Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii



Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
Лечение рака с использованием химерного антигенспецифического рецептора на основе гуманизированного антитела против egfrviii
C07K2317/55 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2708032:

ДЗЕ ТРАСТИЗ ОФ ДЗЕ ЮНИВЕРСИТИ ОФ ПЕНСИЛЬВАНИЯ (US)
ЮНИВЕРСИТИ ОФ ПИТТСБУРГ ОФ ДЗЕ КОММОНВЕЛТ СИСТЕМ ОФ ХАЙЕР ЭДЬЮКЕЙШН (US)
НОВАРТИС АГ (CH)

Настоящее изобретение относится к иммунологии. Предложен связывающий домен против EGFRvIII, содержащий его химерный антигенный рецептор, кодирующие нуклеиновые кислоты, вектор, клетка, а также применения указанных изобретений в производстве лекарственного средства, способы создания клетки и получения популяции клеток, способ обеспечения иммунитета, способ лечения. Данное изобретение может найти дальнейшее применение в терапии с использованием адоптивного переноса клеток. 22 н. и 81 з.п. ф-лы, 18 ил., 9 пр., 2 табл.

 

Эта заявка притязает на приоритет заявки на патент США с серийным № 61/888255, поданной 8 октября 2013 г., и заявки на патент США с серийным № 61/767071, поданной 20 февраля 2013 г., полное содержание каждой из которых включено сюда посредством ссылки.

ЗАЯВЛЕНИЕ О СПОНСИРУЕМОМ ПРАВИТЕЛЬСТВОМ ИССЛЕДОВАНИИ ИЛИ РАЗРАБОТКЕ

Это изобретение было сделано при поддержке правительства по 2R01 NS055140 и 1P01 CA 1322714, присужденных Национальным институтом здравоохранения (NIH). Правительство имеет определенные права на это изобретение.

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Настоящая заявка содержит список последовательностей, который был представлен в электронном виде в формате ASCII и, таким образом, включен посредством ссылки в его полном объеме. Указанная копия ASCII, созданная 20 февраля 2014 г., названа N2067-7000WO_SL.txt и имеет размер, равный 228605 байтам.

УРОВЕНЬ ТЕХНИКИ

Настоящее изобретение относится в целом к применению T-клеток, созданных так, что они экспрессируют химерный антигенспецифический рецептор (CAR), для лечения заболевания, связанного с экспрессией рецептора III эпидермального фактора роста.

ПРЕДПОСЫЛКИ СОЗДАНИЯ ИЗОБРЕТЕНИЯ

Хотя центральная нервная система (ЦНС) часто считается иммунологически «неприкосновенной» (Okada et al., 2009, Crit Rev Immunol 29: 1-42), недавние исследования вакцины на пациентах со злокачественной глиомой продемонстрировали положительные результаты (Aguilar et al., 2012, Curr Treat Options Oncol 13: 437-450; Ruzevick, et al., 2012, Neurosurg Clin N Am 23: 459-470; 15; и Okada et al., 2011, J Clin Oncol 29: 330-336). Однако эффективность вакцины, которая опирается на активность неповрежденной иммунной системы хозяина, может страдать в результате системного подавления иммунитета вследствие экспрессии в опухоли иммуносупрессивных цитокинов, а также химиотерапии и лучевой терапии. С другой стороны, терапия с использованием адоптивного переноса клеток (АСТ) в виде аутологичных Т-клеток, особенно Т-клеток, трансдуцированных химерными антигенспецифическим рецепторами (CAR), раскрыла перспективы предварительных испытаний на раке системы крови (Kalos et al., 2011, Sci Transl Med 3(95):95ra73; и Porter et al., 2011, New England Journal of Medicine 365: 725-733.

Увеличенная экспрессия рецептора эпидермального фактора роста (EGFR) часто обнаруживается в ряде карцином, включая рак молочной железы, легких, головы и шеи, а также глиобластому. Спонтанные перестройки в гене рецептора EGF были впервые определены в первичных опухолях глиобластомах человека, и почти во всех случаях изменения были зарегистрированы в опухолях с увеличением EGFR. Три различных типа мутантов являются результатом этих перестроек. Самым распространенным из них является характеризующийся делецией мутантный рецептор EGF типа III (EGFRvIII), который характеризуется делецией экзонов 2-7 в мРНК EGFR. Эти делеции соответствуют нуклеотидам 275-1075 кДНК, которые кодируют аминокислоты 6-276, по-видимому, за счет альтернативного сплайсинга или перестроек. Делеция 801 п.о. в пределах экстраклеточного домена гена EGFR вызывает находящееся в рамке усечение нормального белка EGFR, приводящее к рецептору с М.м. 145 кДа, создавая тем самым специфический в отношении опухоли и иммуногенный эпитоп (рассматриваемый в Hatanpaa et al., 2010, Neoplasia 12: 675-684; Mukasa et al., 2010, Proc Natl Acad Sci USA 107: 2616-2621). Экспрессия EGFRvIII отмечалась во многих типах опухолей, в том числе мультиформной глиобластоме (GBM), но редко наблюдается в нормальной ткани. EGFRvIII экспрессируется в 24%-67% случаев GBM, и у пациентов, продолжающих жить ≥1 года, экспрессия EGFRvIII является независимым неблагоприятным прогностическим показателем (Heimberger et al., 2005, Clin. Cancer Res. 11: 1462-1466; Heimberger et al., 2005, J Transl. Med 3: 38).

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Настоящим изобретением обеспечиваются, среди прочего, структуры и способы для управления иммунным ответом у пациентов посредством обеспечения оптимизированных и/или гуманизированных антител или фрагментов антител (например, scFv), которые связывают рецептор III эпидермального фактора роста (EGFRvIII), включенных в конструкцию химерного антигенспецифического рецептора (CAR). В некоторых вариантах осуществления настоящее изобретение относится к применению Т-клеток, которые созданы так, что они экспрессируют антитело или фрагмент антитела, которое(ый) связывает EGFRvIII, например, гуманизированное антитело или фрагмент антитела, которое(ый) связывает EGFRvIII, включенное(ый) в CAR, для лечения рака, связанного с экспрессией EGFRvIII. В некоторых аспектах настоящее изобретение относится к адоптивному переносу клеток, который может быть особенно подходящим для пациентов с глиомой, поскольку гораздо лучше можно манипулировать и контролировать специфичность(ю), количество(м) и функциональный(ым) фенотип(ом) клеток, полученных ex vivo, чем не подвергнутых стимуляции Т-клеток, индуцированных с помощью in vivo иммунизации.

Соответственно, в одном аспекте настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей химерный антигенспецифический рецептор (CAR), причем CAR включает антитело или фрагмент антитела, которое(ый) включает связывающий домен антитела против EGFRvIII (например, гуманизированное антитело или фрагмент антитела, которое(ый) специфически связывается с EGFRvIII), трансмембранный домен и внутриклеточный домен сигнализации (например, внутриклеточный домен сигнализации, включающий костимулирующий домен и/или домен первичной сигнализации). В одном варианте осуществления CAR включает антитело или фрагмент антитела, которое(ый) включает связывающий домен антитела против EGFRvIII, описанный здесь (например, гуманизированное антитело или фрагмент антитела, которое(ый) специфически связывается с EGFRvIII, как описано здесь), трансмембранный домен, описанный здесь, и внутриклеточный домен сигнализации, описанный здесь (например, внутриклеточный домен сигнализации, включающий костимулирующий домен и/или домен первичной сигнализации).

В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII включает один или более (например, все три) из определяющего комплементарность участка 1 легкой цепи (CDR1 LC), определяющего комплементарность участка 2 легкой цепи (CDR2 LC) и определяющего комплементарность участка 3 легкой цепи (CDR3 LC) связывающего домена антитела против EGFRvIII, описанного здесь, и один или более (например, все три) из определяющего комплементарность участка 1 тяжелой цепи (CDR1 НС), определяющего комплементарность участка 2 тяжелой цепи (CDR2 НС) и определяющего комплементарность участка 3 тяжелой цепи (CDR3 НС) связывающего домена антитела против EGFRvIII, описанного здесь, например, связывающего домена гуманизированного антитела против EGFRvIII, включающего один или более, например, все три, CDR LC и один или более, например, все три, CDR HC. В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII включает вариабельную область легкой цепи, описанную здесь (например, в таблице 2 или SEQ ID NO: 11) и/или вариабельную область тяжелой цепи, описанную здесь (например, в таблице 2 или SEQ ID NO: 11). В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII представляет собой scFv, включающий легкую цепь и тяжелую цепь аминокислотной последовательности из таблицы 2 или SEQ ID NO: 11. В одном варианте осуществления связывающий домен антитела против EGFRvIII (например, scFv) включает: вариабельную область легкой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области легкой цепи, приведенной в таблице 2 или SEQ ID NO: 11, или последовательность, идентичную на 95-99% аминокислотной последовательности, приведенной в таблице 2 или SEQ ID NO: 11; и/или вариабельную область тяжелой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в таблице 2 или SEQ ID NO: 11, или последовательность, идентичную на 95-99% аминокислотной последовательности, приведенной в таблице 2 или SEQ ID NO: 11. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая связывающий домен антитела против EGFRvIII, включает последовательность SEQ ID NO: 68. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая связывающий домен антитела против EGFRvIII, включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 39, SEQ ID NO: 45, SEQ ID NO: 51, SEQ ID NO: 57, SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 75, SEQ ID NO: 81 и SEQ ID NO: 98, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII представляет собой scFv, и вариабельная область легкой цепи, включающая аминокислотную последовательность, описанную здесь, например, в таблице 2 или SEQ ID NO: 11, присоединена к вариабельной области тяжелой цепи, включающей аминокислотную последовательность, описанную здесь, например, в таблице 2 или SEQ ID NO: 11, через линкер, например, линкер, описанный здесь. В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII включает линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 4 (SEQ ID NO: 110). Вариабельная область легкой цепи и вариабельная область тяжелой цепи scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном варианте осуществления кодируемый CAR включает трансмембранный домен, который включает трансмембранный домен белка, выбираемого из группы, состоящей из альфа, бета или дзета-цепи T-клеточного рецептора, CD28, CD3 эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154. В одном варианте осуществления кодируемый трансмембранный домен включает последовательность SEQ ID NO: 15. В одном варианте осуществления кодируемый трансмембранный домен включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 20, 10 или 5 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 15, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 15. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая трансмембранный домен, включает последовательность SEQ ID NO: 8 или последовательность, идентичную ей на 95-99%.

В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII соединен с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной здесь. В одном варианте осуществления кодируемая шарнирная область включает SEQ ID NO: 14 или SEQ ID NO: 104 или SEQ ID NO: 106 или SEQ ID NO: 108, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая шарнирную область, включает последовательность SEQ ID NO: 7 или SEQ ID NO: 105, или SEQ ID NO: 107, или SEQ ID NO: 109, или последовательность, идентичную ей на 95-99%.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кроме того, включает последовательность, кодирующую костимулирующий домен, например, костимулирующий домен, описанный здесь. В одном варианте осуществления кодируемый костимулирующий домен включает функциональный домен сигнализации белка, выбираемого из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11а/CD18), ICOS (CD278) и 4-1ВВ (CD137). В одном варианте осуществления кодируемый костимулирующий домен включает последовательность SEQ ID NO: 16. В одном варианте осуществления кодируемый костимулирующий домен включает последовательность SEQ ID NO: 102. В одном варианте осуществления кодируемый костимулирующий домен включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 20, 10 или 5 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 102, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 102. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая костимулирующий домен, включает последовательность SEQ ID NO: 9, или последовательность, идентичную ей на 95-99%.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кроме того, включает последовательность, кодирующую внутриклеточный домен сигнализации, например, внутриклеточный домен сигнализации, описанный здесь. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает функциональный домен сигнализации 4-1BB и/или функциональный домен сигнализации CD3 дзета. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает функциональный домен сигнализации CD27 и/или функциональный домен сигнализации CD3 дзета. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 или SEQ ID NO: 102, и/или последовательность SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления внутриклеточный домен сигнализации включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 20, 10 или 5 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 16 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 102 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 или SEQ ID NO: 102 и последовательность SEQ ID NO: 17 или SEQ ID NO: 99, причем последовательности, включающие внутриклеточный домен сигнализации, экспрессируются в одной и той же рамке и в виде одной полипептидной цепи. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая внутриклеточный домен сигнализации, включает последовательность SEQ ID NO: 9 или SEQ ID NO: 103, или последовательность, идентичную ей на 95-99%, и/или последовательность SEQ ID NO: 10 или SEQ ID NO: 100, или последовательность, идентичную ей на 95-99%.

В другом аспекте настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей конструкцию CAR, включающую лидерную последовательность, например, лидерную последовательность, описанную здесь, например, SEQ ID NO: 13, связывающий домен антитела против EGFRvIII, описанный здесь, например, связывающий домен антитела против EGFRvIII, включающий CDR1 LC, CDR2 LC, CDR3 LC, CDR1 HC, CDR2 HC и CDR3 HC, описанный здесь, например, связывающий домен антитела против EGFRvIII, описанный в таблице 2 или SEQ ID NO: 11, или последовательности, идентичной ей на 95-99%, шарнирную область описанную здесь, например, SEQ ID NO: 14 или SEQ ID NO: 104 или SEQ ID NO: 106 или SEQ ID NO: 108, трансмембранный домен, описанный здесь, например, имеющий последовательность SEQ ID NO: 15, и внутриклеточный домен сигнализации, например, внутриклеточный домен сигнализации, описанный здесь. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает костимулирующий домен, например, костимулирующий домен, описанный здесь, например, костимулирующий домен 4-1ВВ, имеющий последовательность SEQ ID NO: 16, и/или домен первичной сигнализации, например, домен первичной сигнализации, описанный здесь, например, стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает костимулирующий домен, например, костимулирующий домен, описанный здесь, например, костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 102, и/или домен первичной сигнализации, например, домен первичной сигнализации, описанный здесь, например, стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает костимулирующий домен, например, костимулирующий домен, описанный здесь, например, костимулирующий домен 4-1ВВ, имеющий последовательность SEQ ID NO: 16, и домен первичной сигнализации, например, домен первичной сигнализации, описанный здесь, например, стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления кодируемый внутриклеточный домен сигнализации включает костимулирующий домен, например, костимулирующий домен, описанный здесь, например, костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 102, и домен первичной сигнализации, например, домен первичной сигнализации, описанный здесь, например, стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, включает лидерную последовательность, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 6, или последовательностью, идентичной ей на 95-99%. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, включает последовательность связывающего домена антитела против EGFR, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 39, SEQ ID NO: 45, SEQ ID NO: 51, SEQ ID NO: 57, SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 75, SEQ ID NO: 81 или SEQ ID NO: 98, или последовательностью, идентичной ей на 95-99%. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, включает последовательность связывающего домена антитела против EGFR, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 69, или последовательностью, идентичной ей на 95-99%. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, включает последовательность связывающего домена антитела против EGFR, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 4, или последовательностью, идентичной ей на 95-99%. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, включает трансмембранную последовательность, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 8, или последовательностью, идентичной ей на 95-99%. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, включает последовательность внутриклеточного домена сигнализации, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 9 или последовательностью, идентичной ей на 95-99%, и/или последовательностью нуклеиновой кислоты SEQ ID NO: 10, или последовательностью, идентичной ей на 95-99%.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты включает (например, состоит из) нуклеиновую кислоту, кодирующую аминокислотную последовательность CAR - SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 или SEQ ID NO: 90, или аминокислотную последовательность, имеющую по крайней мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более 60, 50 или 40 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 или SEQ ID NO: 90, или аминокислотную последовательность, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 или SEQ ID NO: 90. В одном варианте осуществления выделенная молекула нуклеиновой кислоты включает (например, состоит из) нуклеиновую кислоту, кодирующую аминокислотную последовательность CAR - SEQ ID NO: 1 или SEQ ID NO: 2, или аминокислотную последовательность, имеющую крайней мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более 60, 50 или 40 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 1 или SEQ ID NO: 2, или аминокислотную последовательность, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 1 или SEQ ID NO: 2.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты включает (например, состоит из) последовательность нуклеиновой кислоты SEQ ID NO: 42, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 72, SEQ ID NO: 78, SEQ ID NO: 84 или SEQ ID NO: 89, или последовательность нуклеиновой кислоты, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% последовательности нуклеиновой кислоты SEQ ID NO: 42, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 72, SEQ ID NO: 78, SEQ ID NO: 84 или SEQ ID NO: 89. В одном варианте осуществления выделенная молекула нуклеиновой кислоты включает (например, состоит из) последовательность нуклеиновой кислоты SEQ ID NO: 18 или SEQ ID NO: 19, или последовательность нуклеиновой кислоты, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% последовательности нуклеиновой кислоты SEQ ID NO: 18 или SEQ ID NO: 19.

