществления любого из случаев, лечение является более эффективным благодаря комбинированному введению. Например, второе терапевтическое средство является более эффективным, например, эквивалентный эффект наблюдается при использовании меньшего количества, или второе терапевтическое средство уменьшает симптомы в большей степени, чем было бы в случае, если бы второе терапевтическое средство вводили в отсутствие первого терапевтического средства, или аналогичная ситуация имеет место для первого терапевтического средства. В некоторых вариантах осуществления введение приводит к тому, что уменьшение симптома или другого параметра, связанного с заболеванием, происходит в большей степени, чем было бы в случае, когда одно лекарственное средство вводят в отсутствие другого. Эффект двух лекарственных средств может быть частично аддитивным, полностью аддитивным, или более чем аддитивным. Введение может приводить к тому, что эффект первого вводимого лекарственного средства все еще ощутим, когда вводят второе средство.

CAR-экспрессирующую клетку, описанную в настоящем документе, и по меньшей мере одно дополнительное терапевтическое средство можно вводить одновременно, в одной и той же или отдельных композициях, либо последовательно. В случае последовательного введения CAR-экспрессирующую клетку, описанную в настоящем документе, можно вводить в первую очередь, а дополнительное средство можно вводить во вторую очередь, или порядок введения может быть обратным.

В других аспектах CAR-экспрессирующую клетку, описанную в настоящем документе, можно использовать в схеме лечения в сочетании с хирургической операцией, химиотерапией, облучением, иммунодепрессантами, такими как циклоспорин, азатиоприн, метотрексат, микофенолят и FK506, антителами или другими иммуноаблативными средствами, такими как кампат, анти-CD3 антитела или другие терапевтические антитела, цитоксан, флударабин, циклоспорин, FK506, рапамицин, микофеноловая кислота, стероиды, FR901228, цитокины и облучение, пептидная вакцина, например, описанная в статье Izumoto et al. 2008 J Neurosurg 108: 963-971.

В одном варианте осуществления CAR-экспрессирующую клетку, описанную в настоящем документе, можно использовать в сочетании с химиотерапевтическим средством. Иллюстративные химиотерапевтические средства включают антрациклин (например, доксорубицин (например, липосомный доксорубицин)), алкалоид барвинка (например, винбластин, винкристин, виндезин, винорелбин), алкилирующее средство (например, циклофосфамид, декарбазин, мелфалан, ифосфамид, темозололмид), антитело иммунной клетки (например, алемтузумаб, гемтузумаб, ритуксимаб, тозитумомаб), антиметаболит (в том числе, например, антагонисты фолиевой кислоты, аналоги пиримидинов, аналоги пуринов и ингибиторы аденозиндезаминазы (например, флударабин)), ингибитор mTOR, агонист индуцируемого глюкокортикоидами белка TNFR (GITR), протеасомный ингибитор (например, аклациномицин A, глиотоксин или бортезомиб), иммуномодулятор, такой как талидомид или производное талидомида (например, леналидомид).

Основные химиотерапевтические средства, рассматриваемые для использования в комбинированной терапии, включают анастрозол (Arimidex®), бикалутамид (Casodex®), блеомицина сульфат (Blenoxane®), бусульфан (Myleran®), инъекции бусульфана (Busulfex®), капецитабин (Xeloda®), N4-пентоксикарбонил-5-дезокси-5-фторцитидин, карбоплатин (Paraplatin®), кармустин (BiCNU®), хлорамбуцил (Leukeran®), цисплатин (Platinol®), кладрибин (Leustatin®), циклофосфамид (Cytoxan® или Neosar®), цитарабин, цитозина арабинозид (Cytosar-U®), инъекции липосом с цитарабином (DepoCyt®), дакарбазин (DTIC-Dome®), дактиномицин (Actinomycin D, Cosmegan), даунорубицина гидрохлорид (Cerubidine®), инъекции липосом с даунорубицина цитратом (DaunoXome®), дексаметазон, доцетаксел (Taxotere®), доксорубицина гидрохлорид (Adriamycin®, Rubex®), этопозид (Vepesid®), флударабина фосфат (Fludara®), 5-фторурацил (Adrucil®, Efudex®), флутамид (Eulexin®), тезацитабин, гемцитабин (дифтордезоксицитидин), гидроксимочевину (Hydrea®), идарубицин (Idamycin®), ифосфамид (IFEX®), иринотекан (Camptosar®), L-аспарагиназу (ELSPAR®), лейковорин кальция, мелфалан (Alkeran®), 6-меркаптопурин (Purinethol®), метотрексат (Folex®), митоксантрон (Novantrone®), милотарг, паклитаксел (Taxol®), феникс (Yttrium90/MX-DTPA), пентостатин, имплантат полифепрозана 20 с кармустином (Gliadel®), тамоксифена цитрат (Nolvadex®), тенипозид (Vumon®), 6-тиогуанин, тиотепу, тирапазамин (Tirazone®), топотекана гидрохлорид для инъекций (Hycamptin®), винбластин (Velban®), винкристин (Oncovin®) и винорелбин (Navelbine®).

Иллюстративные алкилирующие средства включают, но не ограничиваются ими, азотистые иприты, производные этиленимина, алкилсульфонаты, нитрозомочевины и триазены: урамустин (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desmethyldopan®, Haemanthamine®, Nordopan®, Uracil nitrogen mustard®, Uracillost®, Uracilmostaza®, Uramustin®, Uramustine®), хлорметин (Mustargen®), циклофосфамид (Cytoxan®, Neosar®, Clafen®, Endoxan®, Procytox®, Revimmune™), ифосфамид (Mitoxana®), мелфалан (Alkeran®), хлорамбуцил (Leukeran®), пипоброман (Amedel®, Vercyte®), триэтиленмеламин (Hemel®, Hexalen®, Hexastat®), триэтилентиофосфорамин, темозоломид (Temodar®), тиотепу (Thioplex®), бусульфан (Busilvex®, Myleran®), кармустин (BiCNU®), ломустин (CeeNU®), стрептозоцин (Zanosar®) и дакарбазин (DTIC-Dome®). Дополнительные иллюстративные алкилирующие средства включают, но не ограничиваются ими, оксалиплатин (Eloxatin®), темозоломид (Temodar® и Temodal®), дактиномицин (также известный как актиномицин-D, Cosmegen®), мелфалан (также известный как L-PAM, L-сарколизин и фенилаланиновый иприт, Alkeran®), алтретамин (также известный как гексаметилмеламин (HMM), Hexalen®), кармустин (BiCNU®), бендамустин (Treanda®), бусульфан (Busulfex® и Myleran®), карбоплатин (Paraplatin®), ломустин (также известный как CCNU, CeeNU®), цисплатин (также известный как CDDP, Platinol® и Platinol®-AQ), хлорамбуцил (Leukeran®), циклофосфамид (Cytoxan® и Neosar®), дакарбазин (также известный как DTIC, DIC и имидазола карбоксамид, DTIC-Dome®), алтретамин (также известный как гексаметилмеламин (HMM), Hexalen®), ифосфамид (Ifex®); преднимустин, прокарбазин (Matulane®), мехлорэтамин (также известный как азотистый иприт, мустин и мехлорэтамина гидрохлорид, Mustargen®), стрептозоцин (Zanosar®), тиотепу (также известный как тиофосфоамид, TESPA и TSPA, Thioplex®), циклофосфамид (Endoxan®, Cytoxan®, Neosar®, Procytox®, Revimmune®) и бендамустин HCl (Treanda®).

Иллюстративные ингибиторы mTOR включают, например, темсиролимус, ридафоролимус (ранее известный как деферолимус, (1R,2R,4S)-4-[(2R)-2[(1R,9S,12S,15R,16E,18R,19R,21R,23S,24E,26E,28Z,30S,32S,35R)-1,18-дигидрокси-19,30-диметокси-15,17,21,23,29,35-гексаметил-2,3,10,14,20-пентаоксо-11,36-диокса-4-азатрицикло[30.3.1.04,9]гексатриаконта-16,24,26,28-тетраен-12-ил]пропил]-2-метоксициклогексилдиметилфосфинат, также известный как AP23573 и MK8669, и описанный в PCT публикации № WO 03/064383), эверолимус (Afinitor® или RAD001), рапамицин (AY22989, Sirolimus®), семапимод (CAS 164301-51-3), эмсиролимус, (5-{2,4-бис[(3S,)-3-метилморфолин-4-ил]пиридо[2,3-d]пиримидин-7-ил}-2-метоксифенил)метанол (AZD8055), 2-амино-8-[транс-4-(2-гидроксиэтокси)циклогексил]-6-(6-метокси-3-пиридинил)-4-метил-пиридо[2,3-d]пиримидин-7(8H)-он (PF04691502, CAS 1013101-36-4) и N2-[1,4-диоксо-4-[[4-(4-оксо-8-фенил-4H-1-бензопиран-2-ил)морфолиний-4-ил]метокси]бутил]-L-аргинилглицил-L-α-аспартил-L-серин-, внутренняя соль (SF1126, CAS 936487-67-1) и XL765.

Иллюстративные иммуномодуляторы включают, например, афутузумаб (производства Roche®), пегфилграстим (Neulasta®), леналидомид (CC-5013, Revlimid®), талидомид (Thalomid®), актимид (CC4047) и IRX-2 (смесь человеческих цитокинов, содержащая интерлейкин 1, интерлейкин 2 и интерферон γ, CAS 951209-71-5, производства IRX Therapeutics).

Иллюстративные антрациклины включают, например, доксорубицин (Adriamycin® и Rubex®), блеомицин (Lenoxane®), даунорубицин (даунорубицина гидрохлорид, дауномицин и рубидомицина гидрохлорид, Cerubidine®), липосомный даунорубицин (липосомы с даунорубицина цитратом, DaunoXome®), митоксантрон (DHAD, Novantrone®), эпирубицин (Ellence™), идарубицин (Idamycin®, Idamycin PFS®), митомицин C (Mutamycin®), гелданамицин, гербимицин, равидомицин и дезацетилравидомицин.

Иллюстративные алкалоиды барвинка включают, например, винорелбина тартрат (Navelbine®), винкристин (Oncovin®) и виндезин (Eldisine®)), винбластин (также известный как винбластина сульфат, винкалейкобластин и VLB, Alkaban-AQ® и Velban®) и винорелбин (Navelbine®).

Иллюстративные протеасомные ингибиторы включают бортезомиб (Velcade®), карфилзомиб (PX-171-007, (S)-4-метил-N-((S)-1-(((S)-4-метил-1-((R)-2-метилоксиран-2-ил)-1-оксопентан-2-ил)амино)-1-оксо-3-фенилпропан-2-ил)-2-((S)-2-(2-морфолиноацетамидо)-4-фенилбутанамидо)пентанамид), маризомиб (NPI-0052), иксазомиба цитрат (MLN-9708), деланзомиб (CEP-18770) и O-метил-N-[(2-метил-5-тиазолил)карбонил]-L-серил-O-метил-N-[(1S)-2-[(2R)-2-метил-2-оксиранил]-2-оксо-1-(фенилметил)этил]-L-серинамид (ONX-0912).

Иллюстративные агонисты GITR включают, например, слитые белки GITR и анти-GITR антитела (например, двухвалентные анти-GITR антитела), такие как, например, слитый белок GITR, описанный в патенте США № 6111090, Европейском патенте № 090505B1, патенте США № 8586023, PCT публикациях №№ WO 2010/003118 и 2011/090754, или анти-GITR антитело, описанное, например, в патенте США № 7025962, Европейском патенте № 1947183B1, патенте США № 7812135, патенте США № 8388967, патенте США № 8591886, Европейском патенте № EP 1866339, PCT публикации № WO 2011/028683, PCT публикации № WO 2013/039954, PCT публикации № WO 2005/007190, PCT публикации № WO 2007/133822, PCT публикации № WO 2005/055808, PCT публикации № WO 99/40196, PCT публикации № WO 2001/03720, PCT публикации № WO 99/20758, PCT публикации № WO 2006/083289, PCT публикации № WO 2005/115451, патенте США № 7618632 и PCT публикации № WO 2011/051726.

В одном варианте осуществления CAR-экспрессирующую клетку, описанную в настоящем документе, вводят субъекту в сочетании с ингибитором mTOR, например, ингибитором mTOR, описанным в настоящем документе, например, рапалогом, таким как эверолимус. В одном варианте осуществления ингибитор mTOR вводят до введения CAR-экспрессирующей клетки. Например, в одном варианте осуществления ингибитор mTOR можно вводить до афереза клеток. В одном варианте осуществления субъект имеет CLL.

В одном варианте осуществления CAR-экспрессирующую клетку, описанную в настоящем документе, вводят субъекту в сочетании с агонистом GITR, например, агонистом GITR, описанным в настоящем документе. В одном варианте осуществления агонист GITR вводят до введения CAR-экспрессирующей клетки. Например, в одном варианте осуществления агонист GITR можно вводить до афереза клеток. В одном варианте осуществления субъект имеет CLL.

Можно также использовать лекарственные средства, которые ингибируют либо кальций-зависимую фосфатазу кальцинейрин (циклоспорин и FK506), либо ингибируют киназу p70S6, которая важна для индуцируемой фактором роста сигнализации (рапамицин). (Liu et al., Cell 66: 807-815, 1991; Henderson et al., Immun. 73: 316-321, 1991; Bierer et al., Curr. Opin. Immun. 5: 763-773, 1993). В следующем аспекте клеточные композиции по настоящему изобретению можно вводить пациенту в сочетании с (например, до, одновременно или после) трансплантацией костного мозга, T-клеточной аблативной терапией с использованием химиотерапевтических средств, таких как флударабин, наружной дистанционной лучевой терапией (XRT), циклофосфамидом и/или антителами, такими как OKT3 или кампат. В одном аспекте клеточные композиции по настоящему изобретению вводят после B-клеточной аблативной терапии, например, при помощи средств, которые реагируют с CD20, например, ритуксана. Например, в одном варианте осуществления субъекты могут получать стандартное лечение высокой дозой химиотерапевтического средства, с последующей трансплантацией стволовых клеток периферической крови. В конкретных вариантах осуществления после трансплантации субъекты получают инфузию размноженных иммунных клеток по настоящему изобретению. В дополнительном варианте осуществления размноженные клетки вводят до или после хирургической операции.

В одном варианте осуществления субъекту можно вводить средство, которое уменьшает или ослабляет побочный эффект, связанный с введением CAR-экспрессирующей клетки. Побочные эффекты, связанные с введением CAR-экспрессирующей клетки, включают, но не ограничиваются ими, CRS и гемофагоцитарный лимфогистиоцитоз (HLH), также называемый синдромом активации макрофагов (MAS). Симптомы CRS включают высокую температуру, тошноту, преходящую гипотензию, гипоксию и тому подобное. Соответственно, способы, описанные в настоящем документе, могут включать введение CAR-экспрессирующей клетки, описанной в настоящем документе, субъекту и дополнительное введение средства для контроля повышенных уровней растворимого фактора, возникающих в результате лечения CAR-экспрессирующей клеткой. В одном варианте осуществления растворимый фактор, уровень которого повышен у субъекта, представляет собой один или более из IFN-γ, TNFα, IL-2 и IL-6. Таким образом, средство, вводимое для лечения этого побочного эффекта, может представлять собой средство, которое нейтрализует один или более из этих растворимых факторов. Такие средства включают, но не ограничиваются ими, стероид, ингибитор TNFα и ингибитор IL-6. Примером ингибитора TNFα является этанерцепт. Примером ингибитора IL-6 является тоцилизумаб (toc).

В одном варианте осуществления субъекту можно вводить средство, повышающее активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления средство может представлять собой агент, который ингибирует ингибирующую молекулу. Ингибирующие молекулы, например, белок программируемой клеточной гибели 1 (PD1), могут в некоторых вариантах осуществления уменьшать способность CAR-экспрессирующей клетки осуществлять иммунный эффекторный ответ. Примеры ингибирующих молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR бета. Ингибирование ингибирующей молекулы, например, ингибирование на уровне ДНК, РНК или белка, может оптимизировать эффективность CAR-экспрессирующей клетки. В некоторых вариантах осуществления ингибирующую нуклеиновую кислоту, например, ингибирующую нуклеиновую кислоту, например, дсРНК, например, киРНК или кшРНК, можно использовать для ингибирования экспрессии ингибирующей молекулы в CAR-экспрессирующей клетке. В одном из вариантов осуществления ингибитор представляет собой кшРНК. В одном из вариантов осуществления ингибирующая молекула ингибируется в CAR-экспрессирующей клетке. В этих вариантах осуществления молекула дсРНК, которая ингибирует экспрессию ингибирующей молекулы, связана с нуклеиновой кислотой, кодирующей компонент, например, все компоненты, CAR. В одном варианте осуществления ингибитор ингибирующего сигнала может представлять собой, например, антитело или фрагмент антитела, связывающий ингибирующую молекулу. Например, агент может представлять собой антитело или фрагмент антитела, который связывается с PD1, PD-L1, PD-L2 или CTLA4 (например, ипилимумаб (также называемый MDX-010 и MDX-101, и продающийся под названием Yervoy®, Bristol-Myers Squibb), тремелимумаб (IgG2 моноклональное антитело, производимое компанией Pfizer, ранее известный как тицилимумаб, CP-675,206)). В одном из вариантов осуществления агент представляет собой антитело или фрагмент антитела, который связывается с TIM3. В одном из вариантов осуществления агент представляет собой антитело или фрагмент антитела, который связывается с LAG3.