В одном аспекте настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей связывающий домен антитела против EGFRvIII, причем связывающий домен антитела против EGFRvIII включает один или более (например, все три) из определяющего комплементарность участка 1 легкой цепи (CDR1 LC), определяющего комплементарность участка 2 легкой цепи (CDR2 LC) и определяющего комплементарность участка 3 легкой цепи (CDR3 LC) связывающего домена антитела против EGFRvIII описанного здесь, и один или более (например, все три) из определяющего комплементарность участка 1 тяжелой цепи (CDR1 НС), определяющего комплементарность участка 2 тяжелой цепи (CDR2 НС) и определяющего комплементарность участка 3 тяжелой цепи (CDR3 НС) связывающего домена антитела против EGFRvIII, описанного здесь, например, связывающего домена гуманизированного антитела против EGFRvIII, включающего один или более, например, все три, CDR LC и один или более, например, все три, CDR НС. В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII включает вариабельную область легкой цепи, описанную здесь (например, в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80) и/или вариабельную область тяжелой цепи, описанную здесь (например, в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80). В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII представляет собой scFv, включающий легкую цепь и тяжелую цепь аминокислотной последовательности в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80. В варианте осуществления связывающий домен антитела против EGFRvIII (например, scFv) включает: вариабельную область легкой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области легкой цепи, представленной в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80; и/или вариабельную область тяжелой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области тяжелой цепи, представленной в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80, или последовательность, идентичную на 95-99% аминокислотной последовательности, представленной в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая связывающий домен антитела против EGFRvIII, включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 39, SEQ ID NO: 45, SEQ ID NO: 51, SEQ ID NO: 57, SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 75, SEQ ID NO: 81 и SEQ ID NO: 98, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления кодируемым связывающим доменом антитела против EGFRvIII является scFv, и вариабельная область легкой цепи, включающая аминокислотную последовательность, описанную здесь, например, в таблице 2, присоединена к вариабельной области тяжелой цепи, включающей аминокислотную последовательность, описанную здесь, например, в таблице 2, через линкер, например, линкер, описанный здесь. В одном варианте осуществления кодируемый связывающий домен антитела против EGFRvIII включает линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 4 (SEQ ID NO: 110). Вариабельная область легкой цепи и вариабельная область тяжелой цепи scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В другом аспекте настоящее изобретение относится к выделенной молекуле полипептида, кодируемой молекулой нуклеиновой кислоты. В одном варианте осуществления выделенная молекула полипептида включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 и SEQ ID NO: 90, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления выделенный полипептид включает последовательность SEQ ID NO: 73 или последовательность, идентичную ей на 95-99%. В одном варианте осуществления выделенный полипептид включает последовательность SEQ ID NO: 79 или последовательность, идентичную ей на 95-99%.

В другом аспекте настоящее изобретение относится к выделенной молекуле химерного антигенспецифического рецептора (CAR), включающей связывающий домен антитела против EGFRvIII (например, гуманизированное антитело или фрагмент антитела, которое(ый) специфически связывается с EGFRvIII), трансмембранный домен и внутриклеточный домен сигнализации (например, внутриклеточный домен сигнализации, включающий костимулирующий домен и/или домен первичной сигнализации). В одном варианте осуществления CAR включает антитело или фрагмент антитела, которое(ый) включает связывающий домен антитела против EGFRvIII, описанный здесь (например, гуманизированное антитело или фрагмент антитела, которое(ый) специфически связывается с EGFRvIII, как описано здесь), трансмембранный домен, описанный здесь, и внутриклеточный домен сигнализации, описанный здесь (например, внутриклеточный домен сигнализации, включающий костимулирующий домен и/или домен первичной сигнализации, описанный здесь).

В одном варианте осуществления связывающий домен антитела против EGFRvIII включает один или более (например, все три) из определяющего комплементарность участка 1 легкой цепи (CDR1 LC), определяющего комплементарность участка 2 легкой цепи (CDR2 LC) и определяющего комплементарность участка 3 легкой цепи (CDR3 LC) связывающего домена антитела против EGFRvIII, описанного здесь, и один или более (например, все три) из определяющего комплементарность участка 1 тяжелой цепи (CDR1 НС), определяющего комплементарность участка 2 тяжелой цепи (CDR2 НС) и определяющего комплементарность участка 3 тяжелой цепи (CDR3 НС) связывающего домена антитела против EGFRvIII, описанного здесь, например, связывающего домена гуманизированного антитела против EGFRvIII, включающего один или более, например, все три, CDR LC и один или более, например, все три, CDR НС. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает вариабельную область легкой цепи, описанную здесь (например, в таблице 2 или SEQ ID NO: 11), и/или вариабельную область тяжелой цепи, описанную здесь (например, в таблице 2 или SEQ ID NO: 11). В одном варианте осуществления связывающий домен антитела против EGFRvIII представляет собой scFv, включающий легкую цепь и тяжелую цепь аминокислотной последовательности, приведенной в таблице 2 или SEQ ID NO: 11. В одном варианте осуществления связывающий домен антитела против EGFRvIII (например, scFv) включает: вариабельную область легкой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области легкой цепи, представленной в таблице 2 или SEQ ID NO: 11, или последовательность, идентичную на 95-99% аминокислотной последовательности, представленной в таблице 2 или SEQ ID NO: 11; и/или вариабельную область тяжелой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области тяжелой цепи, представленной в таблице 2 или SEQ ID NO: 11, или последовательность, идентичную на 95-99% аминокислотной последовательности, представленной в таблице 2 или SEQ ID NO: 11. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления связывающий домен антитела против EGFRvIII представляет собой scFv, и вариабельная область легкой цепи, включающая аминокислотную последовательность, описанную здесь, например, в таблице 2 или SEQ ID NO: 11, присоединена к вариабельной области тяжелой цепи, включающей аминокислотную последовательность, описанную здесь, например, в таблице 2 или SEQ ID NO: 11, через линкер, например, линкер, описанный здесь. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 4 (SEQ ID NO: 110). Вариабельная область легкой цепи и вариабельная область тяжелой цепи scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном варианте осуществления выделенная молекула CAR включает трансмембранный домен белка, выбираемый из группы, состоящей из альфа, бета или дзета-цепи T-клеточного рецептора, CD28, CD3 эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD-134, CD-137 и CD154. В одном варианте осуществления трансмембранный домен включает последовательность SEQ ID NO: 15. В одном варианте осуществления трансмембранный домен включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 20, 10 или 5 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 15, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 15.

В одном варианте осуществления связывающий домен антитела против EGFRvIII соединен с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной здесь. В одном варианте осуществления кодируемая шарнирная область включает SEQ ID NO: 14 или SEQ ID NO: 104 или SEQ ID NO: 106 или SEQ ID NO: 108, или последовательность, идентичную ей на 95-99%.

В одном варианте осуществления выделенная молекула CAR, кроме того, включает последовательность, кодирующую костимулирующий домен, например, костимулирующий домен, описанный здесь. В одном варианте осуществления костимулирующий домен включает функциональный домен сигнализации белка, выбираемого из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11а/CD18), ICOS (CD278) и 4-1ВВ (CD137). В одном варианте осуществления костимулирующий домен включает последовательность SEQ ID NO: 16 или SEQ ID NO: 102. В одном варианте осуществления костимулирующий домен включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 20, 10 или 5 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 102, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 102. В одном варианте осуществления выделенная молекула CAR, кроме того, включает последовательность, кодирующую внутриклеточный домен сигнализации, например, внутриклеточный домен сигнализации, описанный здесь. В одном варианте осуществления внутриклеточный домен сигнализации включает функциональный домен сигнализации 4-1BB или CD27 и/или функциональной домен сигнализации CD3 дзета. В одном варианте осуществления внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 или SEQ ID NO: 102 и/или последовательность SEQ ID NO: 17. В одном варианте осуществления внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 или SEQ ID NO: 102 и/или последовательность SEQ ID NO: 99. В одном варианте осуществления внутриклеточный домен сигнализации включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 20, 10 или 5 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 102 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16 или последовательности SEQ ID NO: 102 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 или SEQ ID NO: 102 и последовательность SEQ ID NO: 17 или SEQ ID NO: 99, причем последовательности, включающие внутриклеточный домен сигнализации, экспрессируются в одной и той же рамке и в виде одной полипептидной цепи.

В одном варианте осуществления выделенная молекула CAR, кроме того, включает лидерную последовательность, например, лидерную последовательность, описанную здесь. В одном варианте осуществления лидерная последовательность включает аминокислотную последовательность SEQ ID NO: 13 или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 13.

В другом аспекте настоящее изобретение относится к выделенной молекуле CAR, включающей лидерную последовательность, например, лидерную последовательность, описанную здесь, например, лидерную последовательность с SEQ ID NO: 13 или с последовательностью, идентичной ей на 95-99%, связывающий домен антитела против EGFRvIII, описанный здесь, например, связывающий домен антитела против EGFRvIII, включающий CDR1 LC, CDR2 LC, CDR3 LC, CDR1 HC, CDR2 HC и CDR3 HC, описанный здесь, например, связывающий домен антитела против EGFRvIII, описанный в таблице 2 или SEQ ID NO: 11, или последовательности, идентичной ей на 95-99%, шарнирную область, например, шарнирную область, описанную здесь, например, шарнирную область с SEQ ID NO: 14 или SEQ ID NO: 104 или SEQ ID NO: 106 или SEQ ID NO: 108, или с 95-99% идентичностью ей, трансмембранный домен, например, трансмембранный домен, описанный здесь, например, трансмембранный домен, имеющий последовательность SEQ ID NO: 15 или последовательность, идентичную ей на 95-99%, внутриклеточный домен сигнализации, например, внутриклеточный домен сигнализации, описанный здесь (например, внутриклеточный домен сигнализации, включающий костимулирующий домен и/или домен первичной сигнализации). В одном варианте осуществления внутриклеточный домен сигнализации включает костимулирующий домен, например, костимулирующий домен, описанный здесь, например, костимулирующий домен 4-1ВВ, имеющий последовательность SEQ ID NO: 16, или костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 102, последовательность, идентичную ей на 95-99%, и/или домен первичной сигнализации, например, домен первичной сигнализации, описанный здесь, например, стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления внутриклеточный домен сигнализации включает костимулирующий домен, например, костимулирующий домен, описанный здесь, например, костимулирующий домен 4-1BB, имеющий последовательность SEQ ID NO: 16, или костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 102, и/или домен первичной сигнализации, например, домен первичной сигнализации, описанный здесь, например, стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99.

В одном варианте осуществления выделенная молекула CAR включает (например, состоит из) аминокислотную последовательность SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 или SEQ ID NO: 90, или аминокислотную последовательность, имеющую по крайней мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более 60, 50 или 40 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 или SEQ ID NO: 90, или аминокислотную последовательность, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 или SEQ ID NO: 90. В одном варианте осуществления выделенная молекула CAR включает (например, состоит из) аминокислотную последовательность SEQ ID NO: 1 или SEQ ID NO: 2, или аминокислотную последовательность, имеющую по крайней мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более 60, 50 или 40 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 1 или SEQ ID NO: 2, или аминокислотную последовательность, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 1 или SEQ ID NO: 2. В одном варианте осуществления выделенная молекула CAR включает (например, состоит из) аминокислотную последовательность SEQ ID NO: 73 или аминокислотную последовательность, имеющую по крайней мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более 60, 50 или 40 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 73, или аминокислотную последовательность, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 73. В одном варианте осуществления выделенная молекула CAR включает (например, состоит из) аминокислотную последовательность SEQ ID NO: 79 или аминокислотную последовательность, имеющую по крайней мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более 60, 50 или 40 модификаций (например, замен) аминокислотной последовательности SEQ ID NO: 79, или аминокислотную последовательность, идентичную на 85%, 90%, 95%, 96%, 97%, 98% или 99% аминокислотной последовательности SEQ ID NO: 79.

В одном аспекте настоящее изобретение относится к связывающему домену антитела против EGFRvIII, включающему один или более (например, все три) из определяющего комплементарность участка 1 легкой цепи (CDR1 LC), определяющего комплементарность участка 2 легкой цепи (CDR2 LC) и определяющего комплементарность участка 3 легкой цепи (CDR3 LC) связывающего домена антитела против EGFRvIII, описанного здесь, и один или более (например, все три) из определяющего комплементарность участка 1 тяжелой цепи (CDR1 НС), определяющего комплементарность участка 2 тяжелой цепи (CDR2 НС) и определяющего комплементарность участка 3 тяжелой цепи (CDR3 НС) связывающего домена антитела против EGFRvIII, описанного здесь, например, связывающего домена гуманизированного антитела против EGFRvIII, включающего один или более, например, все три, CDR LC и один или более, например, все три, CDR HC. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает вариабельную область легкой цепи, описанную здесь (например, в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80), и/или вариабельной области тяжелой цепи, описанную здесь (например, в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80). В одном варианте осуществления связывающий домен антитела против EGFRvIII представляет собой scFv, включающий легкую цепь и тяжелую цепь аминокислотной последовательности, представленной в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80. В одном варианте осуществления связывающий домен антитела против EGFRvIII (например, scFv) включает: вариабельную область легкой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области легкой цепи, представленной в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80; и/или вариабельную область тяжелой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области тяжелой цепи, представленной в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80, или последовательность, идентичную на 95-99% аминокислотной последовательности, представленной в SEQ ID NO: 38, 44, 50, 56, 62, 68, 74 или 80. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления связывающий домен антитела против EGFRvIII представляет собой scFv, и вариабельная область легкой цепи, включающая аминокислотную последовательность, описанную здесь, например, в таблице 2, присоединена к вариабельной области тяжелой цепи, включающей аминокислотную последовательность, описанную здесь, например, в таблице 2, через линкер, например, линкер, описанный здесь. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 4 (SEQ ID NO: 110). Вариабельная область легкой цепи и вариабельная область тяжелой цепи scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В другом аспекте настоящее изобретение относится к вектору, включающему молекулу нуклеиновой кислоты, описанную здесь, например, молекулу нуклеиновой кислоты, кодирующую CAR, описанный здесь. В одном варианте осуществления вектор выбирают из группы, состоящей из ДНК, РНК, плазмиды, лентивирусного вектора, аденовирусного вектора или ретровирусного вектора.

В одном варианте осуществления вектор представляет собой лентивирусный вектор. В одном варианте осуществления вектор, кроме того, включает промотор. В одном варианте осуществления промотором является промотор EF-1. В одном варианте осуществления промотор EF-1 включает последовательность SEQ ID NO: 97.

В одном варианте осуществления вектором является in vitro транскрибируемый вектор, например, вектор, который транскрибирует РНК с молекулы нуклеиновой кислоты, описанной здесь. В одном варианте осуществления последовательность нуклеиновой кислоты в векторе, кроме того, включает поли(А) хвост, например, поли(А) хвост, описанный здесь, например, включающий приблизительно 150 оснований аденозинов (SEQ ID NO: 111). В одном варианте осуществления последовательность нуклеиновой кислоты в векторе, кроме того, включает 3' UTR, например, 3' UTR, описанный здесь, например, включающий по крайней мере один повтор 3' UTR, происходящего из бета-глобулина человека.

В другом аспекте настоящее изобретение относится к клетке, включающей вектор, описанный здесь. В одном варианте осуществления клетка представляет собой клетку, описанную здесь, например, Т-клетку человека, например, Т-клетку человека, описанную здесь. В одном варианте осуществления Т-клеткой человека является CD8+ Т-клетка.

В другом аспекте настоящее изобретение относится к способу создания клетки, включающему трансдукцию клетки, описанной здесь, например, Т-клетки, описанной здесь, вектором, включающим нуклеиновую кислоту, кодирующую CAR, например, CAR, описанный здесь.

Настоящее изобретение также относится к способу получения популяции созданных с использованием РНК клеток, например, клеток, описанных здесь, например, Т-клеток, транзиторно экспрессирующих экзогенную РНК. Способ включает введение in vitro транскрибированной РНК или синтетической РНК в клетку, причем РНК включает нуклеиновую кислоту, кодирующую молекулу CAR, описанную здесь.

В другом аспекте настоящее изобретение относится к способу обеспечения иммунитета к опухоли у млекопитающего, включающему введение млекопитающему эффективного количества клетки, экспрессирующей молекулу CAR, например, клетки, экспрессирующей молекулу CAR, описанную здесь. В одном варианте осуществления клеткой является аутологичная Т-клетка. В одном варианте осуществления клеткой является аллогенная Т-клетка. В одном варианте осуществления млекопитающим является человек.

В другом аспекте настоящее изобретение относится к способу лечения млекопитающего, имеющего заболевание, связанное с экспрессией EGFRvIII (например, пролиферативного заболевания, предракового состояния и не относящегося к раку симптома, связанного с экспрессией EGFRvIII), включающему введение млекопитающему эффективного количества клеток, экспрессирующих молекулу CAR, например молекулу CAR, описанную здесь.

В одном варианте осуществления заболевание представляет собой заболевание, описанное здесь. В одном варианте осуществления заболеванием, связанным с EGFRvIII, является глиобластома. В одном варианте осуществления заболеванием, связанным с EGFRvIII, является рак, например, рак, выбираемый из группы, состоящей из мультиформной глиобластомы (GBM), анапластической астроцитомы, гигантоклеточной глиобластомы, глиосаркомы, анапластической олигодендроглиомы, анапластической эпендимомы, карциномы сосудистого сплетения, анапластической ганглиоглиомы, пинеобластомы, медуллоэпителиомы, эпендимобластомы, медуллобластомы, супратенториальной примитивной нейроэктодермальной опухоли, атипичной тератоидной/рабдоидной опухоли, рака легкого (например, немелкоклеточного рака легкого), рака молочной железы, предстательной железы, яичников, колоректального рака и рака мочевого пузыря и любой их комбинации, и метастазов любого из раков.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например молекулу CAR, описанную здесь, вводят в комбинации с агентом, который увеличивает эффективность клетки, экспрессирующей молекулу CAR, например, с агентом, описанным здесь.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например молекулу CAR, описанную здесь, вводят в комбинации с агентом, который уменьшает интенсивность одного или более побочных эффектов, связанных с введением клетки, экспрессирующей молекулу CAR, например, с агентом, описанным здесь.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например молекулу CAR, описанную здесь, вводят в комбинации с агентом, который лечит заболевание, связанное с EGFRvIII, например, с агентом, описанным здесь.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например молекулу CAR, описанную здесь, вводят в дозе и/или по схеме введения доз, описанной здесь.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например молекулу CAR, описанную здесь, вводят в качестве лечения первой линии заболевания, например, рака, например, рака, описанного здесь. В другом варианте осуществления клетки, экспрессирующие молекулу CAR, например молекулу CAR, описанную здесь, вводят в качестве лечения второй, третьей, четвертой линии заболевания, например, рака, например, рака, описанного здесь.

В другом аспекте настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей CAR по настоящему изобретению, выделенной молекуле полипептида CAR по настоящему изобретению, вектору, включающему CAR по настоящему изобретению, и клетке, включающей CAR по настоящему изобретению, для применения в качестве лекарственного средства, например, описанного здесь.

В другом аспекте настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей CAR по настоящему изобретению, выделенной молекуле полипептида CAR по настоящему изобретению, вектору, включающему CAR по настоящему изобретению, и клетке, включающей CAR по настоящему изобретению, для применения в лечении заболевания, экспрессирующего EGFRvIII, например, заболевания, экспрессирующего EGFRvIII, описанного здесь.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

Фиг. 1А и 1B представляют собой ряд блок-схем лентивирусных векторов для 3C10 и miR17-92. На фиг. 1А представлен экспрессирующий 3C10-CAR вектор pELNS-3C10-CAR; а на фиг. 1В представлен экспрессирующий miR17-92 лентивирусный вектор.

Фиг. 2A-2C представляют собой ряд изображений, демонстрирующих функциональную экспрессию 3C10-CAR и miR17-92, трансдуцированных с использованием лентивирусного вектора в Т-клетки человека. CD3+ Т-клетки были трансдуцированы только pELNS-3C10-CAR или как pELNS-3C10-CAR, так и FG12-EF1α-miR17-92.

Фиг. 3A-3D представляют собой ряд изображений, демонстрирующих, что коэкспрессия miR17-92 в CAR-Т-клетки придает стойкость к подавляющим эффектам TGF-β и TMZ. CAR-Т-клетки (неокрашенные столбики) и те, которые были котрансдуцированы miR17-92 (окрашенные столбики), сокультивировали с АРС, экспрессирующими EGFRvIII, в присутствии указанных концентраций TGF-β и TMZ.

Фиг. 4А и 4В являются изображениями, демонстрирующими сильные терапевтические эффекты CAR-Т-клеток у мышей, имеющих опухоли U87-EGFRvIII.

Фиг. 5A-5C представляют собой ряд изображений, демонстрирующих, что котрансдукция miR17-92 в CAR-Т-клетки дает улучшение защиты от повторно инокулируемых клеток глиомы.

Фиг. 6 является представлением, демонстрирующим сравнение репрезентативных EGFRvIII CAR (SEQ ID 1, 121 и 2, соответственно, в порядке появления).

Фиг. 7 представляет собой изображение, демонстрирующее, что Т-клетки человека, трансдуцированные EGFRvIII-специфическим CAR, демонстрируют специфический и сильный лизис EGFRvIII-экспрессирующих клеток GBM человека U87 (U87-EGFRvIII).

Фиг. 8 представляет собой график, показывающий, что все экспрессирующие CAR на основе антитела против EGFRvIII Т-клетки устраняют опухолевые клетки, но клеточная структура 3C10.BBz CARТ устраняет опухоли наиболее быстро к дню 7.

Фиг. 9 является таблицей, показывающей последовательности VH и VL гуманизированного антитела против EGFRvIII (SEQ ID NO: 122-127, соответственно, в порядке появления).

Фиг. 10 представляет собой график, демонстрирующий in vitro связывание конструкций растворимого гуманизированного scFv, связывающихся с линией EGFRvIII+ клеток.

Фиг. 11 представляет собой график, демонстрирующий in vitro связывание конструкций растворимого гуманизированного scFv, связывающихся с линией клеток, экспрессирующих EGFR дикого типа, с клоном 73 (также называемым CAR6) и клоном 74 (также называемым CAR7), демонстрируя профиль безопасности.

Фиг. 12 представляет собой график сравнения специфичности мышиного CAR9 и человеческого CAR10 в отношении EGFRvIII и EGFR дикого типа при транзиторной трансфекции клеток Jurkat и обнаружении с использованием слитых с Fc белков.

Фиг. 13 представляет собой график, демонстрирующий трансдукцию первичных Т-клеток донора конструкциями гуманизированного EGFRvIII-специфического CAR mCAR19 (контроль), CAR10, CAR9 и CAR6, окрашенных насыщающим количеством EGFRvIII.

Фиг. 14 представляет собой график, демонстрирующий люциферазную активность конструкций гуманизированного EGFRvIII-специфического CAR, стимулированную ВНК-EGFRvIII клетками, но не клетками дикого типа.

Фиг. 15 представляет собой график, демонстрирующий, что конструкции гуманизированного EGFRvIII-специфического CAR пролиферируют в ответ на стимул U87vIII без фоновой пролиферации на EGFR дикого типа.

Фиг. 16 представляет собой график, демонстрирующий, что конструкции гуманизированного EGFRvIII-специфического CAR пролиферируют in vitro в присутствии стимула U87vIII.

Фиг. 17 представляет собой график, демонстрирующий 4-часовой анализ уничтожения опухоли - высвобождения 51-хрома, в котором конструкция гуманизированного EGFRvIII-специфического CAR, 2173 (CAR6) и CAR9 специфически уничтожают EGFRvIII-экспрессирующие клетки, но не клетки, экспрессирующие EGFR дикого типа.

Фиг. 18 представляет собой график, показывающий изменение размера опухоли (см3, верхняя левая панель) и изменение средней интенсивности эмиссии в опухоли (фотонов/сек/см2/стерадиан, верхняя правая панель), и кривую выживаемости Каплана-Мейера (ниже) in vivo у мышей, получивших CAR+ Т-клетки, трансдуцированные конструкцией гуманизированного EGFRvIII-специфического CAR (CAR6).

ПОДРОБНОЕ ОПИСАНИЕ НАСТОЯЩЕГО ИЗОБРЕТЕНИЯ

Определения

Кроме особо оговоренных случаев, все технические и научные термины, используемые здесь, имеют такое же значение, в котором их обычно понимает специалист со средним уровнем компетентности в области техники, к которой относится настоящее изобретение.

Артикли «a» и «an» относятся к одному или более чем одному (т.e. к по крайней мере одному) грамматическому подлежащему артикля. В качестве примера, «an element» означает один элемент или более чем один элемент.

Термин «приблизительно», когда относится к измеряемой величине, такой как количество, продолжительность времени и т.п., как подразумевается, охватывает вариации, составляющие ±20% или в некоторых случаях ±10%, или в некоторых случаях ±5%, или в некоторых случаях ±1%, или в некоторых случаях ±0,1% от указанной величины, поскольку такие вариации являются адекватными для выполнения описываемых способов.

Термин «химерный антигенспецифический рецептор» или альтернативно «CAR» относится к рекомбинантной полипептидной конструкции, включающий по крайней мере экстраклеточный антигенсвязывающий домен, трансмембранный домен и цитоплазматический домен сигнализации (также называемый здесь «внутриклеточным доменом сигнализации»), включающий функциональный домен сигнализации, происходящий из стимулирующей молекулы, определенной ниже. В одном аспекте стимулирующей молекулой является дзета цепь, связанная с Т-клеточным рецепторным комплексом. В одном аспекте цитоплазматический домен сигнализации, кроме того, включает один или более функциональных доменов сигнализации, происходящих из по крайней мере одной костимулирующей молекулы, определенной ниже. В одном аспекте костимулирующую молекулу выбирают из 4-1ВВ (т.е. CD137) и/или CD28. В одном аспекте CAR включает химерный слитый белок, включающий экстраклеточный домен распознавания антигена, трансмембранный домен и внутриклеточный домен сигнализации, включающий функциональный домен сигнализации, происходящий из стимулирующей молекулы. В одном аспекте CAR включает химерный слитый белок, включающий экстраклеточный домен распознавания антигена, трансмембранный домен и внутриклеточный домен сигнализации, включающий функциональный домен сигнализации, происходящий из костимулирующей молекулы, и функциональный домен сигнализации, происходящий из стимулирующей молекулы. В одном аспекте CAR включает химерный слитый белок, включающий экстраклеточный домен распознавания антигена, трансмембранный домен и внутриклеточный домен сигнализации, включающий два функциональных домена сигнализации, происходящих из одной или более костимулирующих молекул, и функциональный домен сигнализации, происходящий из стимулирующей молекулы. В одном аспекте CAR включает химерный слитый белок, включающий экстраклеточный домен распознавания антигена, трансмембранный домен и внутриклеточный домен сигнализации, включающий по крайней мере два функциональных домена сигнализации, происходящих из одной или более костимулирующих молекул, и функциональный домен сигнализации, происходящий из стимулирующей молекулы. В одном аспекте CAR включает необязательную лидерную последовательность на амино-конце (N-конце) слитого белка CAR. В одном аспекте CAR, кроме того, включает лидерную последовательность на N-конце экстраклеточного домена распознавания антигена, причем лидерная последовательность необязательно отщепляется от домена распознавания антигена (например, scFv) во время клеточного процессинга и локализации CAR на клеточной мембране.

Термин «домен сигнализации» относится к функциональной части белка, которая действует, передавая информацию в клетке для регулирования клеточной активности через определенные пути передачи сигналов благодаря образованию вторичных мессенджеров или функционированию в качестве эффекторов при ответе на такие мессенджеры.

Термин «EGFR» относится к зрелому полноразмерному рецептору эпидермального фактора роста любого млекопитающего, в том числе человеческим и нечеловеческим формам. Состоящий из 1186 аминокислот EGFR человека описан в Ullrich et al., Nature 309: 418-425 (1984)) и имеет № доступа в GenBank - AF125253 и № доступа в SwissProt - P00533-2.

Термин «EGFRvIII» относится к варианту III рецептора эпидермального фактора роста. EGFRvIII является самым распространенным вариантом EGFR, который наблюдается в опухолях человека, но редко наблюдается в нормальной ткани. Этот белок является результатом делеции в рамке считывания экзонов 2-7 и образования нового остатка глицина на стыке экзонов 1 и 8 в экстраклеточном домене EGFR, в результате чего создается специфический в отношении опухоли эпитоп. EGFRvIII экспрессируется в 24%-67% GBM, но не в нормальных тканях. EGFRvIII также известен как мутант типа III, дельта EGFR, EGFRde2-7 и ΔEGFR и описан в патентах США №№ 6455498, 6127126, 5981725, 5814317, 5710010, 5401828 и 5212290. Экспрессия EGFRvIII может быть результатом хромосомной делеции и может также быть результатом аберрантного альтернативного сплайсинга. Смотрите Sugawa et al., 1990, Proc. Natl. Acad. Sci. 87: 8602-8606.

Используемый здесь термин «антитело» относится к белку или полипептидной последовательности, происходящей из молекулы иммуноглобулина, который специфически связывается с антигеном. Антитела могут быть поликлональными или моноклональными, много- или одноцепочечными, или интактными иммуноглобулинами, и могут быть получены из природных источников или из рекомбинантных источников. Антитела могут представлять собой тетрамеры иммуноглобулиновых молекул.

Термин «фрагмент антитела» относится к по крайней мере одной части интактного антитела, или его рекомбинантных вариантов, и относится к антигенсвязывающему домену, например, определяющей антиген вариабельной области интактного антитела, которая является достаточной для обеспечения распознавания и специфического связывания фрагмента антитела с мишенью, например, антигеном. Примеры фрагментов антитела включают, но без ограничения, Fab-, Fab'-, F(аb')2- и Fv-фрагменты, фрагменты антител scFv, линейные антитела, однодоменные антитела, такие как sdAb (или VL, или VH), VHH-домены семейства верблюдовых и полиспецифические антитела, образованные из фрагментов антител. Термин «scFv» относится к слитому белку, включающему по крайней мере один фрагмент антитела, включающий вариабельную область легкой цепи, и по крайней мере один фрагмент антитела, включающий вариабельную область тяжелой цепи, причем вариабельные области легкой и тяжелой цепей связаны рядом с помощью короткого гибкого полипептидного линкера и могут быть экспрессированы в виде одноцепочечного полипептида, и причем scFv сохраняет специфичность интактного антитела, из которого он происходит. Если не указано иное, как здесь используется, scFv может содержать вариабельные области VL и VH в любом порядке, например, по отношению к N-концу и С-концу полипептида, scFv может включать VL-линкер-VH или может включать VH-линкер-VL.