PD1 представляет собой ингибирующий член семейства рецепторов CD28, которое также включает CD28, CTLA-4, ICOS и BTLA. PD-1 экспрессируется на активированных B-клетках, T-клетках и миелоидных клетках (Agata et al. 1996 Int. Immunol 8: 765-75). Показано, что два лиганда для PD1, PD-L1 и PD-L2 подавляют активацию T-клеток при связывании с PD1 (Freeman et al. 2000 J Exp Med 192: 1027-34, Latchman et al. 2001 Nat Immunol 2: 261-8, Carter et al. 2002 Eur J Immunol 32: 634-43). PD-L1 присутствует в больших количествах в злокачественных опухолях человека (Dong et al. 2003 J Mol Med 81: 281-7, Blank et al. 2005 Cancer Immunol. Immunother 54: 307-314, Konishi et al. 2004 Clin Cancer Res 10: 5094). Иммунная супрессия может быть отменена путем ингибирования локального взаимодействия PD1 с PD-L1. Антитела, фрагменты антител и другие ингибиторы PD1, PD-L1 и PD-L2 доступны в данной области и могут быть использованы в сочетании с CD19 CAR, описанным в настоящем документе. Например, ниволумаб (также известный как BMS-936558 или MDX1106; Bristol-Myers Squibb) представляет собой полностью человеческое IgG4 моноклональное антитело, которое специфически блокирует PD1. Ниволумаб (клон 5C4) и другие человеческие моноклональные антитела, которые специфически связываются с PD1, описаны в US 8008449 и WO 2006/121168. Пидилизумаб (CT-011; Cure Tech) представляет собой гуманизированное IgG1k моноклональное антитело, которое связывается с PD1. Пидилизумаб и другие гуманизированные анти-PD1 моноклональные антитела описаны в WO 2009/101611. Ламбролизумаб (также называемый MK03475; Merck) представляет собой гуманизированное IgG4 моноклональное антитело, которое связывается с PD1. Ламбролизумаб и другие гуманизированные анти-PD1 антитела описаны в US 8354509 и WO 2009/114335. MDPL3280A (Genentech/Roche) представляет собой человеческое Fc-оптимизированное IgG1 моноклональное антитело, которое связывается с PD-L1. MDPL3280A и другие человеческие моноклональные антитела к PD-L1 описаны в патенте США № 7943743 и патентной публикации США № 20120039906. Другие анти-PD-L1 связывающие агенты включают YW243.55.S70 (вариабельные области тяжелой и легкой цепи приведены в SEQ ID NOs 20 и 21 в WO 2010/077634) и MDX-1105 (также называемый BMS-936559, и, например, анти-PD-L1 связывающие агенты, описанные в WO 2007/005874). AMP-224 (B7-DCIg; Amplimmune; например, описанный в WO 2010/027827 и WO 2011/066342), представляет собой PD-L2 Fc слитый растворимый рецептор, который блокирует взаимодействие между PD1 и B7-H1. Другие анти-PD1 антитела включают AMP 514 (Amplimmune), среди прочих, например, анти-PD1 антитела, описанные в US 8609089, US 2010028330 и/или US 20120114649.

В некоторых вариантах осуществления средство, повышающее активность CAR-экспрессирующей клетки, может представлять собой, например, слитый белок, содержащий первый домен и второй домен, при этом первый домен представляет собой ингибирующую молекулу или ее фрагмент, а второй домен представляет собой полипептид, ассоциированный с положительным сигналом, например, полипептид, содержащий внутриклеточный сигнальный домен, описанный в настоящем документе. В некоторых вариантах осуществления полипептид, ассоциированный с положительным сигналом, может включать костимулирующий домен CD28, CD27, ICOS, например, внутриклеточный сигнальный домен CD28, CD27 и/или ICOS, и/или основной сигнальный домен, например, CD3-дзета, например, описанные в настоящем документе. В одном варианте осуществления слитый белок экспрессируется той же клеткой, которая экспрессирует CAR. В другом варианте осуществления слитый белок экспрессируется клеткой, например, T-клеткой, которая не экспрессирует анти-CD19 CAR.

В одном варианте осуществления средство, повышающее активность CAR-экспрессирующей клетки, описанной в настоящем документе, представляет собой miR-17-92.

Фармацевтические композиции и методы лечения

Фармацевтические композиции по настоящему изобретению могут содержать CAR-экспрессирующую клетку, например, множество CAR-экспрессирующих клеток, описанных в настоящем документе, в сочетании с одним или более фармацевтически или физиологически приемлемыми носителями, разбавителями или эксципиентами. Такие композиции могут содержать буферы, такие как нейтральный забуференный солевой раствор, фосфатно-солевой буфер и тому подобное, углеводы, такие как глюкоза, манноза, сахароза или декстраны, маннит, белки, полипептиды или аминокислоты, такие как глицин, антиоксиданты, хелаторы, такие как ЭДТА или глутатион, адъюванты (например, гидроксид алюминия) и консерванты. Композиции по настоящему изобретению в одном из аспектов сформулированы для внутривенного введения.

Фармацевтические композиции по настоящему изобретению можно вводить способом, соответствующим заболеванию, которое лечат (или предотвращают). Количество и частота введения будет определяться такими факторами, как состояние пациента, а также тип и степень тяжести заболевания пациента, хотя соответствующие дозировки могут быть определены в клинических испытаниях.

В одном варианте осуществления фармацевтическая композиция практически не содержит, например, отсутствуют поддающиеся обнаружению уровни, примеси, например, выбранной из группы, состоящей из эндотоксина, микоплазмы, способного к репликации лентивируса (RCL), p24, нуклеиновой кислоты VSV-G, HIV gag, остаточных покрытых анти-CD3/анти-CD28 гранул, мышиных антител, объединенной человеческой сыворотки, бычьего сывороточного альбумина, бычьей сыворотки, компонентов культуральной среды, клеток-упаковщиков вектора или компонентов плазмиды, бактерий и грибков. В одном варианте осуществления бактерия является по меньшей мере бактерией, выбранной из группы, состоящей из Alcaligenes faecalis, Candida albicans, Escherichia coli, Haemophilus influenza, Neisseria meningitides, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pneumonia и Streptococcus pyogenes группы A.

Когда указано «иммунологически эффективное количество», «противоопухолевое эффективное количество», «эффективное для ингибирования опухоли количество» или «терапевтическое количество», точное количество композиций по настоящему изобретению, которое предстоит вводить, может определять врач с учетом индивидуальных различий в возрасте, массе тела, размере опухоли, степени инфицирования или метастазирования, а также состояния здоровья пациента (субъекта). Как правило, можно утверждать, что фармацевтическую композицию, содержащую T-клетки, описанные в настоящем документе, можно вводить в дозе 104-109 клеток/кг массы тела, в некоторых случаях 105-106 клеток/кг массы тела, включая все целочисленные значения в этих диапазонах. T-клеточные композиции можно также вводить несколько раз в этих дозах. Клетки можно вводить с использованием инфузионных методов, которые обычно применяют в иммунотерапии (смотри, например, Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988).

В некоторых аспектах может быть желательным введение активированных T-клеток субъекту с последующим забором крови (или проведением афереза), активацией T-клеток из нее в соответствии с настоящим изобретением и повторной инфузией пациенту этих активированных и размноженных T-клеток. Эту процедуру можно проводить несколько раз каждые несколько недель. В некоторых аспектах T-клетки можно активировать из объема забранной крови от 10 см3 до 400 см3. В некоторых аспектах T-клетки активируют из объема забранной крови 20 см3, 30 см3, 40 см3, 50 см3, 60 см3, 70 см3, 80 см3, 90 см3 или 100 см3.

Введение композиций субъекту можно осуществлять любым удобным способом, в том числе аэрозольной ингаляцией, инъекцией, проглатыванием, переливанием, имплантацией или трансплантацией. Композиции, описанные в настоящем документе, можно вводить пациенту трансартериальной, подкожной, внутрикожной, внутриопухолевой, внутриузловой, интрамедулярной, внутримышечной, внутривенной (в/в) инъекцией, или внутрибрюшинно. В одном аспекте T-клеточные композиции по настоящему изобретению вводят пациенту внутрикожной или подкожной инъекцией. В одном аспекте T-клеточные композиции по настоящему изобретению вводят в/в инъекцией. Композиции T-клеток можно инъецировать непосредственно в опухоль, лимфатический узел или зону инфекции.

В конкретном иллюстративном аспекте субъекты могут подвергаться лейкаферезу, когда лейкоциты собирают, обогащают или обедняют ex vivo для отбора и/или выделения интересующих клеток, например, T-клеток. Эти T-клеточные изоляты можно наращивать методами, известными в данной области, и обрабатывать таким образом, чтобы можно было ввести одну или более конструкций CAR по изобретению, тем самым создавая CAR T-клетку по изобретению. Субъекты, которые нуждаются в этом, могут впоследствии получать стандартное лечение высокой дозой химиотерапевтического препарата, с последующей трансплантацией стволовых клеток периферической крови. В некоторых аспектах после или одновременно с трансплантацией субъекты получают инфузию размноженных CAR T-клеток по настоящему изобретению. В дополнительном аспекте размноженные клетки вводят до или после хирургической операции.

Дозировка вышеуказанных терапевтических средств для введения пациенту будет варьироваться в зависимости от конкретного характера состояния, которое лечат, и конкретного реципиента этого терапевтического средства. Масштабирование доз для введения человеку можно выполнять в соответствии с принятой в данной области практикой. Доза для кампата, например, как правило, будет находиться в диапазоне от 1 до примерно 100 мг для взрослого пациента, которую вводит ежедневно в течение периода времени от 1 до 30 дней. Предпочтительная суточная доза составляет от 1 до 10 мг в сутки, хотя в некоторых случаях можно использовать большие дозы вплоть до 40 мг в сутки (описано в патенте США № 6120766).

В одном варианте осуществления молекулу CAR вводят в T-клетки, например, с использованием in vitro транскрипции, и субъекту (например, человеку) первоначально вводят CAR T-клетки по изобретению, с последующим одним или более введениями CAR T-клеток по изобретению, при этом одно или более последующих введений выполняют через менее чем 15 дней, например, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 или 2 дней после предыдущего введения. В одном варианте осуществления более одного введения CAR T-клеток по изобретению выполняют для субъекта (например, человека) в неделю, например, в неделю выполняют 2, 3 или 4 введения CAR T-клеток по изобретению. В одном варианте осуществления субъект (например, субъект-человек) получает более одного введения CAR T-клеток в неделю (например, 2, 3 или 4 введения в неделю) (что в настоящем документе также называют циклом), затем следует неделя без введения CAR T-клеток, и вслед за этим одно или более дополнительных введений CAR T-клеток (например, более одного введения CAR T-клеток в неделю) выполняют для субъекта. В другом варианте осуществления субъект (например, субъект-человек) получает более одного цикла введения CAR T-клеток, и период времени между циклами составляет менее 10, 9, 8, 7, 6, 5, 4 или 3 дней. В одном варианте осуществления CAR T-клетки вводят через день, что составляет 3 введения в неделю. В одном варианте осуществления CAR T-клетки по изобретению вводят в течение по меньшей мере двух, трех, четырех, пяти, шести, семи, восьми или более недель.

В одном аспекте CD19 CART получают с использованием лентивирусных векторов, таких как лентивирус. CART клетки, полученные таким образом, будут иметь стабильную экспрессию CAR.

В одном аспекте клетки CART временно экспрессируют CAR векторы в течение 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 дней после трансдукции. Временная экспрессия CAR может осуществляться за счет векторной доставки РНК CAR. В одном аспекте РНК CAR трансдуцируют в T-клетку методом электропорации.

Потенциальной проблемой, которая может возникать у пациентов, получающих лечение с использованием временно экспрессирующих CAR T-клеток (в частности, CART, несущих мышиные scFv), является анафилаксия после нескольких процедур.

Без привязки к какой-либо теории, считается, что такой анафилактический ответ может быть вызван у пациента при развитии гуморального анти-CAR ответа, то есть, выработке анти-CAR антител, имеющих анти-IgE изотип. Считается, что в продуцирующих антитела клетках пациента происходит переключение класса с IgG изотипа (который не вызывает анафилаксии) на IgE изотип, когда существует десяти-четырнадцатидневный перерыв в воздействии антигена.

Если для пациента существует высокая степень риска развития анти-CAR гуморального ответа в процессе терапии в условиях временной экспрессии CAR (которая происходит в результате трансдукции РНК), перерывы в инфузии CART не должны продолжаться дольше, чем десять-четырнадцать дней.

ПРИМЕРЫ

Далее изобретение описано более подробно со ссылкой на следующие экспериментальные примеры. Эти примеры приведены исключительно с целью иллюстрации и не предназначены для ограничения изобретения, если не указано иное. Таким образом, изобретение ни в коем случае не должно рассматриваться как ограниченное следующими примерами, но, напротив, должно быть истолковано как охватывающее любую и все вариации, которые будут очевидны благодаря идеям, приведенным в настоящем документе.

Считается, что без дополнительного описания обычный специалист в данной области способен, используя предшествующее описание и следующие далее иллюстративные примеры, получать и использовать соединения по настоящему изобретению и практиковать заявленные способы. Следующие рабочие примеры конкретно иллюстрируют различные аспекты настоящего изобретения и не должны быть истолкованы как ограничивающие каким-либо образом остальную часть изобретения.

Пример 1: Гуманизированное мышиное анти-CD19 антитело

Гуманизация мышиного анти-CD19 антитела нужна для клинической практики, поскольку специфичные для мыши остатки могут индуцировать человеческую иммунную реакцию на мышиный антиген (HAMA) у пациентов, получающих лечение с использованием CART19, то есть, лечение T-клетками, трансдуцированными конструкцией CAR19. Последовательности VH и VL полученного из гибридомы мышиного антитела к CD19 получали из литературных источников (Nicholson et al., 1997, выше). Гуманизацию осуществляли путем прививки областей CDR из мышиного анти-CD19 антитела на акцепторные каркасы человеческого антитела зародышевой линии VH4_4-59 и VK3_L25 (база данных vBASE). Помимо областей CDR, пять остатков каркаса, то есть, VH №71, №73, №78 и VL №71, №87, которые, как считается, поддерживают структурную целостность областей CDR, сохраняли из мышиной последовательности. Кроме того, человеческие J-элементы JH4 и JK2 использовали для тяжелой и легкой цепей, соответственно. Полученные аминокислотные последовательности гуманизированного антитела обозначены FMC63_VL_hz и FMC63_VH_hz1, соответственно, и приведены ниже в таблице 1. Нумерация остатков соответствует системе Kabat (Kabat E.A. et al., 1991, выше). Для определения CDR использовали как систему Kabat, так и систему Chothia et al., 1987, выше. Остатки, происходящие из анти-CD19 мыши, обозначены жирным шрифтом/курсивом. Положения №60/61/62, заключенные в рамку, соответствуют потенциальному сайту посттрансляционной модификации (PTM) в CDR H2, также называемой HCDR2.

Таблица 1
Аминокислотные последовательности вариабельных доменов гуманизированного антитела к CD19 (SEQ ID NOs: 114-117, соответственно, в порядке появления).

Эти гуманизированные IgG к CD19 использовали для получения растворимых scFv с целью проверки экспрессии и scFv для полных конструкций CART CD19 (см. примеры ниже). Интересно, что в процессе гуманизации для положения 62 в области CDRH2 предпочтителен остаток серина, а не остаток аланина, присутствующий в мышиной области CDRH2. В мышиной последовательности отсутствует посттрансляционная модификация (PTM) и находятся остатки аспарагин-серин-аланин в положениях 60/61/62, соответственно, в CDRH2. Это создает потенциальные мотивы PTM (указанные в виде заключенного в рамку участка в CDRH2) в процессе гуманизации. Было проверено, является ли сайт PTM, образованный в процессе гуманизации, «истинным» сайтом PTM или просто теоретическим. Было высказано предположение, что аминокислотный мотив из остатка аспарагина, за которым следует остаток серина (NS), может быть восприимчив к посттрансляционному дезамидированию, однако это не было очевидным. Также было высказано предположение, что сочетание остатка аспарагина, за которым следует любая аминокислота, кроме пролина, и с последующим остатком серина (NxS, x≠P), может быть восприимчивым к посттрансляционному N-гликозилированию. Для проверки этой гипотезы были получены два варианта IgG, в которых аспарагин в положении 60 (известном как сайт гликозилирования) был изменен мутацией на серин или глутамин, и варианты были обозначены FMC63_VH_hz2 (N60S) и FMC63_VH_hz2 (N60Q), соответственно. Эти конструкции были получены с целью устранения потенциального сайта посттрансляционной модификации (PTM) и тестирования на сохранение активности (смотри пример 2, ниже).

Клонирование:

Получали последовательности ДНК, кодирующие мышиные и гуманизированные домены VL и VH, и кодоны конструкций оптимизировали для экспрессии в клетках Homo sapiens.

Последовательности, кодирующие домены VL и VH, субклонировали из клонирующих векторов в экспрессионные векторы, подходящие для секреции в клетках млекопитающих. Тяжелую и легкую цепи клонировали в отдельные экспрессионные векторы, чтобы иметь возможность для совместной трансфекции. Элементы экспрессионного вектора включали промотор (энхансер-промотор цитомегаловируса (CMV)), сигнальную последовательность для облегчения секреции, сигнал полиаденилирования и терминатор транскрипции (ген бычьего гормона роста (BGH)), элемент, делающий возможной эписомную репликацию и репликацию в прокариотах (например, точка начала репликации SV40 и ColE1 или другие, известные в данной области), а также элементы, делающие возможной селекцию (ген устойчивости к ампициллину и маркер устойчивости к зеоцину).

Экспрессия:

Химерный и гуманизированный IgG-кандидаты экспрессировали в клетках HEK293F млекопитающих в 1-мл масштабе. Осветленные супернатанты использовали для изучения связывания методом FACS. Более конкретно, клетки HEK293F разбавляли до 5E5 клеток/мл в среде FreeStyle с добавлением пен/стреп, и 1 мл переносили в 24-луночный круглодонный планшет с глубокими лунками. 0,5 мкг плазмиды для легкой цепи и 0,5 мкг плазмиды для тяжелой цепи, подходящих для экспрессии в клетках млекопитающих, разбавляли в той же среде наряду с 4 мкл FuGENE HD (Roche REF 04709705001). Через 15 мин инкубации при RT смесь ДНК/Fugene добавляли по каплям к клеткам и помещали в инкубатор в атмосферу 5% CO2 с перемешиванием со скоростью 250 об/мин при температуре 37°C на пять дней. Затем супернатант отделяли от клеток центрифугированием. Для измерения содержания IgG аликвоты по 200 мкл помещали в лунки 96-луночного планшетов для микротитрования. Все образцы и стандарты были измерены в двойном повторе с использованием Protein A Dip и считывающих биосенсоров (Fortebio Cat № 18-5010). Планшет помещали в прибор Octet (ForteBio) и оставляли до уравновешивания при температуре 27°C в термостатированной камере. Данные были обработаны автоматически с использованием программы Octet User Software версии 3.0, и концентрацию определяли путем сравнивания со стандартной кривой для IgG.