Часть структуры CAR по настоящему изобретению, включающая антитело или фрагмент антитела, может существовать в различных формах, причем антигенсвязывающий домен экспрессируется в виде части непрерывной полипептидной цепи, включая, например, фрагмент однодоменного антитела (sdAb), одноцепочечное антитело (scFv) и гуманизированное антитело (Harlow et al, 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al, 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al, 1988, Proc. Natl. Acad. Sci. USA 85: 5879-5883; Bird et al, 1988, Science 242: 423-426). В одном аспекте антигенсвязывающий домен структуры CAR по настоящему изобретению включает фрагмент антитела. В дальнейшем аспекте CAR включает фрагмент антитела, который включает scFv.

Термин «тяжелая цепь антитела» относится к большей из двух типов полипептидных цепей, которая присутствует в молекулах антител в их встречающихся в природе конформациях, и которая обычно определяет класс, к которому относится антитело.

Термин «легкая цепь антитела» относится к меньшей из двух типов полипептидных цепей, присутствующих в молекулах антител в их встречающихся в природе конформациях. Легкие цепи каппа (κ) и лямбда (λ) относятся к двум основным изотипам легких цепей антител.

Термин «рекомбинантное антитело» относится к антителу, которое создают с использованием технологии рекомбинантных ДНК, такому как, например, антитело, экспрессируемое бактериофагом или дрожжевой экспрессионной системой. Термин, как должно также подразумеваться, означает антитело, которое было создано посредством синтеза молекулы ДНК, которая кодирует антитело и которая экспрессирует белок антитело, или аминокислотную последовательность, определяющую антитело, причем ДНК или аминокислотная последовательность были получены, используя технологию рекомбинантных ДНК или аминокислотных последовательностей, которая имеется в распоряжении и хорошо известна в данной области техники.

Используемый здесь термин «антиген» или «Аг(Ag)» определяется как молекула, которая стимулирует иммунный ответ. Этот иммунный ответ может включать или продукцию антител, или активацию специфических иммунологически компетентных клеток, или и то, и другое. Квалифицированному специалисту будет понятно, что любая макромолекула, включая фактически все белки или пептиды, может служить в качестве антигена. Кроме того, антигены могут происходить из рекомбинантной или геномной ДНК. Квалифицированному специалисту будет понятно, что любая ДНК, которая включает нуклеотидную последовательность или частичную нуклеотидную последовательность, кодирующую белок, который индуцирует иммунный ответ, поэтому кодирует «антиген», как этот термин здесь используется. Кроме того, квалифицированному в данной области техники специалисту будет понятно, что не требуется, чтобы антиген кодировался исключительно полноразмерной нуклеотидной последовательностью гена. Со всей очевидностью вытекает, что настоящее изобретение включает, но без ограничения, использование частичных нуклеотидных последовательностей более чем одного гена, и что эти нуклеотидные последовательности организованы в различные комбинации для кодирования полипептидов, которые вызывают желаемый иммунный ответ. Более того, квалифицированному специалисту будет понятно, что совсем не требуется, чтобы антиген кодировался «геном». Со всей очевидностью вытекает, что антиген может быть созданным синтезированным или может происходить из биологического образца, или мог бы быть макромолекулой помимо полипептида. Такой биологический образец может включать, но без ограничения, образец ткани, образец опухоли, клетку или жидкость с другими биологическим компонентами.

Используемый здесь термин «противоопухолевый эффект» относится к биологическому эффекту, который может проявляться по-разному, в том числе, но без ограничения, уменьшением объема опухоли, уменьшением числа опухолевых клеток, уменьшением числа метастазов, увеличением средней ожидаемой продолжительности жизни, уменьшением пролиферации опухолевых клеток, уменьшением выживания опухолевых клеток или уменьшением различных физиологических симптомов, связанных с раковым состоянием. «Противоопухолевый эффект» может также проявляться способностью пептидов, полинуклеотидов, клеток и антител по настоящему изобретению к предотвращению возникновения первичной опухоли.

Термин «аутологичный» относится к любому материалу, происходящему от того же индивидуума, которому он позже должен быть снова введен.

Термин «аллогенный» относится к любому материалу, полученному из другого животного того же вида, что и индивидуум, которому вводят материал. Говорят, что два или более индивидуумов являются аллогенными друг относительно друга, когда гены в одном или более локусов не идентичны. В некоторых аспектах аллогенный материал от индивидуумов одного и того же вида может быть достаточно отличным генетически, чтобы взаимодействовать антигенно.

Термин «ксеногенный» относится к трансплантату, происходящему от животного отличного вида.

Термин «рак» относится к заболеванию, характеризующемуся быстрым и неконтролируемым ростом аберрантных клеток. Раковые клетки могут распространяться локально или через кровяное русло и лимфатическую систему в другие части тела. Примеры различных раков описаны здесь и включают, но без ограничения, глиобластому, рак молочной железы, рак предстательной железы, рак яичника, рак шейки матки, рак кожи, рак поджелудочной железы, колоректальный рак, рак почки, рак печени, рак головного мозга, лимфому, лейкоз, рак легкого и т.п.

Используемый здесь термин «заболевание, связанное с экспрессией EGFRvIII» включает, но без ограничения, заболевание, связанное с экспрессией EGFRvIII, или состояние, связанное с клетками, которые экспрессируют EGFRvIII, включая опухолевые клетки различных раковых заболеваний, таких как, например, глиобластома (в том числе стволовые клетки глиобластомы); рак молочной железы, рак яичников и мелкоклеточный рак легкого; плоскоклеточный рак головы и шеи; медуллобластома, колоректальный рак, рак предстательной железы и рак мочевого пузыря. Без ограничения конкретной теорией или механизмом, полагают, что при вызове антигенспецифического ответа против EGFRvIII, CAR, описанные здесь, обеспечивают одно или более из следующего: нацеленность на EGFRvIII-экспрессирующие опухолевые клетки и их уничтожение, уменьшение или уничтожение опухолей, облегчение инфильтрации иммунных клеток в опухолевый центр и повышение/расширение противоопухолевых ответов. Поскольку EGFRvIII не экспрессируется на обнаружимых уровнях в нормальной (т.е. не раковой) ткани, предполагается, что преимущественно CAR по настоящему изобретению в основном избегают нацеливания на нормальные ткани и клетки/их уничтожения.

Термин «консервативные модификации последовательности» предназначен для обозначения аминокислотных модификаций, которые существенно не влияют или не изменяют характеристики связывания антитела или фрагмента антитела, содержащего аминокислотную последовательность. Такие консервативные модификации включают замены, добавления и делеции аминокислот. Модификации могут быть введены в антитело или фрагмент антитела по настоящему изобретению с помощью стандартных методов, известных в данной области техники, таких как сайт-направленный мутагенез и ПЦР-опосредованный мутагенез. Консервативными аминокислотными заменами являются те, в которых аминокислотный остаток заменен аминокислотным остатком, имеющим сходную боковую цепь. Семейства аминокислотных остатков, имеющих сходные боковые цепи, были определены в данной области техники. Эти семейства включают аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислыми боковыми цепями (например, аспарагиновую кислоту, глютаминовую кислоту), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глютамин, серин, треонин, тирозин, цистеин, триптофан), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин). Таким образом, один или более аминокислотных остатков в CAR по настоящему изобретению могут быть заменены другими аминокислотными остатками из того же семейства боковых цепей, и измененный CAR может быть проверен, используя функциональные анализы, описанные здесь.

Термин «стимулирование» относится к первичной ответной реакции, индуцируемой связыванием стимулирующей молекулы (например, TCR/CD3 комплекса) с узнаваемым лигандом, таким образом, опосредуя событие сигнальной трансдукции, такое как, но без ограничения, сигнальная трансдукция с помощью TCR/CD3-комплекса. Стимулирование может опосредовать измененную экспрессию определенных молекул, такую как уменьшение экспрессии TGF-β и/или реорганизация структур цитоскелета и т.п.

Термин «стимулирующая молекула» относится к молекуле, экспрессируемой Т-клеткой, которая обеспечивает

цитоплазматическую последовательность(и) первичной сигнализации, регулирующую первичную активацию TCR комплекса стимулирующим образом в по крайней мере некотором аспекте пути передачи сигналов с участием Т-клеток. В одном аспекте первичный сигнал инициируется, например, в результате связывания TCR/CD3 комплекса с молекулой MHC, связанной с пептидом, и которое приводит к опосредованию Т-клеточной реакции, в том числе, но без ограничения, пролиферации, активации, дифференциации и т.п. Цитоплазматическая последовательность первичной сигнализации (также называемая «доменом первичной сигнализации»), которая действует стимулирующим образом, может содержать мотив сигнализации, который известен как иммунорецепторный тирозиновый активирующий мотив или ITAM. Примеры содержащей ITAM цитоплазматической последовательности первичной сигнализации, которая является особенно полезной в настоящем изобретении, включают, но без ограничения, те, которые происходят из TCR дзета, FcR гамма, FcR бета, CD3 гамма, CD3 дельта, CD3 эпсилон, CD5, CD22, CD79a, CD79b, CD278 (также известного как «ICOS») и CD66d. В конкретном CAR по настоящему изобретению внутриклеточный домен сигнализации в любой одном или более CAR по настоящему изобретению включает внутриклеточную последовательность сигнализации, например, последовательность первичной сигнализации CD3-дзета. В конкретном CAR по настоящему изобретению последовательность первичной сигнализации CD3-дзета представляет собой последовательность, представленную как SEQ ID NO: 17, или эквивалентные остатки из не являющегося человеком вида, например, мыши, грызуна, обезьяны, примата и т.п. В конкретном CAR по настоящему изобретению последовательность первичной сигнализации CD3-дзета представляет собой последовательность, представленную как SEQ ID NO: 99, или эквивалентные остатки из не являющегося человеком вида, например, мыши, грызуна, обезьяны, примата и т.п.

Термин «антигенпрезентирующая клетка» или «АРС» относится к клетке иммунной системы, такой как А-клетка (например, В-клетка, дендритная клетка и т.п.), которая представляет чужеродный антиген в комплексе с главными комплексами гистосовместимости (МНС) на своей поверхности. Т-клетки могут распознавать эти комплексы, используя свои Т-клеточные рецепторы (TCR). АРС процессируют антигены и презентируют их Т-клеткам.

«Внутриклеточный домен сигнализации», как этот термин здесь используется, относится к внутриклеточной части молекулы. Внутриклеточный домен сигнализации порождает сигнал, который стимулирует иммунную эффекторную функцию содержащей CAR клетки, например, CAR-T-клетки. Примеры иммунной эффекторной функции, например, в CAR-T-клетке, включают цитолитическую активность и хэлперную активность, в том числе секрецию цитокинов.

В одном варианте осуществления внутриклеточный домен сигнализации может включать внутриклеточный домен первичной сигнализации. Примеры внутриклеточных доменов первичной сигнализации включают те, которые происходят из молекул, ответственных за первичную стимуляцию, или зависящую от антигена стимуляцию. В одном варианте осуществления внутриклеточный домен сигнализации может включать костимулирующий внутриклеточный домен. Приводимые в качестве примера внутриклеточные домены костимулирующей сигнализации включают те, которые происходят из молекул, ответственных за костимулирующие сигналы, или не зависящую от антигена стимуляцию. Например, в случае CAR-T-клетки внутриклеточный домен первичной сигнализации может включать цитоплазматическую последовательность Т-клеточного рецептора, а внутриклеточный домен костимулирующей сигнализации может включать цитоплазматическую последовательность корецептора или костимулирующей молекулы.

Внутриклеточный домен первичной сигнализации может включать мотив сигнализации, который известен как иммунорецепторный тирозиновый активирующий мотив или ITAM. Примеры содержащих ITAM цитоплазматических последовательностей первичной сигнализации включают, но без ограничения, те, которые происходят из CD3 дзета, FcR гамма, FcR бета, CD3 гамма, CD3 дельта, CD3 эпсилон, CD5, CD22, CD79a, CD79b, и CD66d DAP10 и DAP12.

Термин «дзета» или альтернативно «дзета цепь», «CD3-дзета» или «TCR-дзета» определяется как белок, представленный под входящим № в GenBan - BAG36664.1, или эквивалентные остатки из не являющегося человеком вида, например, мыши, грызуна, обезьяны, примата и т.п., а «стимулирующий домен дзета» или альтернативно «стимулирующий домен CD3-дзета» или «стимулирующий домен TCR-дзета» определяется как аминокислотные остатки цитоплазматического домена дзета цепи, которые достаточны для функциональной передачи первичного сигнала, необходимого для активации Т-клеток. В одном аспекте цитоплазматический домен дзета включает остатки с 52 по 164 включительно белка с входящим № в GenBan - BAG36664.1, или эквивалентные остатки из не являющегося человеком вида, например, мыши, грызуна, обезьяны, примата и т.п., которые являются их функциональными ортологами. В одном аспекте «стимулирующий домен зета» или «стимулирующий домен CD3-дзета» представляет собой последовательность, представленную как SEQ ID NO: 17. В одном аспекте «стимулирующим доменом зета» или «стимулирующим доменом CD3-дзета» является последовательность, представленная как SEQ ID NO: 99.

Термин «костимулирующая молекула» относится к узнаваемому партнеру по связыванию на T-клетке, который специфически связывается с костимулирующим лигандом, тем самым опосредуя костимуляторную реакцию, проявляемую Т-клеткой, такую как, но без ограничения, пролиферация. Костимулирующими молекулами являются молекулы клеточной поверхности, отличные от антигенспецифических рецепторов или их лигандов, которые необходимы для эффективного иммунного ответа. Костимулирующие молекулы включают, но без ограничения, молекулу МНС класса I, BTLA и Toll-подобный рецептор лиганда, а также OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11а/CD18) и 4-1ВВ (CD137).

Внутриклеточный домен костимулирующей сигнализации может происходить из внутриклеточной части костимулирующей молекулы. Костимулирующая молекула может быть представлена в следующих семействах белков: белки рецепторы TNF, иммуноглобулин-подобные белки, рецепторы цитокинов, интегрины, сигнальные молекулы активации лимфоцитов (белки SLAM) и NK-клеточные рецепторы активации. Примеры таких молекул включают CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, связанный с функционированием лимфоцитов антиген-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-Н3 и лиганд, который специфически связывается с CD83, и т.п.

Внутриклеточный домен сигнализации может включать всю внутриклеточную часть, или весь природный внутриклеточный домен сигнализации, молекулы, из которой он происходит, или его функциональный фрагмент.

Термин «4-1ВВ» относится к члену суперсемейства TNFR с аминокислотной последовательностью, представленной как входящий № в GenBank - AAA62478.2, или эквивалентными остатками из не являющегося человеком вида, например, мыши, грызуна, обезьяны, примата и т.п., и «костимулирующий домен 4-1ВВ» определяется как аминокислотные остатки 214-255 белка с входящим № в GenBank - AAA62478.2, или эквивалентные остатки из не являющегося человеком вида, например, мыши, грызуна, обезьяны, примата и т.п. В одном аспекте «костимулирующий домен 4-1ВВ» представляет собой последовательность, представленную как SEQ ID NO: 16, или эквивалентные остатки из не являющегося человеком вида, например, мыши, грызуна, обезьяны, примата и т.п.

Термин «кодирование» относится к внутренне присущей способности конкретных последовательностей нуклеотидов в полинуклеотиде, таком как ген, кДНК или мРНК, служить в качестве матриц для синтеза других полимеров и макромолекул в ходе биологических процессов, имеющих или определенную последовательность нуклеотидов (т.е. рРНК, тРНК и мРНК), или определенную последовательность аминокислот и биологические свойства, являющиеся их следствием. Таким образом, ген, кДНК или РНК кодирует белок, если транскрипция и трансляция мРНК, соответствующей этому гену, приводит к образованию белка в клетке или другой биологической системе. И кодирующую цепь, нуклеотидная последовательность которой идентична последовательности мРНК и обычно представлена в списках последовательностей, и некодирующую цепь, используемую в качестве матрицы для транскрипции гена или кДНК, можно назвать кодирующими белок или другой продукт этого гена или кДНК.

Кроме случаев, оговоренных особо, «нуклеотидная последовательность, кодирующая аминокислотную последовательность» включает все нуклеотидные последовательности, которые являются вырожденными вариантами друг друга и которые кодируют одну и ту же аминокислотную последовательность. Выражение «нуклеотидная последовательность, которая кодирует белок или РНК» может также включать интроны в той мере, в которой нуклеотидная последовательность, кодирующая белок, может в каком-либо варианте содержать интрон(ы).

Термины «эффективное количество» и «терапевтически эффективное количество» используются здесь взаимозаменяемо и относятся к количеству соединения, препарата, материала или композиции, как описано здесь, эффективному для достижения конкретного биологического результата.

Термин «эндогенный» относится к любому материалу из или продуцированному внутри организма, клетки, ткани или системы.

Термин «экзогенный» относится к любому материалу, введенному из или продуцированному вне организма, клетки, ткани или системы.

Термин «экспрессия» относится к транскрипции и/или трансляции конкретной нуклеотидной последовательности, управляемой промотором.

Термин «вектор для переноса» относится к смеси химически связанных веществ, которая включает выделенную нуклеиновую кислоту и которая может использоваться для доставки выделенной нуклеиновой кислоты внутрь клетки. Многочисленные векторы известны в данной области, включая, но без ограничения, линейные полинуклеотиды, полинуклеотиды, связанные с ионными или амфифильными соединениями, плазмиды и вирусы. Таким образом, термин «вектор для переноса» включает автономно реплицирующуюся плазмиду или вирус. Этот термин, как будет также подразумеваться, будет, кроме того, включать неплазмидные и невирусные соединения, которые облегчают перенос нуклеиновой кислоты в клетки, такие как, например, соединение полилизин, липосома и т.п. Примеры вирусных векторов для переноса включают, но без ограничения, аденовирусные векторы, аденоассоциированные вирусные векторы, ретровирусные векторы, лентивирусные векторы и т.п.

Термин «экспрессионный вектор» относится к вектору, включающему рекомбинантный полинуклеотид, включающий контролирующие экспрессию последовательности, функционально связанные с экспрессируемой нуклеотидной последовательностью. Экспрессионный вектор включает достаточные для экспрессии действующие в цис-положении элементы; другие элементы для экспрессии могут обеспечиваться клеткой-хозяином или в in vitro экспрессионной системе. Экспрессионные векторы включают все экспрессионные векторы, которые известны в данной области техники, такие как космиды, плазмиды (например, «голые» или содержащиеся в липосомах) и вирусы (например, лентивирусы, ретровирусы, аденовирусы и аденоассоциированные вирусы), которые включают в свой состав рекомбинантный полинуклеотид.

Термин «лентивирус» относится к роду семейства Retroviridae. Лентивирусы являются уникальными среди ретровирусов, являясь способными к инфицированию неделящихся клеток; они могут доставлять значительное количество генетической информации в ДНК клетки-хозяина, а значит они являются одними из самых эффективных средств - векторов для доставки генов. Все из ВИЧ, SIV и FIV являются примерами лентивирусов.

Термин «лентивирусный вектор» относится к вектору, происходящему из по крайней мере части генома лентивируса, в том числе особенно самоинактивирующемуся лентивирусному вектору, представленному в Milone et al. Mol. Ther. 17 (8): 1453-1464 (2009). Другие примеры лентивирусных векторов, которые могут быть использованы в клинике, включают, но без ограничения, например, технологию доставки генов LENTIVECTOR® от Oxford BioMedica, векторную систему LENTIMAX™ от Lentigen и т.п. Неклинические типы лентивирусных векторов также имеются в распоряжении и должны быть известны квалифицированному в данной области техники специалисту.

Используемый здесь термин «гомологичные» или «идентичность» относится к идентичности последовательностей субъединиц между двумя полимерными молекулами, например, между двумя молекулами нуклеиновых кислот, такими как две молекулы ДНК или две молекулы РНК, или между двумя полипептидными молекулами. Когда положение субъединицы в обеих из двух молекул занято одной и той же мономерной субъединицей, например, если положение в каждой из двух молекул ДНК занято аденином, то они являются гомологичными или идентичными в этом положении. Процент гомологии между двумя последовательностями напрямую зависит от числа совпадающих или гомологичных положений, например, если половина (например, пять положений в полимере длиной десять субъединиц) положений в двух последовательностях являются гомологичными, две последовательности гомологичны на 50%; если 90% положений (например, 9 из 10) являются совпадающими или гомологичными, эти две последовательности гомологичны на 90%.

«Гуманизированные» формы нечеловеческих (например, мышиных) антител представляют собой химерные иммуноглобулины, цепи иммуноглобулинов или их фрагменты (такие как Fv, Fab, Fab', F(аb')2 или другие антигенсвязывающие подпоследовательности антител), которые содержат минимальную последовательность, происходящую из нечеловеческого иммуноглобулина. В большинстве случаев гуманизированные антитела и фрагменты антител представляют собой иммуноглобулины человека (антитело-реципиент или фрагмент антитела), в которых остатки из определяющего комплементарность участка (CDR) реципиента заменены остатками из CDR из не являющегося человеком вида (антитела-донора), такого как мышь, крыса или кролик, обладающими желаемой специфичностью, аффинностью и способностью. В некоторых случаях остатки каркасной области (FR) Fv иммуноглобулина человека заменены соответствующими не принадлежащими человеку остатками. Кроме того, гуманизированное антитело/фрагмент антитела может включать остатки, которые не обнаруживаются ни в антителе-реципиенте, ни в импортируемых CDR или каркасных последовательностях. Эти модификации могут дополнительно улучшить и оптимизировать характеристики антитела или фрагмента антитела. В общем, гуманизированное антитело или фрагмент антитела будет включать все или по существу все из по крайней мере одного, а обычно двух вариабельных доменов, в которых по существу все из CDR-участков соответствуют таковым нечеловеческого иммуноглобулина, и все или значительная часть FR-областей принадлежат последовательности иммуноглобулина человека. Гуманизированное антитело или фрагмент антитела могут также включать по крайней мере часть константной области иммуноглобулина (Fc), обычно таковую иммуноглобулина человека. Для получения более подробной информации смотрите Jones et al., Nature, 321: 522-525, 1986; Reichmann et al., Nature, 332: 323-329, 1988; Presta, Curr. Op. Struct. Biol., 2: 593-596, 1992.

Термин антитело «человека» относится к полностью человеческим антителам, а также фактически человеческим антителам. Термин «полностью человеческий» относится к иммуноглобулину, такому как антитело или фрагмента антитела, вся молекула которого имеет человеческое происхождение или состоит из аминокислотной последовательности, идентичной человеческой форме антитела или иммуноглобулина. «Фактически человеческое» антитело представляет собой антитело, которое включает достаточное количество положений аминокислот человека, так что антитело не вызывает иммуногенную реакцию у нормального человека.

Термин «выделенный» означает измененный или удаленный из природного состояния. Например, нуклеиновая кислота или пептид, присутствующий в природе в живом животном, не является «выделенным», но та же нуклеиновая кислота или пептид, которая частично или полностью отделена от сосуществующих материалов ее (его) природного состояния, является выделенной. Выделенная нуклеиновая кислота или белок может существовать в значительной степени очищенной форме или может существовать в неприродном окружении, такой как, например, клетка-хозяин.

В контексте настоящего изобретения используются следующие сокращения для обычно встречающихся нуклеотидных оснований. «A» относится к аденозину, «C» относится к цитозину, «G» относится к гуанозину, «T» относится к тимидину, и «U» относится к уридину.

Термин «функционально связанный» или «транскрипционный контроль» относится к функциональной связи между регуляторной последовательностью и гетерологичной нуклеотидной последовательностью, приводящей к экспрессии последней. Например, первая последовательность нуклеиновой кислоты функционально связана со второй последовательностью нуклеиновой кислоты, когда первая последовательность нуклеиновой кислоты установлена в функциональной связи со второй последовательностью нуклеиновой кислоты. Например, промотор функционально связан с кодирующей последовательностью, если промотор оказывает влияние на транскрипцию или экспрессию кодирующей последовательности. Функционально связанные последовательности ДНК могут быть соседними и, в случае необходимости соединения двух кодирующих белки областей, находятся в одной и той же рамке считывания.

Термин «парентеральное» введение иммуногенной композиции включает, например, подкожную (s.c.), внутривенную (i.v.), внутримышечную (i.m.) или интрастернальную инъекцию, внутрь опухоли, или способы инфузии.

Термин «нуклеиновая кислота» или «полинуклеотид» относится к дезоксирибонуклеиновым кислотам (ДНК) или рибонуклеиновым кислотам (РНК) и их полимерах в или одно-, или двухцепочечной форме. Если специально не ограничивается, термин охватывает нуклеиновые кислоты, содержащие известные аналоги природных нуклеотидов, которые обладают способностями к связыванию, аналогичными таковым ссылочной нуклеиновой кислоты, и которые метаболизируются аналогично со встречающимися в природе нуклеотидами. Если не указано иное, конкретная последовательность нуклеиновой кислоты также подразумеваемым образом охватывает ее консервативно модифицированные варианты (например, замены вырожденными кодонами), аллели, ортологи, SNP и комплементарные последовательности, а также последовательности, указанные в прямой форме. В частности, замены вырожденными кодонами могут быть получены путем создания последовательностей, в которых третье положение одного или более выбранных (или всех) кодонов замещено остатками со смешанными основаниями и/или дезоксиинозиновыми остатками (Batzer et al., Nucleic Acid Res. 19: 5081 (1991); Ohtsuka et al., J. Biol. Chem. 260: 2605-2608 (1985); и Rossolini et al., Mol. Cell. Probes 8: 91-98 (1994)).

Термины «пептид», «полипептид» или «белок» используются взаимозаменяемо и относятся к соединению, состоящему из аминокислотных остатков, ковалентно связанных пептидными связями. Белок или пептид должен содержать по крайней мере две аминокислоты, и не устанавливается ограничение на максимальное число аминокислот, которое может включать последовательность белка или пептида. Полипептиды включают любой пептид или белок, включающий две или более аминокислот, соединенных друг с другом пептидными связями. Используемый здесь термин относится и к коротким цепям, которые обычно называют в данной области техники пептидами, олигопептидами и олигомерами, например, и к более длинным цепям, которые обычно называют в данной области техники белками, множество типов которых существует. «Полипептиды» включают, например, биологически активные фрагменты, по существу гомологичные полипептиды, олигопептиды, гомодимеры, гетеродимеры, варианты полипептидов, модифицированные полипептиды, производные, аналоги, слитые белки, среди прочих. Полипептиды включают природные пептиды, рекомбинантные пептиды или их комбинацию.

Термин «промотор» относится к последовательности ДНК, распознаваемой относящейся к синтезу системой клетки, или введенной, относящейся к синтезу системой, необходимой для инициации специфической транскрипции последовательности полинуклеотида.

Термин «промотор/регуляторная последовательность» относится к последовательности нуклеиновой кислоты, которая необходима для экспрессии продукта гена, функционально связанного с промотором/регуляторной последовательностью. В некоторых случаях эта последовательность может представлять собой базовую промоторную последовательность, а в некоторых случаях эта последовательность может также включать последовательность энхансера и другие регуляторные элементы, которые необходимы для экспрессии продукта гена. Промотором/регуляторной последовательностью может, например, быть промотор/регуляторная последовательность, который экспрессирует продукт гена тканеспецифически.

Термин «конститутивный промотор» относится к нуклеотидной последовательности, которая, после функциональной связи с полинуклеотидом, который кодирует или определяет продукт гена, является причиной продукции продукта гена в клетке в большей части или во всех физиологических условиях клетки.

Термин «индуцируемый промотор» относится к нуклеотидной последовательности, которая, после функциональной связи с полинуклеотидом, который кодирует или определяет продукт гена, является причиной продукции продукта гена в клетке в основном только, когда в клетке присутствует индуктор, который соответствует промотору.

Термин «тканеспецифический промотор» относится к нуклеотидной последовательности, которая, после функциональной связи с полинуклеотидом, который кодирует или определяет продукт гена, является причиной продукции продукта гена в клетке в основном только, если клеткой является клетка типа ткани, соответствующего промотору.

Термин «гибкий полипептидный линкер» или «линкер», используемый в контексте scFv, относится к пептидному линкеру, который состоит из аминокислот, таких как остатки глицина и/или серина, используемому отдельно или в комбинации, чтобы связать вариабельные области тяжелой и легкой цепей вместе. В одном варианте осуществления гибкий полипептидный линкер представляет собой линкер Gly/Ser и включает аминокислотную последовательность (Gly-Gly-Gly-Ser)n (SEQ ID NO: 112), где n - целое положительное число, равное или большее 1. Например, n=1, n=2, n=3, n=4, n=5 и n=6, n=7, n=8, n=9 и n=10. В одном варианте осуществления гибкие полипептидные линкеры включают, но без ограничения, (Gly4 Ser)4 (SEQ ID NO: 113) или (Gly4 Ser)3 (SEQ ID NO: 114). В другом варианте осуществления линкеры включают множественные повторы (Gly2Ser), (GlySer) или (Gly3Ser) (SEQ ID NO: 112). Также в объем настоящего изобретения включены линкеры, описанные в WO2012/138475, который включен сюда в качестве ссылки.

Как здесь используется, 5' кэп-структура (также называемая кэп-структурой РНК, являющейся остатком 7-метилгуанозина кэп-структурой РНК или являющейся м7G кэп-структурой РНК) является модифицированным гуаниновым нуклеотидом, который был добавлен «перед» или на 5'-конец эукариотической мРНК вскоре после начала транскрипции. 5' кэп-структура состоит из концевой группы, которая связана с первым транскрибированным нуклеотидом. Его присутствие важно для распознания рибосомой и защиты от РНКазы. Добавление кэп-структуры связано с транскрипцией и происходит котранскрипционно, так что каждый из этих процессов оказывает влияние на другой процесс. Вскоре после начала транскрипции, 5'-конец синтезируемой мРНК связывается кэп-синтезирующим комплексом, связанным с РНК-полимеразой. Этот ферментативный комплекс катализирует химические реакции, которые необходимы для кэппирования мРНК. Синтез протекает как многоступенчатая биохимическая реакция. Фрагмент кэппирования можно модифицировать для модулирования функциональных возможностей мРНК, таких как ее стабильность или эффективность трансляции.

Как здесь используется, «in vitro транскрибированная РНК» относится к РНК, предпочтительно мРНК, которая была синтезирована in vitro. Как правило, in vitro транскрибированная РНК образуется с вектора для in vitro транскрипции. Вектор для in vitro транскрипции включает матрицу, которая используется для образования in vitro транскрибированной РНК.

Как здесь используется, «поли(А)» представляет собой ряд аденозинов, присоединенных с помощью полиаденилирования к мРНК. В предпочтительном варианте осуществления конструкции для транзиторной экспрессии, поли(А) составляет от 50 до 5000 (SEQ ID NO: 115), предпочтительно больше чем 64, более предпочтительно больше чем 100, более предпочтительно больше чем 300 или 400. Последовательности поли(А) можно модифицировать химически или ферментативно для модулирования функциональных возможностей мРНК, таких как локализация, стабильность или эффективность трансляции.