Анализ связывания методом FACS:

Гуманизированные и химерные антитела оценивали в анализе связывания методом проточной цитометрии с использованием линии клеток 300.19-hsCD19FL. Эта линия клеток была получена путем трансфицирования мышиной линии преB-клеток 300.19 вектором (hCD19FL/pEF4-myc-His A), кодирующим полноразмерную кодирующую последовательность человеческого CD19 и естественный промотор, а также ген устойчивости к зеоцину. Вкратце, в клетки 300.19 электропорацией вводили линеаризованную плазмиду и затем клетки, экспрессирующие высокие уровни hsCD19, идентифицировали с использованием АПК-конъюгированного Ат против CD19 человека (клон HIB 19 от BD 555415) и впоследствии сортировали с использованием проточного цитометра FACS Aria. Отсортированные клетки hsCD19+ культивировали и подтверждали стабильную экспрессию в них высоких уровней hsCD19.

Анализ связывания можно выполнять непосредственно в бессывороточной культуральной среде, содержащей экспрессированные IgG. Все оцененные концентрации IgG нормировали на одну и ту же концентрацию (85 нМ) перед разбавлением 3-кратными серийными разведениями вплоть до 1,4 пМ. Затем аликвоты по 5×105 клеток/лунку инкубировали в 96-луночном планшете в течение 30 мин при температуре 4°C с разбавленными IgG. Клетки дважды промывали FACS-буфером (0,5% БСА в PBS) перед добавлением обнаруживающего антитела, конъюгированного с APC антитела козы против IgG человека, специфичного для Fc-фрагмента (Dianova #109-136-098), разбавленного 1:1000 в FACS-буфере. Клетки инкубировали еще 30 мин при температуре 4°C, затем дважды промывали в FACS-буфере и анализировали на приборе FACS Calibur (BD Bioscience). Построение кривых связывания (средняя интенсивность флуоресценции в зависимости от концентрации IgG) и определение EC50 проводили при помощи программы GraphPad PrismTM 3.0 с нелинейным регрессионным анализом сигмоидальной кривой доза-ответ (с переменным наклоном).

Анализы методом FACS продемонстрировали, что кажущееся связывание для всех оцениваемых IgG может варьироваться в широких пределах, при этом некоторые конструкции демонстрировали 5-10-кратный сдвиг по EC50 при сравнении IgG с scFv. Исходя из значений EC50, были выбраны лучшие кандидаты, которые имели аффинность связывания, повышенную в 2 или более раз по сравнению с химерным эталоном.

Пример 2: Характеризация анти-CD19 растворимых scFv фрагментов, полученных из гуманизированных IgG антител к CD19

Растворимые scFv фрагменты получали из гуманизированных IgG к CD19, описанных в примере 1, с использованием стандартных молекулярно-биологических методов. Эти растворимые scFv использовали в исследованиях для изучения таких характеристик, как стабильность, экспрессия на клеточной поверхности и связывающие свойства scFv. Кроме того, также проводили эксперименты для изучения влияния потенциального PTM, введенного в процессе гуманизации.

Экспрессия и очистка scFv

Для трансфекции каждой конструкции scFv примерно 3e8 клеток 293F трансфицировали 100 мкг плазмиды с использованием PEI в качестве реагента трансфекции при соотношении 3:1 (PEI:ДНК). Клетки выращивали в 100 мл экспрессионной среды ΕΧΡi293 (Invitrogen) при температуре 37°C в колбе, встряхиваемой со скоростью 125 об/мин, в атмосфере 8% CO2. Культуру собирали через шесть дней и использовали для очистки белка.

Клетки 293F собирали центрифугированием при 3500 g в течение 20 минут. Супернатант собирали и фильтровали через фильтрующую ячейку VacuCap90 PF (w/0,8/0,2 мкм Super Membrane, PALL). К супернатанту добавляли примерно 400 мкл агарозных гранул Ni-NTA (Qiagen). Смесь перемешивали вращением и инкубировали в течение 4 часов при температуре 4°C. Ее нагружали на очищающую колонку и промывали буфером для промывки с 20 мМ гистидина. Белок элюировали 500 мкл элюирующего буфера с 300 мМ гистидина. Проводили диализ образцов против PBS буфера при температуре 4°C в течение ночи. Белковые образцы количественно анализировали с использованием nanodrop 2000c.

Конформация scFv и анализ коллоидной стабильности

Термостабильность scFv определяли при помощи DSF: смешивали 10-20 мкл образца белка с красителем Sypro Orange (Invitrogen Cat № S6650) в конечном разведении 1:1000 в общем объеме 25 мкл в PBS, анализировали на приборе BioRad CFX1000 (25°C в течение 2 минут, затем приращение по 0,5°C в течение 30 секунд, с 25 до 95°C).

Для эксперимента с аналитической ЭХ примерно 15-20 мкг образца белка scFv в 20 мкл PBS инжектировали в колонку TSKgel Super SW2000 при скорости потока 0,3 мл/мин на приборе Agilent серии 1100.

Определение EC50 связывания методом FACS

Мышиную линию клеток 300.CD19 выращивали в среде RPMI 1640 с 0,5 мг/мл зеоцина. Примерно 5e5 клеток/на лунку переносили в 96-луночный планшет BD Falcon. Затем клетки центрифугировали при 900 об/мин (центрифуга Sorval Legend XT) в течение 3 минут. Супернатант удаляли. Образцы белка анти-CD19 scFv разбавляли в DPBS с 5% ЭБС. Образцы вносили в лунки, тщательно перемешивали с клетками и инкубировали в течение 1 часа. Клетки промывали дважды в DPBS с 5% ЭБС. Клетки инкубировали с анти-поли His PE (R&D) в течение 1 часа и промывали дважды перед анализом FACS (LSRII от BD Biosciences).

Кинетический анализ при помощи Proteon

Кинетику определяли с использованием Bio-Rad Proteon. Иммобилизацию проводили путем стандартного связывания через аминогруппы на сенсорном чипе GLC. Образцы scFv разбавляли до 0,03 мг/мл в ацетате, pH 4,5, и наносили на чип при скорости потока 30 мкл/мин в течение 300 секунд. Затем лиганд CD19 серийно разводили в PBS-Tween и инжектировали при скорости потока 50 мкл/мин в течение 120 секунд с временем диссоциации 480 секунд. Поверхность чипа регенерировали с помощью глицина, pH 2,5. По данным строили кривые, используя модель Ленгмюра 1:1.

Поверхностная экспрессия конструкции CART19 и окрашивание методом FACS

Суспензионные клетки HEK293F, временно трансфицированные различными анти-hCD19 CART, собирали через 2 дня после трансфекции. Примерно 1e6 клеток помещали в каждую лунку 96-луночного планшета с V-образными лунками (Greiner Bio-One, Germany) и трижды промывали 0,2 мл FACS-буфера (1хPBS, содержащий 4% бычьего сывороточного альбумина (БСА) (BSA fraction V, Roche Diagnostics, Indianapolis, IN). Клетки ресуспендировали в 0,2 мл FACS-буфера либо с 0,2 мкг биотинилированного белка L (GenScript, Piscataway, NJ), либо с 100 нМ hCD19(AA 1-291)-hIgG1 Fc (полученным в NIBRI), и инкубировали при температуре 4°С в течение 30 минут. Затем клетки промывали 0,2 мл FACS-буфера три раза и инкубировали с 1 мкл стрептавидина, меченого Alexa Fluor 488 (Life Technologies, Grand Island, NY), в 0,2 мл FACS-буфера для образцов с белком L, или 2 мкл PE анти-Fcγ человека (Jackson ImmunoResearch Laboratories, West Grove, PA) в 0,2 мл FACS-буфера для образцов с hCD19-hIgG1 Fc в течение 30 минут при температуре 4°С в темноте. После трехкратного промывания 0,2 мл FACS-буфера клетки анализировали на приборе LSRII (BD Biosciences, San Jose, CA) с использованием программы FACSDiva (BD Biosciences, San Jose, CA). Иммунофлуоресцентное окрашивание анализировали как относительный log флуоресценции живых клеток, и измеряли процентное содержание Alexa Fluor 488-положительных или PE-положительных клеток.

Анализ потенциальных PMT, полученных во время процесса гуманизации

Интересно, что в процессе гуманизации для положения 62 в области CDRH2 предпочтителен остаток серина, а не остаток аланина, присутствующий в мышиной области CDRH2, как описано в примере 1. Было проверено, является ли сайт PTM, образованный в процессе гуманизации, «истинным» сайтом PTM или просто теоретическим. Были получены два варианта IgG, в которых аспарагин в положении 60 (известном как сайт гликозилирования) был изменен мутацией на серин или глутамин, и варианты были обозначены FMC63_VH_hz2 (N60S) и FMC63_VH_hz2 (N60Q), соответственно. Эти конструкции были получены с целью устранения потенциального сайта посттрансляционной модификации (PTM) и тестирования на сохранение активности.

Результаты

Анти-CD19 гуманизированные scFv и мышиные scFv были экспрессированы в клетках 293F и очищены с использованием His-метки. Экспрессия и выход всех гуманизированных scFv были намного выше, чем у исходных мышиных scFv (данные не представлены).

Для подтверждения идентичности и оценки целостности конструкции scFv анализировали с инкубацией и без инкубации с N-гликанaзой F (PNGaseF), с последующим проведением как высокоэффективной жидкостной хроматографии и масс-спектрометрии (ВЭЖХ-МС) (см. фигуру 3), так и SDS-ПААГ (данные не представлены). PNGaseF представляет собой фермент, специфически удаляющий N-связанные структуры гликана с консенсусной последовательности N-X-S/T/C, где X представляет собой любую аминокислоту, за исключением пролина. Вкратце, образцы разбавляли в воде до концентрации 0,1 мкг/мкл и либо оставляли без обработки, либо инкубировали с PNGaseF при соотношении PNGaseF: scFv, составляющем 1:2 (по массе), в течение 3 часов при температуре 37°C.

Анализ методом SDS-ПААГ проводили с использованием NuPAGE 4-12% Bis-Tris геля от компании Novex. Примерно 2 мкг scFv наносили в каждую лунку и электрофорез проводили при постоянном напряжении 200 В в течение 40 минут. После электрофореза гель окрашивали красителем PhastGel Blue R 250 (Amersham Pharmacia) и обесцвечивали смесью 10% уксусной кислоты и 30% метанола.

ВЭЖХ-МС анализ проводили в системе Acquity UPLC от компании Waters, сопряженной с масс-спектрометром Xevo-Tof. Примерно 1 мкг каждого образца наносили на колонку POROS R 1/102,1×100 мм 10 мкм (Applied Biosciences), уравновешенную при температуре 60°C, со скоростью потока 0,5 мл/мин. Подвижные фазы представляли собой: 0,1% муравьиную кислоту (A) и 0,1% муравьиную кислоту, 75% изопропанол, 25% ацетонитрил (B). Белок элюировали с колонки с использованием градиента обращенной фазы 25%-90% B за 12 минут. Сбор данных производили при положительной ионизации электрораспылением в диапазоне сканирования масс m/z 600-4000 Да с изменением напряжения на конусе источника 20-50 В. Полученные спектры были развернуты с использованием MaxEnt1.

Сайт гликозилирования вводили во время процесса гуманизации. Не-PTM варианты (VH: N60S или N60Q) были без этой дополнительной формы. Была только одна конструкция с консенсусным сайтом N-связанного гликозилирования в HC CDR2. По результатам SDS-ПААГ анализа необработанные образцы мигрировали в виде одиночных полос, согласующихся с приблизительными молекулярными массами последовательностей для всех конструкций, за исключением 103101-WT (S/N), для которого наблюдали дуплет. Эта конструкция была единственной с консенсусным сайтом N-связанного гликозилирования в HC CDR2. При обработке PNGaseF полоса дуплета с более высокой молекулярной массой больше не присутствовала, что свидетельствовало о частичной занятости сайта. Аналогично, наблюдаемые молекулярные массы из развернутых масс-спектров согласовались с теми, которые были предсказаны на основании аминокислотных последовательностей. Однако в то время как другие конструкции демонстрировали одиночные основные виды молекул, 103101-WT (S/N) также имела молекулы, имеющие размер на 1217 дальтон больше, чем тот, который был предсказан на основании последовательности, которая больше не присутствовала после обработки PNGaseF. Это согласуется с наличием одной преобладающей N-связанной гликоформы, скорее всего, олигоманнозы 5, исходя из массы. Наличие гликозилированной формы подтверждали МС-анализом, как показано на фигуре 3.

Конформационную стабильность измеряли методом дифференциальной сканирующей флуориметрии (ДСФ). Как показано на фигуре 4, Tm мышиных scFv составляла 57°C, тогда как человеческие варианты демонстрировали более высокую Tm, составляющую примерно 70°C. Tm для всех гуманизированных scFv превосходила таковую для мышиных scFv, ясно показывая, что все гуманизированные scFv являются более стабильными, чем мышиные scFv. Эта стабильность, скорее всего, будет передаваться конструкции CART19, вероятно, приводя к улучшению терапевтических свойств.

Активность очищенных scFv измеряли путем связывания с экспрессирующими hCD19 клетками, а также путем связывания с антигеном hCD19, используя способ детекции на основе SPR. Мышиную линию клеток 300 использовали для определения связывания scFv. Величина EC50 мышиных scFv для hCD19 составляла примерно 06-1,6 нМ. Гуманизированные варианты имели EC50 того же диапазона в низко- или суб-нМ диапазоне EC50.

Пример 3: Конструкции CD19 CAR

ScFv, предназначенные для использования в конечной конструкции CAR, получали из гуманизированных IgG, описанных в примере 1. Для получения завершенного домена scFv меняли порядок, в котором домены VL и VH появляются в scFv (то есть, ориентация VL-VH или VH-VL), а также то, три или четыре копии субъединицы «G4S» (SEQ ID NO: 18), при этом каждая субъединица содержит последовательность GGGGS (SEQ ID NO: 18) (например, (G4S)3 (SEQ ID NO: 107) или (G4S)4 (SEQ ID NO: 106)), соединяют вариабельные домены, как показано в таблице 2.

Таблица 2.
Гуманизированные конструкции scFv для CD19, для которых показана ориентация VH и VL и длина линкера («3G4S» соответствует SEQ ID NO: 107 и «4G4S» соответствует SEQ ID NO: 106).
Название конструкции Длина, ак Аннотация Изменение Vh
mscFvCTL019 486 VL-VH, 3G4S
104879 491 VL-VH, 4G4S N/S
104880 491 VL-VH, 4G4S N/Q
104881 491 VH-VL, 4G4S N/S
104882 491 VH-VL, 4G4S N/Q
104875 486 VL-VH, 3G4S N/S
104876 486 VL-VH, 3G4S N/Q
104877 486 VH-VL, 3G4S N/S
104878 486 VH-VL, 3G4S N/Q
105974 491 VL-VH, 4G4S S/N
105975 491 VH-VL, 4G4S S/N
105976 486 VL-VH, 3G4S S/N
105977 486 VH-VL, 3G4S S/N

Последовательности гуманизированных scFv фрагментов (SEQ ID NOS: 1-12) приведены ниже в таблице 3. Полноразмерные конструкции CAR получали, используя SEQ ID NOs: 1-12 с дополнительными последовательностями, SEQ ID NOs: 13-17, приведенными ниже, для получения полноразмерных конструкций CAR с SEQ ID NOs: 31-42.

• лидер (аминокислотная последовательность) (SEQ ID NO: 13)

MALPVTALLLPLALLLHAARP

лидер (нуклеотидная последовательность) (SEQ ID NO: 54)

ATGGCCCTGCCTGTGACAGCCCTGCTGCTGCCTCTGGCTCTGCTGCTGCATGCCGCTAGACCC

• шарнир CD8 (аминокислотная последовательность) (SEQ ID NO: 14)

TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

шарнир CD8 (нуклеотидная последовательность) (SEQ ID NO: 55)

ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT

• трансмембранный фрагмент CD8 (аминокислотная последовательность) (SEQ ID NO: 15)

IYIWAPLAGTCGVLLLSLVITLYC

трансмембранный фрагмент (нуклеотидная последовательность) (SEQ ID NO: 56)

ATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCAC CCTTTACTGC

• внутриклеточный домен 4-1BB (аминокислотная последовательность) (SEQ ID NO: 16)

KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

внутриклеточный домен 4-1BB (нуклеотидная последовательность) (SEQ ID NO: 60)

AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG

• домен CD3-дзета (аминокислотная последовательность) (SEQ ID NO: 17)

RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

CD3-дзета (нуклеотидная последовательность) (SEQ ID NO: 101)

AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC

домен CD3-дзета (аминокислотная последовательность; NCBI эталонная последовательность NM_000734.3) (SEQ ID NO: 43)

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

CD3-дзета (нуклеотидная последовательность; NCBI эталонная последовательность NM_000734.3) (SEQ ID NO: 44)

AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC

шарнир IgG4 (аминокислотная последовательность) (SEQ ID NO: 102)

ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKM

шарнир IgG4 (нуклеотидная последовательность) (SEQ ID NO: 103)

GAGAGCAAGTACGGCCCTCCCTGCCCCCCTTGCCCTGCCCCCGAGTTCCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGTGTGGTGGTGGACGTGTCCCAGGAGGACCCCGAGGTCCAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCCCGGGAGGAGCAGTTCAATAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAATACAAGTGTAAGGTGTCCAACAAGGGCCTGCCCAGCAGCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTCGGGAGCCCCAGGTGTACACCCTGCCCCCTAGCCAAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTGGACAAGAGCCGGTGGCAGGAGGGCAACGTCTTTAGCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGGGCAAGATG

У всех этих клонов имело место изменение остатка Q/K в сигнальном домене костимулирующего домена, полученного из 4-1BB.

Последовательности гуманизированных последовательностей CDR доменов scFv приведены в таблице 4 для вариабельных доменов тяжелой цепи и в таблице 5 для вариабельных доменов легкой цепи. «ID» означает соответствующую SEQ ID NO для каждой CDR.