Как здесь используется, «полиаденилирование» относится к ковалентной связи полиаденилильного фрагмента, или его модифицированного варианта, с молекулой мРНК. В эукариотических организмах большая часть молекул мРНК является полиаденилированной на 3'-конце. 3' поли(А)-хвост является длинной последовательностью из адениновых нуклеотидов (часто несколько сотен), добавленной к пре-мРНК под действием фермента полиаденилатполимеразы. У высших эукариот поли(А)-хвост добавляется на транскрипты, которые содержат специфическую последовательность, сигнал полиаденилирования. Поли(А)-хвост и белок, связанный с ним, помогают в защите мРНК от деградации под действием экзонуклеаз. Полиаденилирование также важно для терминации транскрипции, экспорта мРНК из ядра и трансляции. Полиаденилирование происходит в ядре сразу после транскрипции ДНК в РНК, но, кроме того, может также происходить позднее в цитоплазме. После терминации транскрипции цепь мРНК расщепляется под действием эндонуклеазного комплекса, связанного с РНК-полимеразой. Сайт расщепления, как правило, характеризуются присутствием последовательности оснований AAUAAA вблизи сайта расщепления. После расщепления мРНК остатки аденозина добавляются к свободному 3'-концу в сайте расщепления.

Как здесь используется, «транзиторная» относится к экспрессии не интегрированного трансгена в течение периода, составляющего часы, дни или недели, причем период времени экспрессии короче периода времени экспрессии гена, если он интегрирован в геном или содержится в стабильном плазмидном репликоне в клетке-хозяине.

Термин «путь трансдукции сигнала» относится к биохимической связи между различными молекулами трансдукции сигнала, которые играют роль в передаче сигнала из одной части клетки в другую часть клетки. Выражение «рецептор клеточной поверхности» включает молекулы и комплексы молекул, способные принимать сигнал и передавать сигнал через мембрану клетки.

Термин «субъект», как предполагается, включает живые организмы, в которых может быть вызван иммунный ответ (например, млекопитающих, человека).

Термин «очищенная в значительной степени» клетка относится к клетке, которая по существу не содержит другие типы клеток. Очищенная в значительной степени клетка также относится к клетке, которая была отделена от других типов клеток, с которыми она обычно связана в своем встречающемся в природе состоянии. В некоторых случаях популяция очищенных в значительной степени клеток относится к гомогенной популяции клеток. В других случаях этот термин относится просто к клеткам, которые были отделены от клеток, с которыми они связаны в природе в своем природном состоянии. В некоторых вариантах осуществления клетки подвергают культивированию in vitro. В других вариантах осуществления клетки не подвергают культивированию in vitro.

Термин «терапевтическое», как здесь используется, означает лечение. Терапевтический эффект достигается при ослаблении, подавлении, ремиссии или ликвидации болезненного состояния.

Термин «профилактика», как здесь используется, означает предупреждение или профилактику заболевания или болезненного состояния.

В контексте настоящего изобретения «опухолевый антиген» или «антиген, связанный с гиперпролиферативным нарушением», относится к антигенам, которые характерны для конкретных гиперпролиферативных нарушений. В некоторых аспектах связанные с гиперпролиферативнвми нарушениями антигены настоящего изобретения происходят из раков, включая, но без ограничения, первичную или метастатическую меланому, тимому, лимфому, саркому, рак легкого, рак печени, неходжкинскую лимфому, неходжкинскую лимфому, лейкозы, рак матки, рак шейки рак, рак мочевого пузыря, рак почки и аденокарциномы, такие как рак молочной железы, рак предстательной железы, рак яичников, рак поджелудочной железы и т.п.

Термин «трансфицированная» или «трансформированная, или «трансдуцированная» относится к процессу, с помощью которого экзогенную нуклеиновую кислоту трансфицируют или вводят в клетку-хозяина. «Трансфицированная» или «трансформированная, или «трансдуцированная» клетка является клеткой, которая была подвергнута трансфекции, трансформации или трансдукции экзогенной нуклеиновой кислотой. Клетка включает эмбриональную клетку субъекта и ее потомство.

Термин «специфически связывается» относится к антителу, или лиганду, которое(ый) распознает и связывает узнаваемый белок, являющийся партнером по связыванию (например, стимулирующую и/или костимулирующую молекулу, присутствующую на Т-клетках), присутствующий в образце, но антитело или лиганд практически не распознает или не связывает другие молекулы в образце.

Диапазоны: На протяжении всего этого описания различные аспекты настоящего изобретения могут быть представлены в формате диапазона. Следует понимать, что описание в формате диапазона представлено исключительно для удобства и краткости и не должно рассматриваться как жесткое ограничение объема настоящего изобретения. Соответственно, описание диапазона, как следует рассматривать, содержит конкретно выявляемые все возможные поддиапазоны, а также отдельные численные значения внутри этого диапазона. Например, описание такого диапазона, как от 1 до 6, как следует рассматривать, содержит конкретно выявляемые поддиапазоны, такие как от 1 до 3, от 1 до 4, от 1 до 5, от 2 до 4, от 2 до 6, от 3 до 6 и т.д., а также отдельные численные значения внутри этого диапазона, например, 1, 2, 2,7, 3, 4, 5, 5,3 и 6. В качестве другого примера, такой диапазон, как составляющая 95-99% идентичность, включает что-нибудь с составляющей 95%, 96%, 97%, 98% или 99% идентичностью и включает такие поддиапазоны, как составляющая 96-99%, 96-98%, 96-97%, 97-99%, 97-98% и 98-99% идентичность. Это применимо независимо от ширины диапазона.

Описание

Здесь обеспечиваются смеси химически связанных веществ и способы использования для лечения такого заболевания, как рак, используя химерные антигенспецифические рецепторы (CAR) на основе антитела против EGFRvIII.

В одном аспекте настоящим изобретением обеспечивает ряд химерных антигенспецифических рецепторов, включающих антитело или фрагмент антитела, созданных так, что они специфически связываются с белком EGFRvIII. В одном аспекте настоящим изобретением обеспечивается клетка (например, Т-клетка), созданная для экспрессии CAR, причем CAR-Т-клетка («CART») демонстрирует противоопухолевое свойство. В одном аспекте клетку трансформируют CAR, и CAR экспрессируется на поверхности клетки. В некоторых вариантах осуществления клетку (например, Т-клетку) трансдуцируют с использованием вирусного вектора, кодирующего CAR. В некоторых вариантах осуществления вирусный вектор представляет собой ретровирусный вектор. В некоторых вариантах осуществления вирусный вектор представляет собой лентивирусный вектор. В некоторых таких вариантах осуществления клетка может стабильно экспрессировать CAR. В другом варианте осуществления клетку (например, Т-клетку) трансфицируют нуклеиновой кислотой, например, мРНК, кДНК, ДНК, кодирующей CAR. В некоторых таких вариантах осуществления клетка может транзиторно экспрессировать CAR.

В одном аспекте связывающая белок EGFRvIII часть CAR представляет собой фрагмент антитела scFv. В одном аспекте такие фрагменты антител являются функциональными в том плане, что у них сохраняется эквивалентная аффинность, например, они связывают тот же антиген с эффективностью, сопоставимой с таковой антитела класса IgG, из которого они получены. В одном аспекте такие фрагменты антител являются функциональными в том плане, что они обеспечивают биологическую реакцию, которая может включать, но без ограничения, активацию иммунного ответа, ингибирование вызова трансдукции сигнала от его антигена-мишени, ингибирование активности киназы и т.п., как будет понятно квалифицированному в данной области техники специалисту.

В одном аспекте EGFRvIII-антигенсвязывающий домен CAR представляет собой фрагмент мышиного антитела scFv. В другом аспекте EGFRvIII-антигенсвязывающий домен CAR представляет собой фрагмент антитела scFv, который является гуманизированным по сравнению с мышиной последовательностью scFv, из которого он получен. Образование приводимого в качестве примера родительского мышиного моноклонального антитела против EGFRvIII (3C10) описано в Okamoto et al. (British J. Cancer 1996, 73: 1366-1372). Приводимое в качестве примера полностью человеческое антитело против EGFRvIII (139) описано в Morgan et al. (2012) Human Gene Therapy, 23: 1043-1953, который включен сюда посредством ссылки. В одном аспекте scFv в случае мышиной последовательности включает SEQ ID NO: 11. Гуманизация этого scFv мыши может быть желательной для клинических условий, в которых специфические для мыши остатки могут вызвать ответ против мышиных антигенов у человека (НАМА) у пациентов, получающих лечение против EGFRvIII, например, лечение с использованием Т-клеток, трансдуцированных конструкцией против EGFRvIII.

В одном аспекте связывающий домен антитела против EGFRvIII CAR кодируется трансгеном, последовательность которого была оптимизирована в отношении кодонов для экспрессии в клетке млекопитающего. В одном аспекте вся конструкция CAR по настоящему изобретению кодируется трансгеном, вся последовательность которого была оптимизирована в отношении кодонов для экспрессии в клетке млекопитающего. Оптимизация кодонов относится к открытию того, что частота встречаемости синонимичных кодонов (т.е. кодонов, которые кодируют одну и ту же аминокислоту) в кодирующей ДНК является смещенной у различных видов. Такая вырожденность кодонов делает возможным кодирование идентичных полипептидов рядом нуклеотидных последовательностей. Разнообразные методы оптимизации кодонов известны в данной области техники и включают, например, методы, описанные в по крайней мере патентах США №№ 5786464 и 6114148.

В одном аспекте связывающий домен антитела против EGFRvIII CAR представляет собой связывающий домен гуманизированного антитела против EGFRvIII. Например, в одном варианте осуществления связывающий домен антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 38. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 44. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 50. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 56. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 62. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 68. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 74. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 80. В одном аспекте связывающий домен гуманизированного антитела против EGFRvIII включает часть scFv, представленную в SEQ ID NO: 86.

В одном аспекте CAR, описанный здесь, включает антигенсвязывающий домен специфического антитела с внутриклеточным доменом сигнализации. Например, в некоторых аспектах внутриклеточный домен сигнализации включает, но без ограничения, сигнальные модули CD3-дзета цепь, 4-1BB и CD28 и их комбинации.

В одном аспекте антигенсвязывающий домен связывается с EGFRvIII. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 43. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 49. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 55. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 61. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 67. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 73. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 79. В одном аспекте CAR включает последовательность, представленную в SEQ ID NO: 85.

В одном аспекте CAR включает по крайней мере один внутриклеточный домен сигнализации, выбираемый из группы, состоящей из домена сигнализации CD137 (4-1BB), домена сигнализации CD28, домена сигнализации CD3 дзета и любой их комбинации. В одном аспекте CAR включает по крайней мере один внутриклеточный домен сигнализации из одной или более костимулирующих молекул, отличных от CD137 (4-1BB) или CD28, домена сигнализации CD3 дзета и любой их комбинации.

Кроме того, настоящим изобретением обеспечиваются структуры CAR и их применение в лекарственных средствах или способах для лечения, среди прочих заболеваний, рака или любой злокачественной опухоли или аутоиммунных заболеваний, в патогенез которых вовлечены клетки или ткани, которые экспрессируют EGFRvIII.

Настоящим изобретением также обеспечиваются структуры и способы для сверхэкспрессии miR-17-92 (микроРНК-17-92), например, в CAR-экспрессирующей клетке, например, Т-клетке. В одном аспекте сверхэкспрессия с трансгена miR-17-92 придает CAR-трансдуцированной Т-клетке повышенную стойкость к индуцированной опухолью иммуносупрессии и химиотерапии, способствуя тем самым продолжительным терапевтическим эффектам.

Химерный антигенспецифический рецептор (CAR)

Настоящее изобретение охватывает рекомбинантную ДНК-конструкцию, включающую последовательности, кодирующие CAR, причем CAR включает фрагмент антитела, который специфически связывается с EGFRvIII, например, фрагмент антитела человека, который специфически связывается с EGFRvIII. В одном аспекте EGFRvIII является EGFRvIII человека, и последовательность нуклеиновой кислоты, кодирующая фрагмент антитела, является смежной с, и находится той же рамке считывания, что и последовательность(ю) нуклеиновой кислоты, кодирующей внутриклеточный домен сигнализации. Внутриклеточный домен сигнализации может включать домен костимулирующей сигнализации и/или домен первичной сигнализации, например, дзета-цепь. Домен костимулирующей сигнализации относится к части CAR, включающей по крайней мере часть внутриклеточного домена костимулирующей молекулы.

В конкретных аспектах конструкция CAR по настоящему изобретению включает scFv-домен, выбираемый из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, причем scFv может предшествовать необязательная лидерная последовательность, например, представленная в SEQ ID NO: 13, и за ней может следовать необязательная шарнирная последовательность, например, представленная в EQ ID NO: 14 или SEQ ID NO: 104 или SEQ ID NO: 106 или SEQ ID NO: 108, трансмембранная область, например, представленная в SEQ ID NO: 15, внутриклеточной домен сигнализации, который включает SEQ ID NO: 16 или SEQ ID NO: 102, и последовательность CD3 дзета, которая включает SEQ ID NO: 17 или SEQ ID NO: 99, причем домены являются смежными и находятся в одной и той же рамке считывания с образованием одного слитого белка. В настоящее изобретение также включена нуклеотидная последовательность, которая кодирует полипептид каждого из scFv-фрагментов, выбираемых из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, и каждого из доменов SEQ ID NO: 13-17. В настоящее изобретение также включена нуклеотидная последовательность, которая кодирует полипептид каждого из scFv-фрагментов, выбираемых из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, и каждого из доменов SEQ ID NO: 13-16 и SEQ ID NO: 99. В одном аспекте конструкция EGFRvIII-специфического CAR включает необязательную лидерную последовательность, экстраклеточный антигенсвязывающий домен, который специфически связывается с EGFRvIII, шарнирную область, трансмембранный домен и внутриклеточный стимулирующий домен. В одном аспекте конструкция EGFRvIII-специфического CAR включает необязательную лидерную последовательность, экстраклеточный антигенсвязывающий домен, который специфически связывается с EGFRvIII, шарнирную область, трансмембранный домен, внутриклеточный домен сигнализации, который включает домен костимулирующей сигнализации и домен первичной стимуляции. Конкретные конструкции EGFRvIII-специфического CAR, содержащие гуманизированный scFv-домен, представлены в SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 и SEQ ID NO: 90. Конкретные конструкции EGFRvIII-специфического CAR, содержащие scFv-домен мыши, представлены в SEQ ID NO: 1 и SEQ ID NO: 2.

Приводимая в качестве примера лидерная последовательность представлена как SEQ ID NO: 13. Приводимая в качестве примера шарнирная/спейсерная последовательность представлена как SEQ ID NO: 14 или SEQ ID NO: 104 или SEQ ID NO: 106 или SEQ ID NO: 108. Приводимая в качестве примера последовательность трансмембранного домена представлена как SEQ ID NO: 15. Приводимая в качестве примера последовательность костимулирующего домена белка 4-1BB предоставляется как SEQ ID NO: 16. Приводимая в качестве примера последовательность костимулирующего домена белка CD27 представлена как SEQ ID NO: 102. Приводимый в качестве примера домен первичной сигнализации из последовательности домена CD3 дзета представлен как SEQ ID NO: 17. Другой приводимый в качестве примера домен первичной сигнализации из последовательности домена CD3 дзета представлен как SEQ ID NO: 99.

В одном аспекте настоящее изобретение охватывает рекомбинантную НК-конструкцию, включающую молекулу нуклеиновой кислоты, кодирующую CAR, причем молекула нуклеиновой кислоты включает последовательность нуклеиновой кислоты, кодирующую связывающий домен антитела против EGFRvIII, например, описанный здесь, который является смежным с, и находится в той же рамке считывания, что и последовательность(ю) нуклеиновой кислоты, кодирующая внутриклеточный домен сигнализации. В одном аспекте связывающий домен антитела против EGFRvIII выбирают из одной или более из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86. В одном аспекте связывающий домен антитела против EGFRvIII кодируется нуклеотидной последовательностью, представленной в последовательности, выбираемой из группы, состоящей из SEQ ID NO: 39, SEQ ID NO: 45, SEQ ID NO: 51, SEQ ID NO: 57, SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 75, SEQ ID NO: 81 и SEQ ID NO: 98. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 39. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 45. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 51. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 57. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 63. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 69. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 75. В одном аспекте связывающий домен антитела против EGFRvIII кодируется SEQ ID NO: 81.