Таблица 4
CDR вариабельных доменов тяжелой цепи (Kabat)
Кандидат FW HCDR1 ID HCDR2 ID HCDR3 ID
мышиные_CART19 GVSLPDYGVS 19 VIWGSETTYYNSALKS 20 HYYYGGSYAMDY 24
гуманизированные_CART19 a VH4 GVSLPDYGVS 19 VIWGSETTYYSSSLKS 21 HYYYGGSYAMDY 24
гуманизированные_CART19 b VH4 GVSLPDYGVS 19 VIWGSETTYYQSSLKS 22 HYYYGGSYAMDY 24
гуманизированные_CART19 c VH4 GVSLPDYGVS 19 VIWGSETTYYNSSLKS 23 HYYYGGSYAMDY 24

Таблица 5
CDR вариабельных доменов легкой цепи
Кандидат FW LCDR1 ID LCDR2 ID LCDR3 ID
мышиные_CART19 RASQDISKYLN 25 HTSRLHS 26 QQGNTLPYT 27
гуманизированные_CART19 a VK3 RASQDISKYLN 25 HTSRLHS 26 QQGNTLPYT 27
гуманизированные_CART19 b VK3 RASQDISKYLN 25 HTSRLHS 26 QQGNTLPYT 27
гуманизированные_CART19 c VK3 RASQDISKYLN 25 HTSRLHS 26 QQGNTLPYT 27

Таблица 6 является идентификационным ключом для сопоставления номерных обозначений конструкций CD19 с конкретной ориентацией легкой и тяжелой цепей scFv, числом единиц линкера (то есть, (G4S)3 (SEQ ID NO: 107) или (G4S)4 (SEQ ID NO: 106)), разделяющих тяжелую и легкую цепи, и различающихся аминокислотных последовательностей в тяжелой цепи CDR2.

Таблица 6
Обозначения CD19 CAR.
ID клона/
№ CAR
Альтерн. ID клона Ориентация цепи Линкеры Сайт мутации в CDR2 тяжелой цепи SEQ ID NO
104875 (CAR1) C2136 L2H 3x YSSSL 28
104876
(CAR2)
C2137 L2H 3x YQSSL 29
104877
(CAR3)
C2138 H2L 3x YSSSL 28
104878
(CAR4)
C2139 H2L 3x YQSSL 29
104879
(CAR5)
C2140 L2H 4x YSSSL 28
104880
(CAR6)
C2141 L2H 4x YQSSL 29
104881
(CAR7)
C2142 H2L 4x YSSSL 28
104882
(CAR8)
C2143 H2L 4x YQSSL 29
105974
(CAR9)
C2144 L2H 4x YNSSL 30
105975
(CAR10)
C2145 H2L 4x YNSSL 30
105976
(CAR11)
C2146 L2H 3x YNSSL 30
105977
(CAR12)
C2147 H2L 3x YNSSL 30

CTL019 muCART19 L2H 3x YNSAL 57

scFv фрагменты CAR затем были клонированы в лентивирусные векторы для получения полноразмерной конструкции CAR в одной кодирующей рамке считывания и с использованием промотора EF1 альфа для экспрессии (SEQ ID NO: 100).

Промотор EF1 альфа

CGTGAGGCTCCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACAGTCCCCGAGAAGTTGGGGGGAGGGGTCGGCAATTGAACCGGTGCCTAGAGAAGGTGGCGCGGGGTAAACTGGGAAAGTGATGTCGTGTACTGGCTCCGCCTTTTTCCCGAGGGTGGGGGAGAACCGTATATAAGTGCAGTAGTCGCCGTGAACGTTCTTTTTCGCAACGGGTTTGCCGCCAGAACACAGGTAAGTGCCGTGTGTGGTTCCCGCGGGCCTGGCCTCTTTACGGGTTATGGCCCTTGCGTGCCTTGAATTACTTCCACCTGGCTGCAGTACGTGATTCTTGATCCCGAGCTTCGGGTTGGAAGTGGGTGGGAGAGTTCGAGGCCTTGCGCTTAAGGAGCCCCTTCGCCTCGTGCTTGAGTTGAGGCCTGGCCTGGGCGCTGGGGCCGCCGCGTGCGAATCTGGTGGCACCTTCGCGCCTGTCTCGCTGCTTTCGATAAGTCTCTAGCCATTTAAAATTTTTGATGACCTGCTGCGACGCTTTTTTTCTGGCAAGATAGTCTTGTAAATGCGGGCCAAGATCTGCACACTGGTATTTCGGTTTTTGGGGCCGCGGGCGGCGACGGGGCCCGTGCGTCCCAGCGCACATGTTCGGCGAGGCGGGGCCTGCGAGCGCGGCCACCGAGAATCGGACGGGGGTAGTCTCAAGCTGGCCGGCCTGCTCTGGTGCCTGGCCTCGCGCCGCCGTGTATCGCCCCGCCCTGGGCGGCAAGGCTGGCCCGGTCGGCACCAGTTGCGTGAGCGGAAAGATGGCCGCTTCCCGGCCCTGCTGCAGGGAGCTCAAAATGGAGGACGCGGCGCTCGGGAGAGCGGGCGGGTGAGTCACCCACACAAAGGAAAAGGGCCTTTCCGTCCTCAGCCGTCGCTTCATGTGACTCCACGGAGTACCGGGCGCCGTCCAGGCACCTCGATTAGTTCTCGAGCTTTTGGAGTACGTCGTCTTTAGGTTGGGGGGAGGGGTTTTATGCGATGGAGTTTCCCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGTAATTCTCCTTGGAATTTGCCCTTTTTGAGTTTGGATCTTGGTTCATTCTCAAGCCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGA (SEQ ID NO: 100).

Анализ гуманизированных конструкций CAR проводили, как описано в примере 4.

Пример 4: Анализ гуманизированных конструкций в CART для CD19

Для оценки возможности таргетирования CD19 при помощи технологии CAR одноцепочечные вариабельные фрагменты анти-CD19 антитела клонировали в лентивирусный экспрессионный вектор для CAR с CD3-дзета цепью и костимулирующей молекулой 4-1BB в четырех различных конфигурациях, и оптимальную конструкцию выбирали на основании количества и качества эффекторного T-клеточного ответа CD19 CAR-трансдуцированных T-клеток («CART19» или «CART19 T-клеток») на CD19+ мишени. Эффекторные T-клеточные ответы включают, но не ограничиваются ими, размножение клеток, пролиферацию, удвоение, продуцирование цитокинов и уничтожение клетки-мишени или цитолитическую активность (дегрануляцию).

Материалы и Методы

Получение перенаправленных T-клеток с гуманизированным CART19

Лентивирусные векторы переноса для гуманизированных CART19 использовали для получения геномного материала, упакованного в псевдотипированные лентивирусные частицы VSVg. Лентивирусный вектор переноса ДНК смешивали с тремя компонентами упаковки VSVg, gag/pol и rev в сочетании с реагентом липофектамином для совместной трансфекции их в 293T клетки. Через 24 и 48 часов среду собирали, фильтровали и концентрировали ультрацентрифугированием. Полученный вирусный препарат хранили при температуре -80°C. Количество трансдуцирующих единиц определяли титрованием на клетках SupT1. Перенаправленные CART19 T-клетки получали путем активации свежих необученных T-клеток посредством создания контакта с гранулами CD3x28 в течение 24 часов и последующего добавления соответствующего количества трансдуцирующих единиц для получения нужного процентного содержания трансдуцированных T-клеток. Эти модифицированные T-клетки оставляли для размножения до перехода их в состояние покоя и уменьшения в размерах, после чего их криоконсервировали для дальнейшего анализа. Количество клеток и размеры измеряли с использованием Coulter Multisizer™ III. Перед криоконсервацией процент трансдуцированных клеток (экспрессирующих CART19 на клеточной поверхности) и относительную интенсивность флуоресценции этой экспрессии для них определяли проточно-цитометрическим анализом на LSRII. На основании гистограмм можно определять относительные уровни экспрессии CAR путем сравнения процента трансдуцированных клеток с их относительной интенсивностью флуоресценции.

Оценка цитолитической активности, способности к пролиферации и секреции цитокинов перенаправленных T-клеток с гуманизированным CART19.

Для оценки функциональных способностей T-клеток с гуманизированным CAR19 уничтожать, пролиферировать и секретировать цитокины клетки размораживали и оставляли для восстановления на ночь. В дополнение к клеткам с гуманизированным CART19, клетки с мышиным CART19 использовали для сравнительных целей, в то время как SS1-BBz использовали в качестве ненаправленного экспрессированного CAR для изучения фоновых эффектов CAR/T-клеток. «Контрольный» золотой стандарт (GS) CART19 использовали во всех анализах для сравнения вариаций анализа. Важно отметить, что, GS CART19 представляют собой клетки, полученные в производственных условиях, подходящих для исследовательских целей (то есть, не для клинических целей), и IL-2 добавляли к растущей культуре. Это, вероятно, влияет на общую жизнеспособность и функциональность этих клеток и не следует проводить прямое сравнение с получением подходящих для научных исследований других популяций трансдуцированных T-клеток. T-клетки были направлены на уничтожение K562, линии клеток хронического миелогенного лейкоза, экспрессирующих или не экспрессирующих CD19, либо Pt14, B-клеток, полученных от пациента с CLL. Для этого основанного на методе проточной цитометрии анализа цитотоксичности клетки-мишени окрашивали CSFE для количественного определения их присутствия. Клетки-мишени окрашивали на экспрессию CD19 для подтверждения аналогичных уровней целевых антигенов. Цитолитическую активность CAR19 T-клеток измеряли при титровании в соотношениях эффектор: клетка-мишень, составляющих 10:1, 3:1, 1:1, 0,3:1 и 0:1, где эффекторы определяли как T-клетки, экспрессирующие анти-CD19 химерный рецептор. Анализы начинали смешиванием соответствующего количества T-клеток с постоянным количеством клеток-мишеней. Через 16 часов каждую смесь полностью удаляли и каждую лунку тщательно промывали, комбинируя соответствующим образом. T-клетки окрашивали на CD2, и все клетки окрашивали маркером для живых/мертвых клеток 7AAD. После последнего промывания осажденные клетки ресуспендировали в определенном объеме с заранее определенным количеством гранул для подсчета. Данные по окрашиванию клеток получали методом проточной цитометрии на LSRII и анализировали с помощью программы FloJo, используя гранулы для получения количественных результатов.

Для измерения клеточной пролиферации и продуцирования цитокинов T-клетками с гуманизированным CAR19 клетки размораживали и оставляли для восстановления на ночь. В дополнение к клеткам с гуманизированным CART19, клетки с мышиным CART19 использовали для сравнительных целей, в то время как SS1-BBz использовали в качестве ненаправленного экспрессированного CAR для изучения фоновых эффектов CAR/T-клеток. «Контрольный» золотой стандарт (GS) CART19 использовали во всех анализах для сравнения вариаций анализа. T-клетки были направлены либо против K562, линии клеток хронического миелогенного лейкоза, экспрессирующих или не экспрессирующих CD19, либо Pt14, B-клеток, полученных от пациента с CLL. Кроме того, гранулы CD3x28 использовали для оценки потенциальной способности T-клеток отвечать на эндогенные иммунологические сигналы. Для анализа пролиферации T-клетки окрашивали CSFE. Пролиферация проявляется как разбавление красителя CSFE, отражающее разделение родительской маркировки на две дочерние клетки. Анализ проводили только при соотношениях эффектор: мишень, составляющих 1:1 и 1:0, при этом эффекторы определяли как T-клетки, экспрессирующие анти-CD19 химерный рецептор. Анализ выполняли в двойном повторе и через 24 часа после смешивания клеток 50% среды удаляли/заменяли для проведение анализа на цитокины с использованием 10-плексной панели Luminex для определения человеческих цитокинов. Через 5 дней T-клетки окрашивали на экспрессию CAR, фенотипировали либо как CD4, либо как CD8 клетки, и окрашивали 7AAD для определения живых/мертвых клеток. После последнего промывания осажденные клетки ресуспендировали в определенном объеме с заранее определенным количеством BD гранул для подсчета. Данные по окрашиванию клеток получали методом проточной цитометрии на LSRII и анализировали с помощью программы FloJo, используя гранулы для получения количественных результатов. Общее количество клеток определяли как подсчитанное количество клеток по отношению к определенному количеству гранул с умножением на фракцию гранул, которые еще предстояло сосчитать.

Для оценки потенциальной способности клеток с гуманизированным CART19 действовать аналогично современным эффективным клеткам с мышиным CART19 авторы изобретения решили оценить in vitro их способность уничтожать клетки-мишени, пролиферировать в ответ на целевой антиген и демонстрировать признаки персистенции. Путем упаковки каждой из лентивирусных конструкций гуманизированных CART19 и титрования их на клетках SupT1 авторы изобретения смогли определить, что количество вируса для нормализации трансдукции составляет примерно 50%. Это позволило проводить более прямые сравнения активности, начиная со сходного среднего количества сайтов интеграции в расчете на клетку.

Терапевтические CAR19 T-клетки получали из крови от нормального донора после проведения афереза, необученные T-клетки которого получали путем отрицательной селекции на T-клетки, CD4+ и CD8+ лимфоциты. Эти клетки активировали CD3x28 гранулами в 10% RPMI при температуре 37°C, 5% CO2.

Через 24 часа целостность T-клеток нарушали и добавляли нормированное количество вируса. T-клетки начинали делиться в логарифмической модели роста, что отслеживали, измеряя количество клеток в мл и размеры клеток. По мере того, как T-клетки переходили в состояние покоя, логарифмический рост ослабевал и размер клеток уменьшался. Сочетание снижения скорости роста с приближением размеров T-клеток к ~300 фл определяет состояние, в котором T-клетки следует криоконсервировать или повторно стимулировать.

Существует очень сходная тенденция для T-клеток, находящихся в состоянии покоя, о чем можно судить по размерам. Почти перекрывающиеся картины в случае клеток с гуманизированным CART и клеток с обычным мышиным CART19, и популяции UTD свидетельствует об отсутствии необычного эффекта гуманизированного CAR19 на размножение обычных T-клеток после активации. В качестве контроля использовали SS1-BBz для определения нежелательной независимой от антигена активности CAR. Профиль размножения в общей численности клеток показывает, что различия в фактических количествах в отдельных размножающихся популяциях, судя по всему, возникают главным образом из-за различных стартовых количеств клеток. При нормировании стартовых количеств T-клеток наблюдается плотный кластер для всех CART19 клеток. Кроме того, нежелательный эффект независимой от антигена активации CAR обнаружен в линии с более низкими показателями и находящейся особняком от группы.

Определяли уровень поверхностной экспрессии для каждой из этих CAR19-экспрессирующих клеток. Титрованный вирус, нормированный по трансдукции, демонстрировал сопоставимые уровни экспрессии, коррелирующие с эффективностью трансдукции, процентом трансдуцированных клеток. Титры для некоторых CAR были экстраполированы из более ранних упаковок, и хотя у них процент трансдуцированных клеток был ниже, их показатели MFI также снижались, как и ожидалось. Результаты показывают, что нет никаких видимых негативных эффектов гуманизированного CAR19 на способность клеток нормально размножаться в сравнении с UTD и T-клетками с мышиным CAR19.

Изучали способность клеток с гуманизированным CART19 избирательно различать специфичный эпитоп клеточной поверхности, экспрессированный на клетках, и разрушать их. Клетки K562 дикого типа не экспрессируют CD19, но могут быть трансдуцированы для экспрессии CD19. При сравнении этих кривых уничтожения, титрование количества эффекторных клеток показало, что эти клетки, экспрессирующие CD19, были уничтожены. Перенаправленные T-клетки от одного и того же донора, модифицированные либо гуманизированным CART19, либо современным клиническим мышиным CART19, не различались по их способности к уничтожению. Кривые уничтожения показали, что очень сходные способности к уничтожению были обнаружены среди клеток с гуманизированным CART19, направленных на CD19+ CLL клетки от пациента 14. Интересно, что наблюдалось снижение общей цитолитической активности, в частности GS CART19, свидетельствующее о том, что эти клетки могут обладать специфическими ингибирующими свойствами. Сходные уровни CD19, экспрессированного на клетках-мишенях, указывают на то, что уровень экспрессии не является причиной различий в уничтожении клеток.

Необходимое свойство клеток с гуманизированным CART19 пролиферировать после встречи с клетками-мишенями было обнаружено у всех конструкций после их стимуляции контрольными CD3x28 гранулами и CD19-экспрессирующими мишенями. Направленные на Pt14 CLL клетки, похоже, демонстрировали несколько более высокую скорость пролиферации в случае scFv с ориентацией легкая цепь к тяжелой цепи, при этом никакой разницы не наблюдали в случае 3x или 4x GGGGS связывающего звена (SEQ ID NOS 107 и 106, соответственно). Результаты теста на пролиферацию отражают общее число клеток, накопленных на протяжении 5 дней, свидетельствуя о том, что гуманизированные CART19, 2146, 2144, 2136, 2141 и 2137 сообщают усиленный пролиферативный сигнал T-клеткам. Поразительно, что это было обнаружено в случае клеток с гуманизированным CART19, направленных на Pt14 CLL клетки.

В целом, гуманизированные конструкции CART19 проявляли очень сходные характеристики с используемыми в настоящее время CART19 по цитолитической активности, пролиферативному ответу и секреции цитокинов в ответ на антигенспецифические мишени. Потенциальная способность гуманизированных CART19 (2146, 2144, 2136, 2141 и 2137) сообщать более сильный пролиферативный сигнал T-клеткам при активации мишенью, очевидно, является дополнительным преимуществом этих новых конструкций для потенциального усиления терапевтического ответа.

Результаты

С использованием анализа на дегрануляцию и на продуцирование цитокинов было продемонстрировано, что сконструированные CART19 T-клетки специфически направлены на CD19+ клетки.

Анализировали клетки ND317, трансдуцированные гуманизированными конструкциями CD19 CAR (также называемыми «huCART19») по изобретению. Существовало большое сходство в размерах T-клеток во время их размножения после активации CD3x28 и трансдукции гуманизированными CART19-кандидатами в сравнении с трансдуцированными мышиными CART19 и немодифицированными (UTD) T-клетками.

Эксперименты показали небольшое различие в количестве T-клеток, которые накапливаются во время их размножения после активации CD3x28 и трансдукции различными гуманизированными CART19-кандидатами в сравнении с трансдуцированными мышиными CART19 и немодифицированными (UTD) T-клетками.

Уровни экспрессии на клеточной поверхности гуманизированного CART19 были сопоставимыми, и эти уровни были очень сходными с уровнями в случае мышиных CART19. Были построены гистограммы по результатам окрашивания на экспрессию на клеточной поверхности для каждых трансдуцированных гуманизированным CART19 T-клеток, и средняя интенсивность флуоресценции (MFI), рассчитанная из этих профилей, хорошо коррелировала с процентом трансдуцированных клеток.

Кроме того, клетки с гуманизированным CART19 имели сходные специфические цитотоксические активности при направлении на CD19-экспрессирующие клетки-мишени и сопоставимые с активностями клеток с мышиным CART19. Были построены графики по результатам анализа методом проточной цитометрии на уничтожение в течение 16 часов с использованием титрующих соотношений эффектора и мишени (E:T), в котором эффекторные клетки с гуманизированным CART19 были направлены на CSFE-меченые K562cc (фигура 1A, не экспрессирующие CD19 контроли), K562.CD19 (фигура 1B, клетки K562, трансдуцированные для экспрессии CD19) или Pt14 (фигура 1C, B-клетки от пациента с CLL). Цитолитические активности всех клеток с гуманизированным CART19 были сходными и сопоставимыми с активностью клеток с мышиным CART19. Различия в цитолитической активности между разными мишенями были сходными и сопоставимыми, свидетельствуя о том, что активность клеток с мышиным CART19 сохраняется в клетках с гуманизированной формой CART19.

Построенные гистограммы для CFSE-меченых клеток с гуманизированным CART19 через 6 дней после смешивания их с клетками-мишенями демонстрировали их пролиферативную способность (фигура 5). Пролиферативный ответ, вызываемый CAR19, является необходимым ответом после вступления в контакт и уничтожения клеток-мишеней для достижения положительного клинического ответа. Разбавление CSFE-окрашивания SS1-BBz, индикатор наличия дочерних клеток, в которых разбавляется окрашивание родительских клеток, является следствием того, что не покоящиеся T-клетки продолжают деление по независимому от таргетирования механизму.

Общую способность к пролиферации клеточных популяций оценивали с помощью гранул CD3x28, которые имитируют эндогенное связывание TCR и костимулятора CD28. Данные показывают, что все клеточные популяции имеют сопоставимые потенциалы для пролиферации. Все клетки с гуманизированным и мышиным CART19 пролиферировали сильно и сопоставимо при контакте с клетками K562, экспрессирующими CD19. Клетки с гуманизированным CART19 также хорошо отвечали на B-клетки, полученные от пациента с CLL, хотя некоторые, похоже, отвечали в несколько меньшей степени. Как показано на фигуре 2A и 2B, клетки с гуманизированным CART19 2136, 2137, 2140, 2141, 2144 и 2146 отличались несколько более выраженной пролиферацией, о чем свидетельствовало более сильное разбавление красителя CSFE. Все эти конструкции имели одну и ту же ориентацию вариабельной цепи, от легкой цепи к тяжелой, что указывало на то, что эта ориентация является предпочтительной. Более внимательное изучение аминокислотных изменений в сайте CDR2 тяжелой цепи (таблица 1) выявило, что каждая из этих трех вариаций YSSSL, YQSSL и YNSSL (SEQ ID NOS: 28, 29 и 30, соответственно) представлена в конструкциях, которые, судя по всему, демонстрировали более сильную пролиферацию при контакте с мишенями. Кроме того, эти рассматриваемые конструкции имели как линкер G4S, содержащий 3 копии субъединицы (3 G4S) (SEQ ID NO: 107), так и линкер G4S, содержащий 4 копии субъединицы (4 G4S) (SEQ ID NO: 106), это указывало на то, что размер линкера не влияет на функцию.

На основании результатов пролиферации, описанной выше, определяли общее число клеток через 5 дней после контакта с опухолью. Численность клеток была меньше, чем было изначально высеяно, это свидетельствовало о том, что активация необходима для поддержания жизнеспособности. Анализировали эндогенный контроль активации и обнаружили, что общее количество клеток по окончании 6 дней было аналогичным. Изучение клеток с гуманизированным CART19, направленных на клетки K562, экспрессирующие CD19, показало, что обе из двух линий клеток с мышиным CART19 в конечном итоге имели более высокое число клеток, при этом клетки 2146 имели несколько более высокое количество, чем все другие конструкции со сходными значениями. Общее количество клеток также анализировали через 6 дней после контакта с B-клетками от пациента 14 (pt14), и интересно отметить, что ранее отобранные гуманизированные конструкции CART19 2146, 2144, 2136, 2141 и 2137, все из которых имели ориентацию от легкой к тяжелой цепи и представляли три аминокислотные вариации YSSSL, YQSSL и YNSSL (SEQ ID NOS: 28, 29 и 30, соответственно), отличались более высоким общим количеством клеток, превышающим количество клеток с мышиным CART19. Это неожиданное различие между разными клонами с гуманизированными анти-CD19 CAR может привести к более высокой клинической эффективности CART-клеток, трансдуцированных этими конструкциями.

Анализировали фоновые уровни цитокинов, продуцируемых клетками с гуманизированными CART19 после контакта с контрольными клетками K562, не экспрессирующими CD19. Супернатанты, полученные через 24 часа, анализировали с использованием 30-плексной панели Luminex. Потенциальный профиль цитокинов в результате стимуляции эндогенной иммунной системы гранулами CD3x28 указывал на то, что все клеточные популяции имели сопоставимые профили цитокинов.

Данные также показали, что клетки с гуманизированным CART19 и мышиным CART19 продуцируют аналогичные профили цитокинов на аналогичных уровнях при ответе на одни и те же мишени. Профиль цитокинов имел более низкие значения, но был аналогичным при контакте с клетками-мишенями Pt14.

Пример 5: Лечение T-клетками с гуманизированным CD19 CAR в in vivo модели ALL.

Клетки первичного человеческого ALL выращивали в иммунодефицитных мышах без необходимости культивирования их in vitro. Таких мышей можно использовать для тестирования эффективности T-клеток с химерным антигенным рецептором (CAR) в модели, представляющей популяцию пациентов, которую можно найти в клинике. В используемой в данном случае модели клетки HALLX5447 пассировали дважды в мышах NOD.Cg-PrkdcscidIl2rgtmlWjl/SzJ (NSG) перед использованием в исследованиях по проверке эффективности CAR T-клеток.

Ранее было показано, что T-клетки с мышиным CD19 CAR таргетируют и уничтожают лейкозные клетки в модели первичного человеческого ALL на мышах NSG. scFv против CD19 (одноцепочечные вариабельные фрагменты Fc) были гуманизированы и в настоящем примере сравнивалась способность T-клеток, экспрессирующих гуманизированный CD19 CAR (CAR 2), к элиминации клеток опухоли ALL in vivo с аналогичной способностью T-клеток с мышиным CD19 CAR. В данном примере эффективность этих клеток напрямую сравнивали в экспериментах с мышами, имеющими сформировавшийся первичный человеческий ALL, что анализировали FACS-анализом человеческих CD19+ клеток в периферической крови. После имплантации 1,5×106 клеток первичного ALL внутривенно, бремя болезни, составляющее 2,5-4% CD19+ клеток человека в крови, было достигнуто через 2 недели после имплантации опухоли. Таким было процентное содержание CD19+ клеток среди всех клеток в крови мышей. 100% человеческих клеток у мышей перед началом лечения CAR T-клетками были опухолевыми клетками. Процентное содержание свыше 2% CD19+ человеческих клеток в периферической крови считается признаком развитого заболевания человеческого ALL в данной модели. Страдающих лейкозом мышей лечили CAR T-клетками после развития лейкоза у мышей примерно через две-три недели после имплантации опухоли. Мышей в каждой группе лечили, используя в общей сложности 5×106 человеческих T-клеток. Эффективность трансдукции донорских человеческих T-клеток CAR-экспрессирующим лентивирусом составляла 40-60%. После лечения T-клетками у мышей еженедельно брали кровь для анализа процентного содержания CD19+ человеческих клеток в крови в качестве биомаркера прогрессирования заболевания.

Материалы и методы:

Клетки первичного человеческого ALL: Первичные клетки не культивировали in vitro перед имплантацией. Эти клетки получали от пациента с ALL и затем переносили в мышей для развития и наращивания клеток. После того, как клетки опухоли были размножены в мышах, костный мозг и спленоциты собирали и замораживали с сохранением жизнеспособности отдельными партиями для повторной имплантации. Клетки замораживали в 90% ДМСО и 10% ЭБС при минимальной концентрации 5×106 клеток в миллилитре. Для повторной имплантации замороженные клетки ALL размораживали и затем вводили внутривенной инъекцией мышам NSG для получения мышей с ALL, которые будут использованы для сравнения противоопухолевой эффективности гуманизированных CD19 CAR T-клеток и мышиных CD19 CAR T-клеток.

Мыши : 6-недельных мышей NSG (NOD.Cg-PrkdcscidIl2rgtmlWjl/SzJ) получали от компании Jackson Laboratory (артикул 005557). Животных оставляли для акклиматизации в помещении для содержания животных в Novartis NIBRI в течение по меньшей мере 3 дней перед проведением экспериментов. С животными обращались в соответствии с правилами и принципами ACUC компании Novartis.

Имплантация опухолей: Серийно пассированные in vivo клетки первичного человеческого ALL, модель HALLX5447, размораживали в водяной бане с температурой 37°C. Затем клетки переносили в 15-мл коническую пробирку и промывали дважды холодным стерильным PBS. Вслед за этим клетки первичного ALL подсчитывали и ресуспендировали в концентрации 15×106 клеток в миллилитре PBS. Клетки помещали на лед и немедленно (в пределах одного часа) имплантировали мышам. Клетки ALL вводили внутривенной инъекцией в хвостовую вену в объеме 100 мкл, в общей сложности 1,5×106 клеток на мышь.

Дозирование CAR T-клеток: Мышам вводили 5×106 T-клеток через 16 дней после имплантации опухолей. Клетки частично размораживали в водяной бане с температурой 37 градусов Цельсия, а затем полностью размораживали путем добавления 1 мл холодного стерильного PBS в пробирку, содержащую клетки. Размороженные клетки переносили в 15-мл пробирки Falcon™ и доводили до конечного объема 10 мл PBS-буфером. Клетки промывали дважды центрифугированием при 1000 об/мин в течение 10 минут каждый раз, и затем подсчитывали на гемоцитометре. T-клетки затем ресуспендировали в концентрации 50×106 клеток в мл холодного PBS и хранили на льду до введения мышам. Мышам вводили внутривенной инъекцией в хвостовую вену 100 мкл CAR T-клеток, что соответствовало дозе 5×106 T-клеток на мышь. Пять мышей в каждой группе получали 100 мкл либо PBS (PBS), не трансдуцированных T-клеток (суррогат), содержащих мышиный CD19 CAR T-клеток (muCTL019), либо содержащих гуманизированный CD19 CAR T-клеток (huCTL019). Не трансдуцированные T-клетки, muCTL019 T-клетки и huCTL019 T-клетки получали от одного и того же человека-донора и готовили параллельно.

Мониторинг животных: Состояние здоровья мышей контролировали ежедневно, в том числе два раза в неделю измеряли массу тела. Процентное изменение массы тела рассчитывали по формуле (МТтекущая - МТисходная)/(МТисходная)×100%. Бремя опухоли контролировали еженедельно путем FACS-анализа периферической крови. У мышей еженедельно брали кровь из хвостовой вены в покрытые ЭДТА пробирки, которые хранили на льду. 10-20 мкл крови переносили из пробирок в 96-луночные планшеты на льду. Эритроциты лизировали с использованием ACK буфера для лизиса эритроцитов (Life Technologies, каталожный номер A 10492-01) и затем дважды промывали холодным PBS. Клетки инкубировали с блокирующей Fc смесью из блокаторов человеческих и мышиных Fc (Miltenyi Biotec, каталожные номера 130-059-901 и 130-092-575) в течение 30 минут и затем инкубировали с антителом против CD19 человека в течение 30 минут. Клетки фиксировали 2% раствором параформальдегида в течение 20 минут, промывали и хранили в PBS + 2% ЭБС в течение ночи перед анализом на BD Canto или Fortessa, с последующим анализом при помощи программы FlowJo для FACS-анализа. Клетки анализировали для определения процента человеческих CD19+ клеток в крови у мышей NSG, несущих опухолевые клетки HALLX5447 человеческого ALL. Процентное содержание CD19+ клеток в крови выражали в виде среднего значения ± стандартная ошибка среднего (SEM).

Процентные значения для групп лечения/контроля (T/C) рассчитывали с использованием следующей формулы:

% T/C=100×ΔΤ/ΔC, если ΔΤ≥0;

% регрессии=100×ΔΤ/Tисходное, если ΔΤ<0;

где T=среднее процентное содержание CD19+ клеток в периферической крови животных в группе, получавшей лекарственное средство, в последний день исследования; Tисходное=процентное содержание CD19+ клеток в периферической крови животных в группе, получавшей лекарственное средство, в первый день дозирования; ΔΤ=среднее процентное содержание CD19+ клеток в периферической крови животных в группе, получавшей лекарственное средство, в последний день исследования - среднее процентное содержание CD19+ клеток в периферической крови животных в группе, получавшей лекарственное средство, в первый день дозирования; C=среднее процентное содержание CD19+ клеток в периферической крови животных в контрольной группе в последний день исследования и ΔC=среднее процентное содержание CD19+ клеток в периферической крови животных в контрольной группе в последний день исследования - среднее процентное содержание CD19+ клеток в периферической крови животных в контрольной группе в первый день дозирования.

Значения T/C в диапазоне от 100% до 42% интерпретируют как отсутствие или наличие минимальной противоопухолевой активности; значения T/C в диапазоне ≤ 42% и > 10% интерпретируют как наличие противоопухолевой активности или ингибирования роста опухоли. Значения T/C≤10% или значения регрессии ≥ -10% интерпретируют как задержку роста опухоли. Значения регрессии < -10% интерпретируют как регрессию.

Результаты:

Противоопухолевую активность содержащих мышиный и гуманизированный CD19 CAR T-клеток оценивали и напрямую сравнивали с использованием модели первичного человеческого ALL. После имплантации опухоли в день 0 мышей произвольно распределяли в группы лечения и лечили внутривенным введением 5×106 T-клеток в день 16. Бремя болезни ALL и состояние здоровья контролировали до достижения животными конечной точки. Мышей во всех группах подвергали эвтаназии в день 65 после имплантации опухоли, когда бремя болезни в контрольных группах превышало 80% человеческих CD19+ клеток в периферической крови.

Четкое различие в бремени болезни наблюдали между контрольными группами и группами, получавшими лечение содержащими либо мышиный, либо гуманизированный CD19 CAR T-клетками, с P<0,01, которое начиналось со дня 24 после имплантации опухоли и продолжалось до конца исследования в день 65. Содержащие мышиный и человеческий CD19 CAR T-клетки демонстрировали сходные способности контролировать рост опухолевых клеток HALLX5447 человеческого ALL в мышах NSG. В обеих группах наблюдали пик уровня заболевания в периферической крови, соответствующий 12-15% человеческих CD19+ клеток в день 21 после имплантации HALLX5447. Через 42 дня после имплантации клеток опухоли человеческие CD19+ клетки не были обнаружены в группе huCTL019, в то время как процентное содержание человеческих CD19+ клеток в группе muCTL019 упало до примерно 1%. Содержащие как мышиный, так и гуманизированный CD19 CAR T-клетки проявляли сопоставимую способность контролировать размножение клеток первичного человеческого ALL в этой модели (P>0,05). Величина % T/C для группы суррогатных трансдуцированных T-клеток составляла 94,40%, свидетельствуя о том, что суррогатные трансдуцированные T-клетки не обладали противоопухолевой активностью. Процент регрессии в группе muCTL019 составлял -89,75% и в группе huCTL019 составлял -90,46%, свидетельствуя о том, что оба эти метода лечения были способны приводить к регрессии в модели с опухолевыми клетками HALLX5447. Процентное содержание человеческих CD19+ клеток в периферической крови как мера бремени болезни у этих мышей показано на фигуре 7. В группе лечения PBS, в которой животные не получали никаких T-клеток, наблюдали базовую кинетику роста опухолевых клеток первичного ALL, которые имплантировали внутривенно мышам NSG. Животные в группе суррогатного лечения получали не трансдуцированные T-клетки, подвергнутые тому же процессу размножения in vitro, что и CAR T-клетки. Эти клетки служили в качестве T-клеточного контроля для демонстрации неспецифического ответа на T-клетки в этой опухолевой модели. В группах лечения как PBS, так и суррогатными трансдуцированными T-клетками наблюдали непрерывное прогрессирование опухоли на протяжении всего эксперимента. Содержащие как мышиный, так и гуманизированный CD19 CAR T-клетки контролировали прогрессирование заболевания через одну неделю после инъекций 5×106 T-клеток и демонстрировали стабильную способность сохранять контроль над заболеванием на протяжении всех 65 дней исследования.

Противоопухолевую активность трансдуцированных мышиным и гуманизированным CD19 CAR T-клеток оценивали в исследованиях эффективности на мышах NSG, несущих клетки HALLX5447 первичного человеческого ALL. Это исследование показало, что содержащие как мышиный, так и гуманизированный CD19 CAR T-клетки (muCTL019 и huCTL019) способны создавать противоопухолевый ответ в модели первичного человеческого ALL. Кроме того, этот ответ, по результатам анализа на бремя болезни в периферической крови, не отличался для клеток muCTL019 и huCTL019. Содержащие как мышиный, так и гуманизированный CD19 CAR T-клетки контролировали рост первичного ALL через неделю после того, как мышам были введены T-клетки. Первоначально после лечения бремя болезни продолжало увеличиваться, прежде чем уменьшиться до практически не поддающегося обнаружению уровня. Одно введение содержащих либо мышиный, либо гуманизированный CAR T-клеток приводило к устойчивому противоопухолевому ответу на протяжении 65 дней, в течение которых заболевание прогрессировало у получавших контрольные препараты мышей. Содержащие гуманизированный CD19 CAR T-клетки демонстрировали способность создавать эффективный ответ против CD19+ опухолей и контролировать бремя болезни ALL, аналогичную той, которую наблюдали в случае содержащих мышиный CD19 CAR T-клеток.

Пример 6: Содержащие CD19 CAR T-клетки для использования в лечении множественной миеломы.