В одном аспекте настоящее изобретение охватывает рекомбинантную НК-конструкцию, включающую молекулу нуклеиновой кислоты, кодирующую CAR, причем молекула нуклеиновой кислоты включает последовательность нуклеиновой кислоты, кодирующую связывающий домен антитела против EGFRvIII, выбираемый из группы, состоящей из SEQ ID NO: 42, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 60, SEQ ID NO: 66, SEQ ID NO: 72, SEQ ID NO: 78, SEQ ID NO: 84 и SEQ ID NO: 90, причем последовательность является смежной с и находится в той же рамке считывания, что и последовательность(ю) нуклеиновой кислоты, кодирующая внутриклеточный домен сигнализации. Приводимый в качестве примера внутриклеточный домен сигнализации, который может использоваться в CAR, включает, но без ограничения, один или более внутриклеточных доменов сигнализации, например, CD3 дзета, CD28, 4-1BB и т.п. В некоторых случаях CAR может включать любую комбинацию внутриклеточных доменов сигнализации из CD3-дзета, CD28, 4-1ВВ и т.п. В одном аспекте НК-конструкция включает SEQ ID NO: 42. В одном аспекте последовательностью нуклеиновой кислоты конструкции CAR является SEQ ID NO: 48. В одном аспекте НК-конструкция включает SEQ ID NO: 54. В одном аспекте НК-конструкция включает SEQ ID NO: 60. В одном аспекте НК-конструкция включает SEQ ID NO: 66. В одном аспекте НК-конструкция включает SEQ ID NO: 72. В одном аспекте НК-конструкция включает SEQ ID NO: 78. В одном аспекте НК-конструкция включает SEQ ID NO: 84.

Последовательности нуклеиновых кислот, кодирующие желаемые молекулы, можно получить, используя рекомбинантные способы, известные в данной области техники, такие как, например, путем скрининга библиотек из клеток, экспрессирующих ген, путем извлечения гена из вектора, который, как известно, включает его, или путем выделения непосредственно из клеток и тканей, содержащих его, используя стандартные методы. Альтернативно, представляющую интерес нуклеиновую кислоту можно синтезировать, а не клонировать.

Настоящее изобретение включает ретровирусные и лентивирусные векторные конструкции, экспрессирующие CAR, которые можно непосредственно трансдуцировать в клетку.

Настоящее изобретение также включает РНК-конструкцию, которую можно непосредственно трансфицировать в клетку. Способ получения мРНК для применения в трансфекции включает in vitro транскрипцию (IVT) матрицы с использованием специально разработанных праймеров, с последующим добавлением поли(А), чтобы получить конструкцию, содержащую 3' и 5' нетранслируемые последовательности («UTR»), 5' кэп и/или участок внутренней посадки рибосомы (IRES), экспрессируемую нуклеиновую кислоту и поли(А)-хвост, обычно длиной 50-2000 оснований. РНК, полученная таким образом, может эффективно трансфицировать различные типы клеток. В одном варианте осуществления матрица включает последовательности для CAR. В одном варианте осуществления РНК-вектор, кодирующий CAR, трансдуцируют в Т-клетку путем электропорации.

Антигенсвязывающий домен

В одном аспекте CAR по настоящему изобретению включает мишень-специфический связывающий элемент, иначе называемый антигенсвязывающим доменом. Выбор этой составляющей зависит от типа и количества лигандов, которые определяют поверхность клетки-мишени. Например, может быть выбран антигенсвязывающий домен, который распознает лиганд, который действует в качестве маркера клеточной поверхности на клетках-мишенях, связанных с конкретным болезненным состоянием. Таким образом, примеры маркеров клеточной поверхности, которые могут действовать в качестве лигандов для антигенсвязывающего домена CAR по настоящему изобретению, включают те, которые связаны с вирусными, бактериальными и паразитарными инфекциями, аутоиммунным заболеванием и раковыми клетками.

В одном аспекте CAR-опосредованная Т-клеточная реакция может быть направлена на представляющий интерес антиген через создание антигенсвязывающего домена, который специфически связывается с желаемым антигеном, в CAR.

В одном из аспектов часть CAR, включающая антигенсвязывающий домен, включает антигенсвязывающий домен, мишенью которого является EGFRvIII. В одном аспекте мишенью антигенсвязывающего домена является EGFRvIII человека. Например, мышиное моноклональное антитело (IgG2b) 3C10 против EGFRvIII было получено путем иммунизации мышей 14-аминокислотным пептидом (LEEKKGNYVVTDHC; SEQ ID NO: 101), включающим EGFRvIII-специфический стык, и продемонстрировало очень специфическое распознавание EGFRvIII без какого-либо обнаруживаемого связывания с EGFR дикого типа (Okamoto et al, British J. Cancer 1996, 73: 1366-1372). Соответственно, в некоторых вариантах осуществления мишенью антигенсвязывающего домена является аминокислотная последовательность, например, аминокислотная последовательность, включающая дополнительный остаток глицина, в области стыка с EGFvIII. В некоторых вариантах осуществления мишенью антигенсвязывающего домена является одна или более аминокислотных последовательностей в аминокислотной последовательности SEQ ID NO: 101.

Антигенсвязывающим доменом может быть любой домен, который связывается с антигеном, включая, но без ограничения, моноклональное антитело, поликлональное антитело, рекомбинантное антитело, антитело человека, гуманизированное антитело и его функциональный фрагмент, в том числе, но без ограничения, однодоменное антитело, такое как вариабельный домен тяжелой цепи (VH), вариабельный домен легкой цепи (VL) и вариабельный домен (VHH) происходящего от семейства верблюдовых нанотела, и альтернативный каркас, который, как известно в данной области техники, функционируют как антигенсвязывающий домен, такой как рекомбинантный домен фибронектина и т.п. В некоторых случаях выгодно, когда антигенсвязывающий домен происходит из того же вида, в котором будет, в конечном счете, использоваться CAR. Например, в случае применения для людей может быть выгодно, когда антигенсвязывающий домен CAR включают человеческие или гуманизированные остатки для антигенсвязывающего домена антитела или фрагмента антитела.

Таким образом, в одном аспекте антигенсвязывающий домен включает антитело человека или фрагмент антитела. В другом аспекте антигенсвязывающий домен включает гуманизированное антитело или фрагмент антитела. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает один или более (например, один, два или все три) из определяющего комплементарность участка 1 легкой цепи (CDR1 LC), определяющего комплементарность участка 2 легкой цепи (CDR2 LC) и определяющего комплементарность участка 3 легкой цепи (CDR3 LC) связывающего домена антитела против EGFRvIII, описанного здесь, и один или более (например, один, два или все три) из определяющего комплементарность участка 1 тяжелой цепи (CDR1 НС), определяющего комплементарность участка 2 тяжелой цепи (CDR2 НС) и определяющего комплементарность участка 3 тяжелой цепи (CDR3 НС) связывающего домена антитела против EGFRvIII, описанного здесь. В одном варианте осуществления связывающий домен антитела против EGFRvIII включает вариабельную область легкой цепи, описанную здесь, и/или вариабельную область тяжелой цепи, описанную здесь. В одном варианте осуществления связывающий домен антитела против EGFRvIII представляет собой scFv, включающий вариабельную область легкой цепи и вариабельную область тяжелой цепи аминокислотной последовательности, например, вариабельную область легкой цепи и вариабельную область тяжелой цепи, описанную здесь. В одном варианте осуществления связывающий домен антитела против EGFRvIII (например, scFv) включает: вариабельную область легкой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области легкой цепи, представленной здесь, или последовательность, идентичную на 85-99% (например, 90-99% или 95-99%) аминокислотной последовательности, представленной здесь; и/или вариабельную область тяжелой цепи, включающую аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 30, 20 или 10 модификаций (например, замен) аминокислотной последовательности вариабельной области тяжелой цепи, представленной здесь, или последовательность, идентичную на 85-99% (например, 90-99% или 95-99%) аминокислотной последовательности, представленной здесь. В одном аспекте антигенсвязывающий домен включает одну или более последовательностей, выбираемых из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86. В одном аспекте гуманизированный CAR выбирают из одной или более последовательностей, выбираемых из группы, состоящей из SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 и SEQ ID NO: 90.

В некоторых аспектах нечеловеческое антитело является гуманизированным, причем специфические последовательности или области антитела модифицированы для увеличения сходства с антителом, образуемым в естественным условиях у человека, или его фрагментом. В одном аспекте антигенсвязывающий домен является гуманизированным.

Гуманизированное антитело может быть получено с использованием различных методов, известных в данной области техники, включая, но без ограничения, CDR-прививку (смотрите, например, Европейский патент № ЕР 239400; публикацию международной заявки № WO 91/09967; и патенты США №№ 5225539, 5530101 и 5585089, каждый из которых включен сюда во всей своей полноте посредством ссылки), венерование или изменение поверхности (смотрите, например, Европейский патент № ЕР 592106 и № ЕР 519596; Padlan, 1991, Molecular Immunology, 28 (4/5): 489-498; Studnicka et al., 1994, Protein Engineering, 7(6): 805-814; и Roguska et al., 1994, PNAS, 91: 969-973, каждый из которых включен сюда во всей своей полноте посредством ссылки), перетасовку цепей (смотрите, например, патент США № 5565332, который включен сюда во всей своей полноте посредством ссылки) и методы, описанные, например, в публикации заявки на патент США № US2005/0042664, публикации заявки на патент США № US2005/0048617, патенте США № 6407213, патенте США № 5766886, публикации международной заявки № WO 9317105, Tan et al., 2002, J. Immunol., 169: 1119-25; Caldas et al., 2000, Protein Eng., 13(5): 353-60; Morea et al., 2000, Methods, 20: 267-79; Baca et al., 1997, J. Biol. Chem., 272: 10678-84; Roguska et al., 1996, Protein Eng., 9(10): 895-904; Couto et al., 1995, Cancer Res., 55: 5973s-5977; Couto et al., 1995, Cancer Res., 55(8): 1717-22; Sandhu 1994 Gene, 150(2): 409-10; и Pedersen et al., 1994, J. Mol. Biol, 235(3): 959-73, каждый из которых включен сюда во всей своей полноте посредством ссылки. Часто каркасные остатки в каркасных областях будут заменены соответствующим остатком из антитела-донора CDR с целью изменения, например, увеличения, связывания с антигеном. Эти замены в каркасных областях идентифицируют способами, хорошо известными в данной области техники, например, путем моделирования взаимодействий остатков CDR и каркасных остатков для идентификации каркасных остатков, важных для связывания с антигеном, и сравнения последовательностей для выявления необычные каркасных остатков в конкретных положениях. (Смотри, например, Queen et al., патент США № 5585089; и Riechmann et al., 1988, Nature, 332: 323, которые включены сюда во всей своей полноте посредством ссылки).

Гуманизированное антитело или фрагмент антитела имеет один или более аминокислотных остатков, остающихся в нем из источника, который является нечеловеческим. Эти нечеловеческие аминокислотные остатки часто называют «импортными» остатками, которые обычно берут из «импортного» вариабельного домена. Как здесь предусмотрено, гуманизированные антитела или фрагменты антител включают один или более CDR из нечеловеческих молекул иммуноглобулинов и каркасные области, причем аминокислотные остатки, составляющие каркасную область, происходят полностью или в основном из зародышевой линии человека. Множество методов гуманизации антител или фрагментов антител хорошо известны в данной области техники и могут быть выполнены по существу в соответствии со способом Winter и сотрудников (Jones et al., Nature, 321: 522-525 (1986); Riechmann et al., Nature, 332: 323-327 (1988); Verhoeyen et al., Science, 239: 1534-1536 (1988)), путем замены CDR грызунов или последовательностями CDR грызунов соответствующих последовательностей антитела человека, т.е. CDR-прививки (EP 239400; публикация РСТ-заявки № WO 91/09967 и патенты США №№ 4816567; 6331415; 5225539; 5530101; 5585089; 6548640, содержание которых включено сюда посредством ссылки во всей их полноте). В таких гуманизированных антителах и фрагментах антител в значительной степени меньше, чем интактный человеческий вариабельный домен был заменен соответствующей последовательностью из не являющегося человеком вида. Гуманизированные антитела часто представляют собой антитела человека, в которых некоторые остатки CDR и, возможно, некоторые остатки каркасных областей (FR) заменены остатками из аналогичных участков в антителах грызунов. Гуманизации антител и фрагментов антител можно также достичь путем венерования или изменения поверхности (EP 592106; EP 519596; Padlan, 1991, Molecular Immunology, 28(4/5): 489-498; Studnicka et al., Protein Engineering, 7(6): 805-814 (1994); и Roguska et al., PNAS, 91:969-973 (1994)) или перетасовки цепей (патент США № 5565332), содержание которых включено сюда посредством ссылки во всей их полноте.

Результатом выбора вариабельных доменов человека, как легких, так и тяжелых цепей, которые будут использоваться при получении гуманизированных антител, является снижение антигенности. В соответствии с так называемым способом «наилучшего соответствия», последовательность вариабельного домена антитела грызуна скринируют по всей библиотеке известных последовательностей вариабельных доменов человека. Последовательность человека, которая наиболее близка к последовательности грызуна, затем принимают в качестве человеческой каркасной области (FR) для гуманизированного антитела (Sims et al., J. Immunol., 151: 2296 (1993); Chothia et al., J. Mol. Biol., 196: 901 (1987), содержание которых включено сюда посредством ссылки во всей их полноте). В другом способе используется конкретная каркасная область, полученная из консенсусной последовательности для всех антител человека конкретной подгруппы легких или тяжелых цепей. Одна и та же каркасная область может использоваться для нескольких различных гуманизированных антител (смотрите, например, Carter et al., Proc. Natl. Acad. Sci. USA, 89: 4285 (1992); Presta et al., J. Immunol., 151: 2623 (1993), содержание которых включено сюда посредством во всей их полноте).

В некоторых аспектах часть структуры CAR по настоящему изобретению, которая включает фрагмент антитела, является гуманизированной с сохранением высокой аффинности к антигену-мишени и других подходящих биологических свойств. В соответствии с одним аспектом настоящего изобретения гуманизированные антитела и фрагменты антител получают с помощью процесса анализа исходных последовательностей и различных концептуальных гуманизированных продуктов с использованием трехмерных моделей исходных и гуманизированных последовательностей. Трехмерные модели иммуноглобулинов являются общедоступными и известны квалифицированным в данной области техники специалистам. В наличии имеются компьютерные программы, которые иллюстрируют и демонстрируют возможные трехмерные конформационные структуры выбранных кандидатных последовательностей иммуноглобулина. Осмотр этих демонстраций позволяет проанализировать вероятную роль остатков в функционировании последовательности иммуноглобулина-кандидата, например, проанализировать остатки, которые влияют на способность иммуноглобулина-кандидата к связыванию с антигеном-мишенью. Таким образом, остатки FR могут быть выбраны из реципиентных и импортных последовательностей и объединены, так что достигается требуемая характеристика антитела или фрагмента антитела, такая как увеличенная аффинность к антигену-мишени. В общем, остатки CDR непосредственно и наиболее существенно участвуют во влиянии на связывание антигена.

В одном аспекте связывающим доменом антитела против EGFRvIII является, например, Fv, Fab или (Fab')2, или бифункциональное (например, биспецифическое) гибридное антитело (например, Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)). В одном аспекте предусмотренным здесь фрагментом антитела является scFv. В одном аспекте scFv связывает белок EGFRvIII, но не EGFR дикого типа. В некоторых случаях scFv человека может быть также получен из библиотеки дрожжевого дисплея.