Даже при современных методах химиотерапии, таргетированной терапии и трансплантации аутологичных стволовых клеток миелома считается неизлечимым заболеванием. В настоящем примере описано лечение множественной миеломы (MM) аутологичными T-клетками, направленными на CD19 при помощи химерного антигенного рецептора (лентивирус/CD19:4-1BB:CD3-дзета; также известными как «CART19» или CTL019). Это пример показывает, что лечение при помощи CD19-направленного CAR имеет потенциал для создания масштабных, долгосрочных надежных ремиссий, основанных на таргетировании миеломных стволовых клеток и/или опухолевых клеток, которые экспрессируют CD19 на очень низком уровне (не поддающемся обнаружению большинством методов).

При лечении пациентки с агрессивным вторичным плазмаклеточным лейкозом авторы изобретения обнаружили, что введение CART19 через два дня после трансплантации спасительных аутологичных стволовых клеток приводило к быстрому устранению плазмаклеточного лейкоза и очень хорошему частичному ответу у пациентки, прошедшей несколько линий химиотерапии. Эта пациентка была зависима от переливаний в течение нескольких месяцев до начала лечения; через два месяца у нее восстановилась лейкоцитарная формула (с нормальным количеством тромбоцитов и уровнем лейкоцитов) и ей не требовались переливания, так как она была выписана из больницы после завершения лечения.

Поскольку клетки миеломы естественным образом не экспрессируют CD19, тот факт, что лечение при помощи CART19 вызвало быстрый и значительный противоопухолевый ответ в случае этой опухоли, вызывал удивление. Без привязки к какой-либо конкретной теории, было логично предположить, что CART19 можно было бы использовать для лечения миеломы, поскольку: (1) при том, что традиционно считается, что клетки миеломы отрицательны в отношении экспрессии CD19 согласно данным проточной цитометрии, существуют данные, указывающие на то, что клетки миеломы могут экспрессировать очень небольшие количества CD19, так, что экспрессию можно обнаружить на уровне РНК, но не методами проточной цитометрии или иммуногистохимии; и (2) существует концепция таргетирования клонотипичных В-клеток, которые, как полагают, являются раковыми стволовыми клетками, дающими начало множественной миеломе, и являются особенно устойчивыми к химиотерапии. Существуют клональные отношения между B-клетками и опухолевыми клетками миеломы, однако традиционное лечение миеломы направлено на злокачественные плазматические клетки, а не на B-клетки. Таким образом, лечение миеломы при помощи CART19 направлено на иные популяции клеток, чем большинство методов лечения меланомы.

В этом одном случае с пациенткой у пациентки были циркулирующие плазматические клетки, и авторам изобретения удалось протестировать ее опухолевые клетки на экспрессию CD19. Примерно 1-2% ее опухолевых клеток экспрессировали антиген CD19. (фигура 8). Таким образом, было обоснованным предположение, что CART19 могут оказать прямое воздействие на очень небольшую популяцию опухолевых клеток пациентки; хотя и нельзя было ожидать очень хорошего частичного ответа, исходя из таргетирования лишь крайне небольшой популяции CD19+ клеток опухоли.

В этом случае CART19 вводили после введения аутологичных стволовых клеток в качестве спасительной трансплантации после лечения высокими дозами мелфалана. Хотя это является стандартной терапией при миеломе, эта терапия не приводит к излечению. Более того, эта пациентка ранее подвергалась тандемным трансплантациям аутологичных стволовых клеток, и у нее возник рецидив вскоре (<6 месяцев) после трансплантации. Без привязки к какой-либо конкретной теории, при использовании CART19 клеток, как описано в настоящем примере, может быть задействован совершенно отдельный механизм лечения миеломы в сочетании со спасительной трансплантацией аутологичных стволовых клеток.

Еще десять пациентов с множественной миеломой получат лечение при помощи CART19 в фазе I клинических испытаний.

Обоснование доз и соотношение риск/польза

Для данного протокола авторы изобретения выбрали базовую дозировку с использованием внутривенного пути введения. Основная цель данного протокола заключалась в проверке безопасности и возможности введения CART19 клеток пациентам с множественной миеломой. Основными ожидаемыми токсическими эффектами были (1) высвобождение цитокинов, когда CAR клетки сталкиваются с их суррогатным антигеном CD19 на злокачественных или нормальных B-клетках; (2) истощение нормальных В-клеток, аналогично тому, что происходит при терапии ритуксимабом; (3) реакция кожи на стероиды и желудочно-кишечные синдромы, напоминающие болезнь «трансплантат против хозяина» (GVHD), что наблюдалось ранее, когда размноженные/костимулированные аутологичные T-клетки были использованы в сочетании с АТСК (ASCT) для лечения MM. Существовало теоретическое опасение, что трансформация или неконтролируемая пролиферация CART19 T-клеток может иметь место в ответ на высокие уровни CD19. В данном случае было меньше опасений по сравнению с другим исследованием для пациентов с CLL, поскольку содержание клонотипичных B-клеток при MM, как ожидается, будет намного меньше, чем содержание злокачественных B-клеток у неподдающихся лечению пациентов с CLL, которых лечили в данном исследовании.

Обоснование доз

В случае первых 3 пациентов авторы изобретения наблюдали клиническую активность при дозах, находящихся в диапазоне от 1,4×107 до 1,1×109 CART19 клеток. Этот результат показывает, что по меньшей мере у первых 3 проходящих лечение пациентов отсутствует очевидная зависимость ответа от дозы. Полный ответ наблюдали у пациентов, которым вводили дозы с разницей, кратной log2. Таким образом, в отличие от стандартных лекарственных средств, которые метаболизируются, CAR T-клетки имеют широкий диапазон значений доза-ответ. Это, скорее всего, происходит потому, что CAR T-клетки способны интенсивно пролиферировать в организме пациентов. Таким образом, авторы изобретения определили диапазон доз 1-5×108 CART19 клеток для инфузии. В описанном исследовании с участием одного пациента, которое было предложено из сострадательных мотивов, пациенту было предложено вплоть до 5×108 CART19 клеток, без нижнего предела дозы. Для испытания с участием десяти пациентов им будет предложено 1-5×107 CART19 клеток.

Общий дизайн

Проводили исследование с участием одного пациента, которое было предложено из сострадательных мотивов; оно было смоделировано после фазы I клинического исследования для определения того, является ли безопасной инфузия аутологичных T-клеток, трансдуцированных для экспрессии CART19. Основными задачами исследования были определение безопасности, переносимости и возможности приживления CART19 T-клеток у пациентов, прошедших процедуру спасительной АТСК после раннего рецидива, последовавшего за первой АТСК. Был составлен протокол для открытого пилотного исследования.

Включаемые в исследование субъекты пройдут биопсию костного мозга и оценку их MM обычными лабораторными методами и методами визуализации. Подходящие субъекты пройдут стационарный аферез для получения большого количества мононуклеарных клеток периферической крови (МКПК) для производства CART19. T-клетки будут выделены из МКПК, трансдуцированы лентивирусным вектором TCRζ/4-1BB, размножены in vitro и затем заморожены для последующего введения. Будет отмечено число пациентов, имеющих неадекватные результаты по сбору, наращиванию или изготовлению T-клеток, по сравнению с числом пациентов, T-клетки которых были успешно изготовлены; не ожидается, что изготовление препарата будет проблематичным в данной популяции пациентов.

Как правило, субъекты будут иметь достаточно стволовых клеток периферической крови, сохраняемых со времени мобилизации/сбора во время подготовки к их первой АТСК, чтобы провести две дополнительные АТСК. Те пациенты, которые не имеют этого, пройдут вторую процедуру мобилизации/сбора до или после их стационарного афереза в режиме, выбранном их лечащим врачом. Примерно через две недели после первоначального лейкафереза субъекты поступят в больницу и получат высокую дозу мелфалана (день -2), с последующей инфузией аутологичных стволовых клеток два дня спустя (день 0), и все субъекты получат инфузию CART19 клеток через четыре дня (день +2). В исследовании примут участие до 10 пациентов.

Для всех субъектов будут выполняться анализы крови для оценки безопасности, а также приживления и персистенции CART19 клеток через регулярные интервалы на протяжении недели 4 исследования. В день +42 и день +100 субъектам будет проведена аспирация/биопсия костного мозга для оценки количества плазматических клеток костного мозга и доставки CART19 клеток в костный мозг. Формальная оценка ответа будет проведена в день 100 в соответствии с критериями 136 Международной рабочей группы по изучению множественной миеломы (IMWG), и время до прогрессирования заболевания (TTP) будет контролироваться в соответствии с обычной клинической практикой для пациентов с множественной миеломой. Основным показателем эффективности, измеренным в данном исследовании, будет результат сравнения TTP после первой АТСК пациента с TTP после АТСК в данном исследовании.

Поскольку основным оцениваемым исходом в данном исследовании является безопасность и возможность инфузии CART19 клеток с АТСК, в исследовании будет использоваться правило ранней остановки. Вкратце, если менее 2 тяжелых неожиданных нежелательных явлений случится у первых пяти получающих лечение пациентов, в исследование будут введены еще пять субъектов для доведения количества участников до запланированных 10 человек. Проходящих лечение субъектов будут наблюдать в течение 40 дней после инфузии CART19 (то есть, до первой официальной оценки ответа в день 42) прежде, чем вводить в исследование следующего субъекта, пока не будут включены пять субъектов, которых будут наблюдать. При лечении второй группы из пяти пациентов не будет необходимости в периодах ожидания между введением каждого следующего субъекта.

После 6 месяцев интенсивного наблюдения субъектов будут оценивать по меньшей мере ежеквартально в течение двух лет, заполняя историю болезни, проводя физический осмотр и анализы крови. После этой оценки субъекты будут переведены в дополнительное исследование, заключающееся в ежегодном опросе по телефону и заполнении анкеты на протяжении вплоть до тринадцати лет с целью оценки для диагностирования долгосрочных проблем со здоровьем, таких, как развитие новых злокачественных новообразований.

Основные оцениваемые исходы

Это пилотное исследование предназначено для проверки безопасности и возможности использования аутологичных T-клеток, трансдуцированных CD19 TCRζ/4-1BB, для пациентов, получающих спасительную АТСК при MM после раннего рецидива, следующего за первой АТСК.

Основные оцениваемые исходы в отношении безопасности и возможности использования включают:

Возникновение связанных с исследованием нежелательных явлений, определяемых как NCJ CTC 2: признаки/симптомы 3-й степени, лабораторная токсичность и клинические события, которые, возможно, скорее всего или безусловно связаны с исследуемым препаратом в любое время с момента инфузии до недели 24. Сюда входит инфузионная токсичность, а также любая токсичность, возможно, связанная с CART19 клетками, включая, но не ограничиваясь ими:

a. лихорадку

b. сыпь

c. нейтропению, тромбоцитопению, анемию, аплазию костного мозга

d. печеночную дисфункцию

e. легочные инфильтраты или другую легочную токсичность

f. GVHD-подобные синдромы, затрагивающие желудочно-кишечный тракт или кожу.

Возможность создания CART19 клеток из продуктов афереза пациента. Будет определено количество полученных продуктов, которые не отвечают критериям выпуска готового продукта с точки зрения эффективности векторной трансдукции, чистоты, жизнеспособности, стерильности T-клеток и опухолевых примесей.

Глубина и продолжительность ответа после аутологичной трансплантации стволовых клеток с CART19 будут сравнены с глубиной и продолжительностью ответа, которые достигаются у каждого пациента после стандартной аутологичной трансплантации стволовых клеток.

Отбор и исключение из исследования субъектов

Критерии включения

Субъекты должны предварительно пройти АТСК в связи с MM и иметь прогрессирование заболевания в течение 365 дней после инфузии стволовых клеток. Субъекты, прошедшие две предварительные АТСК как часть запланированной консолидированной схемы тандемной АТСК, подходят для исследования. Прогрессирование заболевания будет определено в соответствии с критериями IMWG для прогрессирующего заболевания или, для пациентов, достигших ПР (CR) или нПР (sCR) после первоначальной АТСК, критериями для рецидива после ПР (Durie et al. Leukemia 2006; 20(9): 1467-1473). Примечание: не требуется, чтобы пациенты обязательно были включены в исследование в пределах 365 дней после первой АТСК, и пациенты могут получать лечение другими средствами, включая экспериментальные препараты, после рецидива/прогрессирования, следующего за предыдущей АТСК, до включения в данное исследование.

Субъекты должны предоставить подписанную форму информированного согласия.

Субъекты должны иметь достаточную функцию жизненно важных органов для получения высокой дозы мелфалана, что определяют по следующим показателям, измеренным в пределах 12 недель до даты инфузии мелфалана: a. сывороточный креатинин ≤ 2,5 или расчетный клиренс креатинина ≥ 30 мл/мин и отсутствие зависимости от диализа, b. SGOT ≤ 3x верхнего предела нормы и общий билирубин ≤ 2,0 мг/дл (за исключением пациентов, у которых гипербилирубинемия объясняется синдромом Жильбера), c. фракция выброса левого желудочка (ФВЛЖ) (LVEF) ≥ 45% или, если ФВЛЖ составляет < 45%, официальная оценка кардиолога, удостоверяющего отсутствие клинически значимых нарушений сердечно-сосудистой функции. Оценка ФВЛЖ должна быть проведена в пределах шести недель до включения в исследование, d. адекватная легочная функция с показателями ОФВ1 (FEV1), ФВС (FVC), ОЕЛ (TLC), ДСЛ CO (DLCO) (после соответствующей корректировки на объем легких и концентрацию гемоглобина) ≥ 40% от ожидаемых значений. Проверка легочной функции должна быть проведена в пределах шести недель до включения в исследование.

Субъекты должны иметь функциональный статус по критериям ECOG, соответствующий 0-2, если только более высокий функциональный статус не связан исключительно с болью в костях.

Критерии исключения Субъекты не должны:

Иметь какую-либо активную и неконтролируемую инфекцию.

Иметь активный гепатит B, гепатит C или ВИЧ-инфекцию.

Любое неконтролируемое медицинское нарушение, которое исключает участие, как описано.

Схема лечения

Терапия для рецидивирующей/прогрессирующей множественной миеломы

Пациенты могут до включения в исследование получать лечение в связи с рецидивирующей/прогрессирующей множественной миеломой в соответствии с выбором их лечащего врача. Терапия может продолжаться после включения в исследование.

Пациенты должны прекращать любое лечение за две недели до афереза и за две недели до получения высокой дозы мелфалана. Если ожидаемый интервал между аферезом и высокой дозой мелфалана составляет более двух недель, пациенты могут возобновлять лечение после афереза по усмотрению их лечащего врача.

Высокая доза мелфалана (день -2)

Пациенты поступят в больницу в день -3 или -2 и пройдут обследование лечащим врачом и обычные лабораторные анализы, которые будут включать мониторинг параметров для синдрома лизиса опухоли, до начала лечения в соответствии с протоколом. Кровь для лабораторных анализов с целью контроля MM (ЭСБ (SPEP), количественное определение иммуноглобулинов и анализ свободных легких цепей в сыворотке) будет взята до начала терапии, если такие анализы не были проведены в течение 7 дней до поступления в больницу.

Терапия высокой дозой будет включать внутривенное введение мелфалана в дозе 200 мг/м2 в течение примерно 20 минут в день -2. Доза мелфалана будет снижена до 140 мг/м2 для пациентов старше 70 лет или для пациентов любого возраста, которые по мнению лечащего врача могут не перенести дозу 200 мг/м2. Все пациенты профилактически получат стандартные противорвотные препараты, которые могут включать дексаметазон, и стандартный антибиотик профилактически.

Повторная инфузия стволовых клеток (день 0)

Инфузия стволовых клеток будет проведена в день 0, по меньшей мере через 18 часов после введения высокой дозы мелфалана. Стволовые клетки будут введены внутривенной инфузией в течение примерно 20-60 минут после премедикации в соответствии со стандартом институциональной практики. Должно быть введено по меньшей мере 2×106 CD34+ предшественников/кг массы тела. Кроме того, по меньшей мере 1×106 CD34+ предшественников/кг массы тела должно быть доступно в качестве резервных стволовых клеток для инфузии в случае задержки приживления или позднего отторжения трансплантата. G-CSF должен быть введен п/к, начиная со дня +5, в дозах, соответствующих стандарту институциональной практики. Другие методы поддерживающего лечения, такие как поддерживающее переливание, будут применены в соответствии со стандартными институциональными руководящими принципами.

Инфузия CART19 клеток (день +2)

Будет введена одна доза трансдуцированных CART19 T-клеток, включающая до 5×107 CART19 клеток. В таком протоколе для одного пациента не будет минимальной приемлемой дозы вводимых инфузией клеток, трансдуцированных вектором CD19 TCRζ/4-1BB. CART-19 клетки будут введены в одной дозе быстрой в/в инфузией в день +2 после инфузии стволовых клеток.

Поддерживающий леналидомид

Субъекты, которые получали и хорошо переносили поддерживающий препарат леналидомид после их первой АТСК, вновь начнут поддерживающую терапию леналидомидом примерно в день +100, при отсутствии противопоказаний по мнению их лечащего врача.

Получение и введение изучаемого лекарственного средства

CART19 T-клетки будут получены в CVPF и останутся в CVPF до достижения соответствия утвержденным FDA критериям выпуска готового продукта для инфузионных клеток (например, доза клеток, чистота клеток, стерильность, среднее количество копий векторов/клетку и так далее). После выпуска клетки будут доставлены в больницу для введения.

Размораживание клеток. Замороженные клетки будут транспортированы в сухом льду до постели больного. Клетки будут разморожены возле постели больного при помощи водяной бани, поддерживаемой при температуре от 36°C до 38°C. Упаковку следует осторожно массировать до полного размораживания клеток. В контейнере не должно оставаться замороженных сгустков. Если препарат CART19 клеток будет выглядеть испорченным или упаковка будет протекать, либо будут заметны иные нарушения, препарат не должен быть введен и должен быть возвращен в CVPF, как указано ниже.

Премедикация. Побочные эффекты после инфузии T-клеток включают временное повышение температуры, озноб и/или тошноту; для обзора смотри Cruz et al. (Cytotherapy 2010; 12(6): 743-749). Рекомендуется премедикация субъекта с использованием ацетаминофена и дифенгидрамина гидрохлорида перед инфузией CART19 клеток. Прием этих препаратов можно повторять каждые шесть часов по мере необходимости. Может быть предписан курс нестероидных противовоспалительных средств, если у пациента сохраняется повышенная температура, несмотря на прием ацетаминофена. Рекомендуется совсем не давать пациентам системные кортикостероиды, такие как гидрокортизон, преднизон, метилпреднизолон или дексаметазон, за исключением экстренных случаев угрозы для жизни, поскольку эти препараты могут оказывать неблагоприятный эффект на T-клетки. Если кортикостероиды необходимы в случае острой реакции на инфузию, рекомендуется начальная доза гидрокортизона 100 мг.

Пиретическая реакция. В маловероятном случае, если у субъекта разовьется сепсис или системная бактериемия после инфузии CAR T-клеток, должен быть произведен соответствующий посев и предприняты необходимые медицинские меры. В случае подозрения на загрязнение препарата CART19 T-клеток препарат должен быть повторно протестирован на стерильность с использованием архивированных образцов, хранящихся в CVPF.

Введение. Инфузия будет проведена в изолированном помещении в Rhoads, с принятием мер предосторожности для пациентов с ослабленным иммунитетом. Трансдуцированные T-клетки будут введены быстрой внутривенной инфузией со скоростью потока примерно от 10 мл до 20 мл в минуту через не содержащее латекс Y-образное устройство для переливания крови с иглой 18G и с 3-ходовой краном. Продолжительность инфузии будет составлять примерно 2-20 минут. К каждому инфузионному мешку будет прикреплена этикетка следующего содержания: «ТОЛЬКО ДЛЯ АУТОЛОГИЧНОГО ИСПОЛЬЗОВАНИЯ». Помимо этикетки будут присутствовать по меньшей мере два уникальных идентификатора, например, содержащие инициалы субъекта, дату рождения и номер исследования. Перед проведением инфузии два человека будут независимо проверять всю эту информацию в присутствии субъекта и, таким образом, подтверждать, что данная информация точно соответствует участнику исследования.

Оборудование для неотложной медицинской помощи (то есть, автомобиль скорой медицинской помощи) будет находиться поблизости во время инфузии на случай, если у субъекта разовьется аллергическая реакция или тяжелой гипотензивный криз, или любая другая реакция на инфузию. Жизненно важные показатели (температура, частота дыхания, пульс и кровяное давление) будут измерены до и после инфузии, затем каждые 15 минут в течение по меньшей мере одного часа и до тех пор, пока эти показатели не станут удовлетворительными и стабильными. Субъекта попросят не покидать больницу до тех пор, пока врач не сочтет, что это безопасно для пациента или пациентки.

Упаковка

Инфузия будет состоять из одной дозы 1-5×108 трансдуцированных CAR19 T-клеток, с минимальной приемлемой дозой 1×107 CART19 клеток для инфузии. Каждый мешок будет содержать аликвоту (объем зависит от дозы) криосреды, содержащую следующие реагенты инфузионной степени чистоты (% по объему): 31,25% плазмалит-A, 31,25% декстрозы (5%), 0,45% NaCl, до 7,5% ДМСО, 1% декстрана 40, 5% человеческого сывороточного альбумина.

Аферез

Процедуру афереза для больших объемов (12-15 литров или 4-6 объемов крови) проводят в центре афереза. Во время этой процедуры получают МКПК для CART19. Во время одного лейкафереза предполагается получать по меньшей мере 50×109 лейкоцитов для создания CART19 T-клеток. Исходные лейкоциты крови для ретроспективных исследований в соответствии с требованиями FDA и для научных исследований также получают и криоконсервируют. Ожидается, что препарат клеток будет готов для выпуска примерно через 2-4 недели. Методом проточной цитометрии проводят подсчет подмножеств лимфоцитов, включая определение CD19 и CD20 B-клеток. Оценку исходного уровня проводят для человеческих антител против VSV-G и против мышиного антигена (HAMA). Если для субъекта была раньше собрана адекватная коллекция клеток после афереза, сохраняемая в соответствии с современными правилами надлежащей производственной практики в Клиническом центре производства клеток и вакцин (Clinical Cell and Vaccine Production Facility), эти клетки можно использовать в качестве источника клеток для производства CART19. Использование сохраняемого продукта афереза позволило бы сократить расходы, время и риск для субъекта в случае прохождения им дополнительного афереза.

Циторедуктивная химиотерапия

Противолимфомная химиотерапия будет заключаться в приеме высокой дозы мелфалана, как описано в настоящем документе.

Инфузия CART19

Инфузия будет начата в день +2 после повторной инфузии стволовых клеток.

В день +2 перед первой инфузией пациентам будет сделан общий анализ крови (CBC) с дифференциалом, и проведена количественная оценка CD3, CD4 и CD8, поскольку химиотерапию отчасти проводят, чтобы индуцировать лимфопению.

Первая доза будет введена в виде однократной дозы. Клетки будут разморожены возле постели пациента. Размороженные клетки будут введены при максимально переносимой скорости инфузии так, что продолжительность инфузии составит примерно 10-15 минут. Для облегчения смешивания клетки будут введены одновременно с использованием Y-образного адаптера. Субъекты получат инфузию и премедикацию, как описано в настоящем документе. Жизненно важные показатели субъектов будут оценены и импульсная оксиметрия проведена перед введением дозы, после окончания инфузии и каждые последующие 15 минут в течение 1 часа и до тех пор, пока показатели не станут стабильными и удовлетворительными. Образец крови для определения исходного уровня CART19 будет собран в любой момент перед первой инфузией и в срок от 20 минут до 4 часов после каждой инфузии (и отправлен в TCSL).

Для пациентов, испытывающих признаки токсичности, связанные с введением высокой дозы мелфалана, инфузия будет отложена до тех пор, пока их состояние не улучшится. Конкретные проявления токсичности, из-за которых инфузия T-клеток должна быть отложена, включают: 1) легкие: необходимость в дополнительном кислороде для поддержания насыщения на уровне выше 95% или наличие рентгенологических аномалий на рентгеновских снимках грудной клетки, которые прогрессируют; 2) сердце: новая сердечная аритмия, не поддающаяся консервативному лечению; 3) гипотензия, требующая применения сосудосуживающих препаратов; 4) активная инфекция: положительный результат при посеве крови на наличие бактерий, грибков или вирусов в течение 48 часов после инфузии T-клеток.

Контроль проявлений токсичности

Неконтролируемая пролиферация T-клеток. Токсичность, связанную с аллогенной или аутологичной инфузией T-клеток, контролировали путем фармакологической иммуносупрессии. Сообщалось, что связанная с T-клетками токсичность поддается лечению системными кортикостероидами. В случае неконтролируемой пролиферации T-клеток (токсичность 3 или 4 степени, связанная с CART19 клетками), субъекты могут получать кортикостероиды. Субъекты будут получать импульсную терапию метилпреднизолоном (2 мг/кг в/в, разделенными дозами каждые 8 часов × 2 дня), с последующим быстрым постепенным сокращением дозы.

Кроме того, на основании наблюдений за субъектами, получавшими лечение по другому протоколу, существуют некоторые опасения насчет синдрома активации макрофагов (MAS), хотя ожидается, что бремя CD19+ опухоли будет гораздо меньше у пациентов с миеломой, чем у пациентов с CLL. Решение о лечении и сроках лечения этой токсичности будет принимать лечащий врач пациента и проводящий испытание исследователь. Предлагаемое лечение включает: если температура тела у субъекта превышает 101°F и сохраняется более 2 последовательных дней и при этом отсутствуют признаки инфекции (отрицательные результаты посева крови, рентгена грудной клетки (CXR) или других анализов), можно рассмотреть возможность применения тоцилизумаба в дозе 4 мг/кг массы тела. По усмотрению врача можно применять кортикостероиды и анти-TNF терапию.

Истощение В-клеток. Есть вероятность, что произойдет истощение B-клеток и гипогаммаглобулинемия. Это обычное явление при анти-CD20 направленной терапии. В случае клинически значимой гипогаммаглобулинемии (то есть системных инфекций), субъекты будут получать внутривенно иммуноглобулин (IVIG) в соответствии с установленными правилами клинического дозирования для восстановления нормальных уровней сывороточных иммуноглобулинов, как было в случае с ритуксимабом.

Отторжение первичного трансплантата. Отторжение первичного трансплантата (то есть, отсутствие приживления) может чаще встречаться после второй АТСК, чем после первой АТСК. Критерии допуска к участию в исследовании предусматривают, что достаточное количество стволовых клеток должно быть в наличии для спасительной повторной инфузии по решению лечащего врача в случае отторжения первичного трансплантата.

ЭКВИВАЛЕНТЫ

Полное содержание всех и каждого патента, патентной заявки и публикации, процитированных в настоящем документе, включено в настоящий документ посредством ссылки. При том, что данное изобретение описано со ссылками на конкретные аспекты, очевидно, что другие аспекты и варианты данного изобретения могут быть разработаны специалистами в данной области без отступления от сущности и объема изобретения. Прилагаемую формулу изобретения следует рассматривать как включающую все такие аспекты и эквивалентные вариации.

1. Выделенная молекула нуклеиновой кислоты, кодирующая химерный антигенный рецептор (CAR), при этом CAR содержит антитело или фрагмент антитела, которые включают гуманизированный анти-CD19-связывающий домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий стимулирующий домен, при этом указанный анти-CD19-связывающий домен содержит:

определяющую комплементарность область 1 легкой цепи (LC CDR1), содержащую аминокислотную последовательность SEQ ID NO: 25,

определяющую комплементарность область 2 легкой цепи (LC CDR2), содержащую аминокислотную последовательность SEQ ID NO: 26,

определяющую комплементарность область 3 легкой цепи (LC CDR3), содержащую аминокислотную последовательность SEQ ID NO: 27,

определяющую комплементарность область 1 тяжелой цепи (HC CDR1), содержащую аминокислотную последовательность SEQ ID NO: 19,

определяющую комплементарность область 2 тяжелой цепи (HC CDR2), содержащую любую аминокислотную последовательность из SEQ ID NO: 22, 21 или 23, и

определяющую комплементарность область 3 тяжелой цепи (HC CDR3), содержащую аминокислотную последовательность SEQ ID NO: 24.

2. Выделенная молекула нуклеиновой кислоты по п. 1, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 21.

3. Выделенная молекула нуклеиновой кислоты по п. 1, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 22.

4. Выделенная молекула нуклеиновой кислоты по п. 1, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 23.

5. Выделенная молекула нуклеиновой кислоты по п. 1, которая кодирует любую вариабельную область легкой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

6. Выделенная молекула нуклеиновой кислоты по п. 1, которая кодирует любую вариабельную область тяжелой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

7. Выделенная молекула нуклеиновой кислоты по п. 1, которая кодирует любую вариабельную область легкой цепи и любую вариабельную область тяжелой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

8. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой анти-CD19-связывающий домен представляет собой scFv.

9. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой вариабельная область легкой цепи содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности вариабельной области легкой цепи, любой из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или аминокислотную последовательность с по меньшей мере 95% идентичности с ней.

10. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой вариабельная область тяжелой цепи содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности вариабельной области тяжелой цепи, любой из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или аминокислотную последовательность, имеющую 95-99% идентичности с ней.

11. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой анти-CD19-связывающий домен содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или аминокислотную последовательность с по меньшей мере 95% идентичности с ней.

12. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой последовательность нуклеиновой кислоты, кодирующая анти-CD19-связывающий домен, содержит последовательность нуклеиновой кислоты, выбранную из группы, состоящей из SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность нуклеиновой кислоты, имеющую по меньшей мере 95% идентичности с ними.

13. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, которая содержит последовательность нуклеиновой кислоты, выбранную из группы, состоящей из SEQ ID NO: 86, SEQ ID NO: 85, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 и SEQ ID NO: 96, или последовательности нуклеиновой кислоты с по меньшей мере 95% идентичности с ней.

14. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой кодируемый CAR содержит трансмембранный домен, который представляет собой трансмембранный домен белка, выбранного из группы, состоящей из альфа-, бета- или дзета-цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154, или кодируемый CAR включает трансмембранный домен, который содержит трансмембранный домен альфа-цепи CD8.

15. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой:

(i) кодируемый трансмембранный домен содержит аминокислотную последовательность SEQ ID NO: 15,

(ii) кодируемый трансмембранный домен содержит аминокислотную последовательность, содержащую по меньшей мере одну, две или три модификации, но не более чем 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 15, или аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с аминокислотной последовательностью SEQ ID NO: 15, или

(iii) последовательность нуклеиновой кислоты, кодирующая трансмембранный домен, содержит последовательность нуклеиновой кислоты SEQ ID NO: 56 или последовательность нуклеиновой кислоты, имеющую по меньшей мере 95% идентичности с ней.

16. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой кодируемый анти-CD19-связывающий домен связан с трансмембранным доменом с помощью шарнирной области.

17. Выделенная молекула нуклеиновой кислоты по п. 16, в которой:

(i) кодируемая шарнирная область содержит аминокислотную последовательность SEQ ID NO: 14 или аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с ней, или

(ii) последовательность нуклеиновой кислоты, кодирующая шарнирную область, содержит последовательность нуклеиновой кислоты SEQ ID NO: 55 или последовательность нуклеиновой кислоты, имеющую по меньшей мере 95% идентичности с ней.

18. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, где внутриклеточный сигнальный домен содержит костимулирующий домен.

19. Выделенная молекула нуклеиновой кислоты по п. 18, в которой костимулирующий домен представляет собой функциональный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137).

20. Выделенная молекула нуклеиновой кислоты по п. 18 или 19, в которой:

(i) кодируемый костимулирующий домен содержит аминокислотную последовательность SEQ ID NO: 16,

(ii) кодируемый костимулирующий домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 16, или аминокислотную последовательность, имеющую по меньшей мере 95% с ней, или

(iii) последовательность нуклеиновой кислоты, кодирующая костимулирующий домен, содержит последовательность нуклеиновой кислоты SEQ ID NO: 60 или последовательность нуклеиновой кислоты, имеющую по меньшей мере 95% идентичности с ней.

21. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, где внутриклеточный сигнальный домен содержит основной сигнальный домен.

22. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой кодируемый внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и/или функциональный сигнальный домен CD3-дзета.

23. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой:

(i) кодируемый внутриклеточный сигнальный домен содержит аминокислотную последовательность SEQ ID NO: 16 и/или аминокислотную последовательность SEQ ID NO: 17 или SEQ ID NO: 43, или

(ii) кодируемый внутриклеточный сигнальный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 16 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 43, или аминокислотную последовательность, имеющую 95% идентичности с аминокислотной последовательностью SEQ ID NO: 16 и/или аминокислотной последовательностью SEQ ID NO: 17 или SEQ ID NO: 43.

24. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой кодируемый внутриклеточный сигнальный домен содержит аминокислотную последовательность SEQ ID NO: 16 и аминокислотную последовательность SEQ ID NO: 17 или SEQ ID NO: 43, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессированы в одной и той же рамке считывания и в виде одной полипептидной цепи.

25. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, в которой последовательность нуклеиновой кислоты, кодирующая внутриклеточный сигнальный домен, содержит последовательность нуклеиновой кислоты SEQ ID NO: 60 или последовательность нуклеиновой кислоты, имеющую по меньшей мере 95% идентичности с ней, и/или последовательность нуклеиновой кислоты SEQ ID NO: 101 или SEQ ID NO: 44 или последовательность нуклеиновой кислоты, имеющую по меньшей мере 95% идентичности с ними.

26. Выделенная молекула нуклеиновой кислоты по любому из пп. 1-7, дополнительно содержащая лидерную последовательность.

27. Выделенная молекула нуклеиновой кислоты по п. 26, в которой лидерная последовательность кодирует аминокислотную последовательность SEQ ID NO: 13.

28. Выделенная молекула химерного антигенного рецептора (CAR), содержащая: (i) гуманизированный анти-CD19-связывающий домен, (ii) трансмембранный домен и (iii) внутриклеточный сигнальный домен,

где гуманизированный анти-CD19-связывающий домен содержит:

определяющую комплементарность область 1 легкой цепи (LC CDR1), содержащую аминокислотную последовательность SEQ ID NO: 25,

определяющую комплементарность область 2 легкой цепи (LC CDR2), содержащую аминокислотную последовательность SEQ ID NO: 26,

определяющую комплементарность область 3 легкой цепи (LC CDR3), содержащую аминокислотную последовательность SEQ ID NO: 27,

определяющую комплементарность область 1 тяжелой цепи (HC CDR1), содержащую аминокислотную последовательность SEQ ID NO: 19,

определяющую комплементарность область 2 тяжелой цепи (HC CDR2), содержащую любую аминокислотную последовательность из SEQ ID NO: 22, 21 или 23, и

определяющую комплементарность область 3 тяжелой цепи (HC CDR3) содержащую аминокислотную последовательность SEQ ID NO: 24.

29. Выделенная молекула CAR по п. 28, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 21.

30. Выделенная молекула CAR по п. 28, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 22.

31. Выделенная молекула CAR по п. 28, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 23.

32. Выделенная молекула CAR по любому из пп. 28-31, в которой анти-CD19-связывающий домен представляет собой scFv.

33. Выделенная молекула CAR по любому из пп. 28-32, в которой анти-CD19-связывающий домен содержит вариабельную область легкой цепи и вариабельную область тяжелой цепи, любую из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

34. Выделенная молекула CAR по любому из пп. 28-33, в которой анти-CD19-связывающий домен содержит:

(i) любую вариабельную область легкой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12,

(ii) вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности любой вариабельной области легкой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или

(iii) последовательность, имеющую по меньшей мере 95% с любой вариабельной областью легкой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

35. Выделенная молекула CAR по любому из пп. 28-34, в которой анти-CD19-связывающий домен содержит:

(i) любую вариабельную область тяжелой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12,

(ii) вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности любой вариабельной области тяжелой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или

(iii) последовательность с по меньшей мере 95% идентичности с любой вариабельной областью тяжелой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

36. Выделенная молекула CAR по любому из пп. 28-35, в которой анти-CD19-связывающий домен содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или аминокислотную последовательность с по меньшей мере 95% идентичности с ними.

37. Выделенная молекула CAR по любому из пп. 28-36, дополнительно содержащая трансмембранный домен белка, выбранного из группы, состоящей из альфа-, бета- или дзета-цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154.

38. Выделенная молекула CAR по п. 37, в которой трансмембранный домен содержит:

(i) аминокислотную последовательность SEQ ID NO: 15,

(ii) аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 15, или

(iii) аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с аминокислотной последовательностью SEQ ID NO: 15.

39. Выделенная молекула CAR по любому из пп. 28-38, в которой гуманизированный анти-CD19-связывающий домен связан с трансмембранным доменом с помощью шарнирной области.

40. Выделенная молекула CAR по п. 39, в которой кодируемая шарнирная область содержит аминокислотную последовательность SEQ ID NO: 14 или SEQ ID NO: 102 или аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с ними.

41. Выделенная молекула CAR по любому из пп. 28-40, где внутриклеточный сигнальный домен содержит костимулирующий домен.

42. Выделенная молекула CAR по п. 41, в которой костимулирующий домен представляет собой функциональный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137).

43. Выделенная молекула CAR по п. 41, в которой костимулирующий домен содержит:

(i) аминокислотную последовательность SEQ ID NO: 16,

(ii) костимулирующий домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 16, или

(iii) аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с аминокислотной последовательностью SEQ ID NO: 16.

44. Выделенная молекула CAR по любому из пп. 28-43, где внутриклеточный сигнальный домен содержит основной сигнальный домен.

45. Выделенная молекула CAR по любому из пп. 28-43, в которой внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и/или функциональный сигнальный домен CD3-дзета.

46. Выделенная молекула CAR по любому из пп. 28-40, в которой внутриклеточный сигнальный домен содержит:

(i) аминокислотную последовательность SEQ ID NO: 16 и/или аминокислотную последовательность SEQ ID NO: 17,

(ii) аминокислотную последовательность SEQ ID NO: 16 и/или аминокислотную последовательность SEQ ID NO: 43,

(iii) аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 16 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 43, или

(iv) аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с аминокислотной последовательностью SEQ ID NO: 16 и/или аминокислотной последовательностью SEQ ID NO: 17 или SEQ ID NO: 43.

47. Выделенная молекула CAR по любому из пп. 28-40, в которой внутриклеточный сигнальный домен содержит аминокислотную последовательность SEQ ID NO: 16 и аминокислотную последовательность SEQ ID NO: 17 или SEQ ID NO: 43, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессированы в одной и той же рамке считывания и в виде одной полипептидной цепи.

48. Выделенная молекула CAR по любому из пп. 28-47, дополнительно содержащая лидерную последовательность.

49. Выделенная молекула CAR по п. 48, в которой лидерная последовательность содержит аминокислотную последовательность SEQ ID NO: 13 или аминокислотная последовательность, имеющую по меньшей мере 95% идентичности с аминокислотной последовательностью SEQ ID NO: 13.

50. Выделенная молекула CAR по любому из пп. 28-49, содержащая аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 и SEQ ID NO: 42.

51. Гуманизированный анти-CD19-связывающий домен, содержащий:

определяющую комплементарность область 1 легкой цепи (LC CDR1), содержащую аминокислотную последовательность SEQ ID NO: 25,

определяющую комплементарность область 2 легкой цепи (LC CDR2), содержащую аминокислотную последовательность SEQ ID NO: 26,

определяющую комплементарность область 3 легкой цепи (LC CDR3), содержащую аминокислотную последовательность SEQ ID NO: 27,

определяющую комплементарность область 1 тяжелой цепи (HC CDR1), содержащую аминокислотную последовательность SEQ ID NO: 19,

определяющую комплементарность область 2 тяжелой цепи (HC CDR2), содержащую любую аминокислотную последовательность из SEQ ID NO: 22, 21 или 23, и

определяющую комплементарность область 3 тяжелой цепи (HC CDR3) содержащую аминокислотную последовательность SEQ ID NO: 24.

52. Гуманизированный анти-CD19-связывающий домен по п. 51, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 21.

53. Гуманизированный анти-CD19-связывающий домен по п. 51, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 22.

54. Гуманизированный анти-CD19-связывающий домен по п. 51, где HC CDR2 содержит аминокислотную последовательность SEQ ID NO: 23.

55. Гуманизированный анти-CD19-связывающий домен по любому из пп. 51-54, содержащий:

(i) scFv, содержащий вариабельную область легкой цепи и вариабельную область тяжелой цепи, любую из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 или SEQ ID NO: 12, или

(ii) вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности вариабельной области легкой цепи, любой из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с любой вариабельной областью легкой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности любой вариабельной области тяжелой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или аминокислотную последовательность, имеющую по меньшей мере 95% идентичности с любой вариабельной областью тяжелой цепи из SEQ ID NO: 2, SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

56. Вектор, содержащий молекулу нуклеиновой кислоты, кодирующую молекулу CAR по любому из пп. 28-50.

57. Вектор по п. 56, выбранный из группы, состоящей из ДНК, РНК, плазмиды, лентивирусного вектора, аденовирусного вектора или ретровирусного вектора.

58. Вектор по п. 56 или 57, дополнительно содержащий промотор.

59. Вектор по п. 58, в котором промотор представляет собой промотор EF-1.

60. Вектор по п. 59, в котором промотор EF-1 содержит последовательность нуклеиновой кислоты SEQ ID NO: 100.

61. Вектор по любому из пп. 56-60, представляющий собой in vitro транскрибируемый вектор.

62. Вектор по любому из пп. 56-61, в котором последовательность нуклеиновой кислоты дополнительно содержит поли(A)-последовательность.

63. Вектор по любому из пп. 56-62, в котором последовательность нуклеиновой кислоты дополнительно содержит 3'UTR.

64. Клетка, продуцирующая молекулу CAR по любому из пп. 28-50, содержащая вектор по любому из пп. 56-63.

65. Клетка, продуцирующая молекулу CAR по любому из пп. 28-50, содержащая молекулу нуклеиновой кислоты по любому из пп. 1-27.

66. Клетка для лечения млекопитающего, страдающего пролиферативным заболеванием, ассоциированным с экспрессией CD19, содержащая молекулу CAR по любому из пп. 28-50.

67. Клетка по любому из пп. 64-66, представляющая собой человеческую T-клетку.

68. Клетка по п. 67, представляющая собой CD8+ T-клетку.

69. Способ получения клетки, включающий трансдуцирование T-клетки вектором по любому из пп. 56-63 или молекулой нуклеиновой кислоты по любому из пп. 1-27.

70. Способ получения популяции клеток с генетически измененной РНК, включающий введение in vitro транскрибированной РНК или синтетической РНК в клетку, при этом РНК содержит нуклеиновую кислоту, кодирующую молекулу CAR по любому из пп. 28-50.

71. Способ создания противоопухолевого иммунитета у млекопитающего, включающий введение млекопитающему эффективного количества клетки, экспрессирующей молекулу CAR, по любому из пп. 28-50, где клетка является аутологичной клеткой.

72. Способ по п. 71, в котором клетка представляет собой аутологичную T-клетку.

73. Способ по п. 71 или 72, в котором млекопитающее является человеком.

74. Способ лечения млекопитающего, страдающего пролиферативным заболеванием, ассоциированным с экспрессией CD19, включающий введение млекопитающему эффективного количества клетки, содержащей молекулу CAR, по любому из пп. 28-50, где клетка является аутологичной клеткой.

75. Способ по п. 74, в котором пролиферативное заболевание представляет собой рак, или злокачественное заболевание, или предраковое состояние, такое как миелодисплазия, миелодиспластический синдром или предлейкоз.

76. Способ по п. 74 или 75, в котором пролиферативное заболевание представляет собой рак крови, выбранный из группы, состоящей из одной или более форм острого лейкоза, включая, но не ограничиваясь ими, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одной или более форм хронического лейкоза, включая, но не ограничиваясь ими, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL); других форм рака крови или патологических состояний крови, включая, но не ограничиваясь ими, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, при которых экспрессируется CD19; а также их сочетания.

77. Способ по любому из пп. 74-76, в котором клетку, содержащую молекулу CAR, вводят в сочетании с:

(i) агентом, который повышает эффективность клетки, содержащей молекулу CAR,

(ii) агентом, который ослабляет один или более побочных эффектов, связанных с введением клетки, содержащей молекулу CAR, или

(iii) агентом, который лечит пролиферативное заболевание.

78. Клетка по п. 64, дополнительно экспрессирующая ингибирующую молекулу, которая содержит первый полипептид, содержащий по меньшей мере часть ингибирующей молекулы, связанный со вторым полипептидом, который обеспечивает положительный сигнал от внутриклеточного сигнального домена.

79. Клетка по п. 78, в которой ингибирующая молекула содержит первый полипептид, содержащий по меньшей мере часть PD1, и второй полипептид, содержащий костимулирующий домен и основной сигнальный домен.

80. Выделенная молекула нуклеиновой кислоты, кодирующая CAR, где CAR содержит:

scFv, который содержит гуманизированный анти-CD19-связывающий домен, где указанный анти-CD19-связывающий домен содержит LC CDR1 с SEQ ID NO: 25, LC CDR2 с SEQ ID NO: 26, LC CDR3 с SEQ ID NO: 27, HC CDR1 с SEQ ID NO: 19, HC CDR2 с SEQ ID NO: 21, 22 или 23 и HC CDR3 с SEQ ID NO: 24,

трансмембранный домен,

основной внутриклеточный сигнальный домен, содержащий нативный внутриклеточный сигнальный домен CD3-дзета или FcR-гамма или его функциональный фрагмент, и

костимулирующий домен, содержащий нативный внутриклеточный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD27, CD28, ICOS и 4-1BB, или его функциональный фрагмент.

81. Выделенная молекула нуклеиновой кислоты, кодирующая CAR, где CAR содержит:

гуманизированный анти-CD19-связывающий домен, содержащий аминокислотную последовательность SEQ ID NO: 2,

трансмембранный домен,

основной внутриклеточный сигнальный домен, содержащий нативный внутриклеточный сигнальный домен CD3-дзета или FcR-гамма или его функциональный фрагмент, и

костимулирующий домен, содержащий нативный внутриклеточный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD27, CD28, ICOS и 4-1BB, или его функциональный фрагмент.

82. Выделенная молекула нуклеиновой кислоты, кодирующая CAR, где CAR содержит, от N-конца к C-концу:

гуманизированный анти-CD19-связывающий домен, содержащий аминокислотную последовательность SEQ ID NO: 2,

трансмембранный домен, содержащий аминокислотную последовательность SEQ ID NO: 15,

костимулирующий домен, содержащий аминокислотную последовательность SEQ ID NO: 16, и

основной внутриклеточный сигнальный домен, содержащий аминокислотную последовательность SEQ ID NO: 17.

83. Выделенная молекула нуклеиновой кислоты, кодирующая CAR, содержащая последовательность нуклеиновой кислоты SEQ ID NO: 86.



 

Похожие патенты:

Настоящее изобретение относится к области иммунологии. Предложены антитело и его антигенсвязывающий фрагмент, способные к специфическому связыванию с участком бета цепи семейства TRBV9 Т-клеточного рецептора человека.

Группа изобретений относится к иммунологии, в частности к антителам и их антиген-связывающим фрагментам, специфически связывающимся с PD-1, а также к способам применения таких антител и антиген-связывающих фрагментов, в частности, для лечения рака и инфекционного заболевания, ассоциированных с экспрессией PD-1.

Настоящее изобретение относится к биотехнологии. Предложены антитела и их антиген-связывающие фрагменты против ИЛ-1-бета.

Изобретение относится к области биотехнологии, конкретно к химерным антигенным рецепторам, нацеленным на CD123 (CD123CAR), и может быть использовано в медицине для лечения острого миелоидного лейкоза (AML).

Изобретение относится к области биотехнологии, конкретно к получению выделенной клетки млекопитающего, подходящей для рекомбинантной экспрессии интересующего полипептида, где клетку млекопитающего изменяют для ухудшения функции эндогенной протеазы матриптазы посредством нокаута, мутации, делеции или сайленсинга гена матриптазы.

Настоящее изобретение относится к биотехнологии. Предложено антитело против пресепсина, а также антигенсвязывающий фрагмент антитела, полинуклеотид, экспрессирующий вектор, трансформированный штамм, способы получения антитела и его антигенсвязывающего фрагмента.

Изобретение относится к биотехнологии. Описан вектор экспрессии фактора VIII (FVIII) на основе аденоассоциированного вируса (ААВ), содержащий нуклеиновую кислоту, содержащую 5’-инвертированный концевой повтор (ITR) ААВ2, специфическую для печени область регуляции транскрипции, кодон-оптимизированную область, кодирующую функционально активный FVIII, возможно один или более интронов, последовательность полиаденилирования и 3’-ITR ААВ2, причем область, кодирующая функционально активный FVIII, включает нуклеотиды 923-5296 последовательности SEQ ID NO: 9 и причем вектор имеет длину менее 5000 нуклеотидов.

Настоящее изобретение относится к иммунологии. Предложены варианты человеческого нейтрализующего моноклонального антитела против IL-33, а также молекула кодирующей нуклеиновой кислоты, вектор, клетка-хозяин и способ получения упомянутых вариантов антитела.

Изобретение относится к биохимии. Описано выделенное антитело или его антигенсвязывающий фрагмент для доставки цитотоксина, содержащие домен CH1 IgG, где домен CH1 IgG содержит остаток аспарагина в положении аминокислоты 114 в соответствии с нумерацией Kabat, где боковая цепь указанного остатка аспарагина связана с гликаном.

Настоящее изобретение относится к иммунологии. Предложен связывающий домен против EGFRvIII, содержащий его химерный антигенный рецептор, кодирующие нуклеиновые кислоты, вектор, клетка, а также применения указанных изобретений в производстве лекарственного средства, способы создания клетки и получения популяции клеток, способ обеспечения иммунитета, способ лечения.

Группа изобретений относится к области биотехнологии. Предложен устройство и способ самоотбора относительно высокоподвижных морфологически нормальных сперматозоидов с высокой целостностью ДНК из неочищенной или необработанной семенной жидкости.

Изобретение относится к области биотехнологии, а именно к увеличению количества плюрипотентных клеток в популяции неэмбриональных дифференцированных соматических клеток и восстановлению нервной функции у субъекта с неврологическим повреждением.

Изобретение относится к области биохимии, в частности к способу модификации целевого геномного локуса на Y-хромосоме в мышиной эмбриональной стволовой клетке (ЭС). При этом способ предусматривает: обеспечение мышиной ЭС клетки, содержащей целевой геномный локус на Y-хромосоме, причем целевой геномный локус содержит сайт распознавания для нуклеазного агента, и где мышиная ЭС клетка находится в культуре, содержащей основную среду DMEM, введение в мышиную ЭС клетку нуклеазного агента или полинуклеотида, кодирующего нуклеазный агент, причем нуклеазный агент индуцирует одно- или двухцепочечный разрыв на сайте распознавания, и большого нацеливающего вектора, содержащего полинуклеотидную вставку, и идентификацию по меньшей мере одной мышиной ЭС клетки, содержащей в своем геноме полинуклеотидную вставку, интегрированную в целевой геномный локус.

Изобретение относится к биохимии. Описано применение in vitro модифицированных лимфоцитов, содержащих вектор для регулируемой экспрессии белка, обладающего функцией интерлейкина-12 (IL-12) для лечения опухоли у млекопитающего, причем указанный вектор содержит полинуклеотид, кодирующий переключатель гена, где указанный генный переключатель содержит: (a) по меньшей мере одну последовательность транскрипционного фактора, причем указанная по меньшей мере одна последовательность транскрипционного фактора кодирует лиганд-зависимый транскрипционный фактор, функционально связанный с промотором; и (b) полинуклеотид, кодирующий белок, обладающий функцией IL-12, связанный с промотором, который активируется указанным лиганд-зависимым транскрипционным фактором; причем указанный полинуклеотид, кодирующий указанный белок, обладающий функцией IL-12, кодирует белок, который по меньшей мере на 85% идентичен человеческому IL-12 дикого типа, и при этом указанный лиганд вводят в эффективном количестве через или менее чем через 24 часа после внутриопухолевой доставки эффективного количества указанных лимфоцитов.

Группа изобретений относится к иммунологии, в частности к антителам и их антиген-связывающим фрагментам, специфически связывающимся с PD-1, а также к способам применения таких антител и антиген-связывающих фрагментов, в частности, для лечения рака и инфекционного заболевания, ассоциированных с экспрессией PD-1.

Изобретение относится к области биотехнологии, конкретно к химерным антигенным рецепторам, нацеленным на CD123 (CD123CAR), и может быть использовано в медицине для лечения острого миелоидного лейкоза (AML).

Изобретение относится к области биотехнологии, а именно к клеточным технологиям, может также быть использовано в медицине и ветеринарии. Предложен способ модификации пролиферативной активности клеточных культур млекопитающих с применением D-аспарагина.

Изобретение относится к способу получения полоксамера для применения в клеточной культуральной среде. Твердый полоксамер нагревают до 60-185°C до образования жидкого полоксамера.
Изобретение относится к медицине, а именно к биотехнологии, и может быть использовано для получения и концентрирования микроРНК-содержащих экзосом мультипотентных мезенхимально-стромальных клеток.

Изобретение относится к медицине и может быть использовано для получения и культивирования фибробластоподобных клеток из пуповины новорожденного. Для этого проводят забор пуповины у здоровых женщин после рождения ребенка путем кесарева сечения.

Изобретение относится к области биотехнологии, а именно к увеличению количества плюрипотентных клеток в популяции неэмбриональных дифференцированных соматических клеток и восстановлению нервной функции у субъекта с неврологическим повреждением.

Настоящее изобретение относится к области иммунологии. Предложены выделенная молекула нуклеиновой кислоты, кодирующая анти-CD19 химерный антигенный рецептор, выделенная молекула анти-CD19 химерный антигенный рецептор, а также гуманизированный анти-CD19-связывающий домен. Кроме того, рассмотрен вектор, клетки, способ получения клетки, способ получения популяции клеток, способ создания противоопухолевого иммунитета и способ лечения. Также описаны выделенные молекулы нуклеиновой кислоты, кодирующие анти-CD19 CAR. Данное изобретение может найти дальнейшее применение в терапии различных пролиферативных заболеваний, ассоциированных с экспрессией CD19, в частности рака. 15 н. и 68 з.п. ф-лы, 12 ил., 6 табл., 6 пр.

Наверх