В некоторых случаях scFv могут быть приготовлены в соответствии со способом, известным в данной области техники (смотрите, например, Bird et al., (1988) Science 242: 423-426 и Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85: 5879-5883). Молекулы scFv могут быть получены путем связывания VH- и VL-областей вместе с использованием гибких полипептидных линкеров. Молекулы scFv включают линкер (например, линкер Ser-Gly) оптимизированной длины и/или с оптимизированным аминокислотным составом. Длина линкера может сильно влиять на то, каким образом вариабельные области scFv будут укладываться и взаимодействовать. В самом деле, если используется короткий полипептидный линкер (например, 5-10 аминокислот), внутрицепочечная укладка предотвращается. Межцепочечная укладка также требуется для сближения двух вариабельных областей для формирования функционального сайта связывания эпитопа. Для примеров ориентации и размер линкера смотрите, например, Hollinger et al. 1993 Proc Natl Acad. Sci. U.S.A. 90: 6444-6448, публикацию заявки на патент США №№ 2005/0100543, 2005/0175606, 2007/0014794 и публикацию РСТ-заявки №№ WO2006/020258 и WO2007/024715, которые включены сюда посредством ссылки.

ScFv может включать линкер из по крайней мере 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50 или более аминокислотных остатков между своими VL- и VH-областями. Последовательность линкера может включать любую встречающуюся в природе аминокислоту. В некоторых вариантах осуществления последовательность линкера включает аминокислоты глицин и серин. В другом варианте осуществления последовательность линкера включает ряды повторов глицина и серина, такие как (Gly4Ser)n (SEQ ID NO: 37), где n - положительное целое число, равное или большее 1. В одном варианте осуществления линкером может быть (Gly4Ser)4 (SEQ ID NO: 113) или (Gly4Ser)3 (SEQ ID NO: 114). В результате изменения длины линкера активность может сохраняться или повышаться, что приводит к большей эффективности в исследованиях активности.

Стабильность и мутации

Стабильность связывающего домена антитела против EGFRvIII, например, молекул scFv (например, растворимого scFv), можно оценить относительно биофизических свойств (например, термостабильности) обычной контрольной молекулы scFv или полноразмерного антитела. В одном варианте осуществления гуманизированный scFv имеет термостабильность, превышающую на приблизительно 0,1, приблизительно 0,25, приблизительно 0,5, приблизительно 0,75, приблизительно 1, приблизительно 1,25, приблизительно 1,5, приблизительно 1,75, приблизительно 2, приблизительно 2,5, приблизительно 3, приблизительно 3,5 приблизительно 4, приблизительно 4,5, приблизительно 5, приблизительно 5,5, приблизительно 6, приблизительно 6,5, приблизительно 7, приблизительно 7,5, приблизительно 8, приблизительно 8,5, приблизительно 9, приблизительно 9,5, приблизительно 10 градусов, приблизительно 11 градусов, приблизительно 12 градусов, приблизительно 13 градусов, приблизительно 14 градусов или приблизительно 15 градусов по Цельсию таковую контрольной связывающей молекулы (например, обычной молекулы scFv) в описанных анализах.

Увеличенная термостабильность связывающего домена антитела против EGFRvIII, например, scFv, впоследствии придается всей конструкции EGFRvIII-специфического CAR, что приводит к улучшению терапевтических свойств конструкции EGFRvIII-специфического CAR. Термостабильность связывающего домена антитела против EGFRvIII, например, scFv, может быть увеличена на по крайней мере приблизительно 2°C или 3°C по сравнению с обычным антителом. В одном варианте осуществления связывающий домен антитела против EGFRvIII, например, scFv, имеет увеличенную на 1°C термостабильность по сравнению с обычным антителом. В другом варианте осуществления связывающий домен антитела против EGFRvIII, например, scFv, имеет увеличенную на 2°C термостабильность по сравнению с обычным антителом. В другом варианте осуществления связывающий домен антитела против EGFRvIII, например, scFv, имеет увеличенную на 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15°C термостабильность по сравнению с обычным антителом. Сравнения могут быть сделаны, например, между молекулами scFv, описанными здесь, и молекулами scFv или Fab-фрагментами антитела, из которого происходят VH и VL scFv. Термостабильность может быть измерена с помощью методов, известных в данной области техники. Например, в одном варианте осуществления может быть измерена Tm. Методы измерения Tm и другие методы определения стабильности белков описаны подробнее ниже.

Мутации в scFv (возникающие в результате гуманизации или прямого мутагенеза растворимого scFv) изменяют стабильность scFv и увеличивают общую стабильность scFv и конструкции EGFRvIII-специфического CAR. Стабильность гуманизированного scFv сравнивают с таковой scFv мыши, используя такие измерения, как Tm, температура денатурации и температура агрегации. Способность к связыванию мутантных scFv можно определить, используя анализы, описанных в разделе «Примеры».

В одном варианте осуществления связывающий домен антитела против EGFRvIII, например, scFv, содержит по крайней мере одну мутацию, возникающую в процессе гуманизации, из условия, чтобы мутантный scFv придавал увеличенную стабильность EGFRvIII-специфической конструкции. В другом варианте осуществления связывающий домен антитела против EGFRvIII, например, scFv, содержит по крайней мере 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 мутаций, возникающих в процессе гуманизации, из условия, чтобы мутантный scFv придавал увеличенную стабильность EGFRvIII-специфической конструкции.

Способы оценки стабильности белков

Стабильность антигенсвязывающего домена можно оценить, используя, например, способы, описанные ниже. Такие способы позволяют определить множество термически инициированных конформационных переходов с разворачиванием, причем наименее стабильный домен или разворачивается первым, или ограничивает порог общей стабильности многодоменного блока, который разворачивается кооперативно (например, многодоменного белка, который демонстрирует один конформационный переход с разворачиванием). Наименее стабильный домен можно идентифицировать рядом дополнительных способов. Мутагенез может быть выполнен, чтобы исследовать, какой домен ограничивает общую стабильность. Кроме того, устойчивость к протеазам многодоменного белка может быть исследована в условиях, когда наименее стабильный домен, как известно благодаря DSC или другим спектроскопическим методам, является по сути развернутым (Fontana, et al., (1997) Fold. Des., 2: R17-26; Dimasi et al. (2009) J. Mol. Biol. 393: 672-692). После идентификации наименее стабильного домена последовательность, кодирующую этот домен (или его часть), можно использовать в качестве тестовой последовательности в способах.

a) Термостабильность

Термостабильность структур можно проанализировать с использованием ряда неограничивающих биофизических или биохимических методов, известных в данной области техники. В некоторых вариантах осуществления термостабильность оценивают с помощью аналитической спектроскопии.

Приводимым в качестве примера методом аналитической спектроскопии является дифференциальная сканирующая калориметрия (DSC). При выполнении DSC используется калориметр, который чувствителен к теплопоглощениям, которые сопровождают развертывание большинства белков или белковых доменов (смотрите, например, Sanchez-Ruiz, et al., Biochemistry, 27: 1648-52, 1988). Для определения термостабильности белка образец белка помещают в калориметр, и температуру повышают до тех пор, пока Fab или scFv не развернется. Температура, при которой белок разворачивается, является показателем общей стабильности белка.

Другим приводимым в качестве примера методом аналитической спектроскопии является спектроскопия кругового дихроизма (CD). В случае CD-спектрометрии измеряется оптическая активность структуры в зависимости от повышения температуры. В случае спектроскопии кругового дихроизма (CD) определяется различия в поглощении света с левовращающей поляризацией и света с правовращающей поляризацией, которые возникают из-за структурной асимметрии. Неупорядоченная или развернутая структура приводит в CD-спектру, очень отличному от такового упорядоченной или свернутой структуры. CD-спектр отражает чувствительность белков к денатурирующим эффектам повышения температуры и, следовательно, является показателем термостабильности белков (смотрите van Mierlo and Steemsma, J. Biotechnol, 79 (3): 281-98, 2000).

Другим приводимым в качестве примера методом аналитической спектроскопии для определения термостабильности является флуоресцентная спектроскопия (смотрите van Mierlo and Steemsma, выше). Еще одним приводимым в качестве примера методом аналитической спектроскопии для определения термостабильности является спектроскопия ядерного магнитного резонанса (ЯМР) (смотрите van Mierlo and Steemsma, выше).

Термостабильность структуры можно измерить биохимически. Приводимым в качестве примера биохимическим методом для оценки термостабильности является анализ теплового испытания. В ходе «анализа теплового испытания» структуру подвергают воздействию диапазона повышенных температур в течение заданного периода времени. Например, в одном варианте осуществления тестовые молекулы scFv или молекулы, включающие молекулы scFv, подвергают воздействию диапазона увеличивающихся температур, например, в течение 1-1,5 часов. Активность белка затем анализируют с помощью соответствующего биохимического анализа. Например, если белком является связывающий белок (например, scFv или scFv-содержащий полипептид), активность связывания связывающего белка можно определить с помощью функционального или количественного ELISA.

Такой анализ может быть осуществлен в формате высокой пропускной способности и форматах, описанных в разделе «Примеры», используя E. coli и скрининг с высокой пропускной способностью. Библиотека вариантов связывающего домена антитела против EGFRvIII, например, scFv, может быть создана, используя способы, известные в данной области техники. Экспрессия связывающего домена антитела против EGFRvIII, например, scFv, может быть индуцирована, и связывающий домен антитела против EGFRvIII, например, scFv, может быть подвергнут тепловому испытанию. Подвергнутые испытанию тестовые образцы можно проанализировать на связывание, и те связывающие домены антитела против EGFRvIII, например, scFvs, которые являются стабильными, могут быть увеличены в масштабе и далее охарактеризованы.

Термостабильность оценивается путем измерения температуры плавления (Tm) структуры с использованием любого из вышеуказанных методов (например, методов аналитической спектроскопии). Температура плавления представляет собой температуру в средней точке кривой теплового перехода, при которой 50% молекул структуры находится в свернутом состоянии (смотри, например, Dimasi et al. (2009) J. Mol Biol. 393: 672-692). В одном варианте осуществления значения Tm для связывающего домена антитела против EGFRvIII, например, scFv, составляют приблизительно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C. В одном варианте осуществления значения Tm для IgG составляют приблизительно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C. В одном варианте осуществления значения Tm для поливалентного антитела составляют приблизительно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C.

Термостабильность также оценивают путем измерения теплоемкости (Cp) структуры, используя аналитический колориметрический метод (например, DSC). Теплоемкость структуры - энергия (например, в ккал/моль), которая требуется для повышения на 1°C температуры 1 моля воды. Так большая Ср является признаком денатурированной или неактивной белковой структуры. Изменение теплоемкости (ΔCp) структуры измеряется путем определения теплоемкости структуры до и после его теплового перехода. Термостабильность может быть также оценена путем измерения или определения других параметров термодинамической стабильности, включая свободную энергию Гиббса разворачивания (ΔG), энтальпию разворачивания (ΔΗ) или энтропию разворачивания (ΔS). Один или более из вышеуказанных биохимических анализов (например, анализ теплового испытания) используются для определения температуры (т.е. значения ТС), при которой 50% структуры сохраняют свою активность (например, активность связывания).

Кроме того, мутации в связывающем домене антитела против EGFRvIII, например, scFv, изменяют термостабильность связывающего домена антитела против EGFRvIII, например, scFv, по сравнению с не мутированным связывающим доменом антитела против EGFRvIII, например, scFv. Когда связывающий домен гуманизированного антитела против EGFRvIII, например, scFv, включен в конструкцию CAR на основе антитела против EGFRvIII, связывающий домен антитела против EGFRvIII, например, гуманизированный scFv, придает термостабильность всей конструкции CAR на основе антитела против EGFRvIII. В одном варианте связывающий домен антитела против EGFRvIII, например, scFv, содержит одну мутацию, которая придает термостабильность связывающему домену антитела против EGFRvIII, например, scFv. В другом варианте связывающий домен антитела против EGFRvIII, например, scFv, содержит множество мутаций, которые придают термостабильность связывающему домену антитела против EGFRvIII, например, scFv. В одном варианте осуществления множество мутации в связывающем домене антитела против EGFRvIII, например, scFv, оказывают аддитивный эффект на термостабильность связывающего домен антитела против EGFRvIII, например, scFv.

b) % Агрегация

Стабильность структуры можно определить путем измерения ее склонности к агрегации. Агрегация может быть определена с помощью ряда неограничивающих биохимических или биофизических методов. Например, агрегация структуры может быть оценена с помощью хроматографии, например, гель-хроматографии (SEC). В ходе SEC молекулы разделяются на основе размера. Колонку заполняют полутвердыми гранулами полимерного геля, которые будут пропускать внутрь себя ионы и небольшие молекулы, но не большие молекулы. Когда белковую композицию вносят в верхнюю часть колонки, компактные свернутые белки (т.е. не агрегированные белки) распределяются по большему объему растворителя, чем тот, который находится в распоряжении крупных белковых агрегатов. Следовательно, крупные агрегаты движутся быстрее через колонку, и таким образом смесь можно разделить или фракционировать на ее компоненты. Каждую фракцию можно отдельно подвергнуть количественному анализу (например, с помощью рассеяния света), по мере того как она элюируется из геля. Соответственно, % агрегации структуры можно определить путем сравнения концентрации фракции с общей концентрацией белка, внесенного в гель. Стабильные структуры элюируют с колонки в виде по существу одной фракции и появляются в виде по существу одного пика в профиле элюции или на хроматограмме.

с) Аффинность

Устойчивость структуры моно оценить путем определения ее аффинности к мишени. Широкий ряд методов определения аффинности известен в данной области техники. В иллюстративном методе определения аффинности используется поверхностный плазмонный резонанс. Поверхностный плазмонный резонанс представляет собой оптическое явление, которое позволяет проводить анализ в режиме реального времени биоспецифических взаимодействий по детекции изменений концентраций белка в матрице биосенсора, например, с использованием системы BIAcore (Pharmacia Biosensor AB, Uppsala, Sweden и Piscataway, N.J.). Для дальнейших описаний смотрите Jonsson, U., et al. (1993) Ann. Biol. Clin. 51: 19-26; Jonsson, U., i (1991) Biotechniques 11: 620-627; Johnsson, B., et al. (1995) J. Mol. Recognit. 8: 125-131; и Johnnson, B., et al. (1991) Anal. Biochem. 198: 268-277.

В одном аспекте антигенсвязывающий домен CAR включает аминокислотную последовательность, которая является гомологичной аминокислотной последовательности антигенсвязывающего домена, описанной здесь, и антигенсвязывающий домен сохраняет желаемые функциональные свойства фрагментов антител против EGFRvIII, описанных здесь. В одном конкретном аспекте структура CAR настоящего изобретения включает фрагмент антитела. В дальнейшем аспекте фрагмент антитела включает scFv.

В различных аспектах антигенсвязывающий домен CAR создают путем модификации одной или более аминокислот в одной или обеих вариабельных областях (например, VH и/или VL), например, в одном или более CDR-участков и/или в одной или более каркасных областей. В одном конкретном аспекте структура CAR настоящего изобретения включает фрагмент антитела. В дальнейшем аспекте фрагмент антитела включает scFv.

Специалисту со средним уровнем компетентности в данной области техники будет понятно, что антитело или фрагмент антитела настоящего изобретения можно подвергнуть дополнительным модификациям из условия, чтобы они отличались по аминокислотной последовательности (например, от дикого типа), но не по желаемой активности. Например, дополнительные нуклеотидные замены, ведущие к заменам аминокислот в положениях «несущественных» аминокислотных остатков, могут быть осуществлены в белке. Например, несущественный аминокислотный остаток в молекуле может быть заменен другим аминокислотным остатком из того же семейства боковых цепей. В другом варианте осуществления ряд аминокислот может быть заменен структурно аналогичным рядом, который отличается порядком и/или составом членов семейства боковых цепей, например, может быть осуществлена консервативная замена, при которой аминокислотный остаток заменяют на аминокислотный остаток, имеющий сходную боковую цепь.

В данной области техники были определены семейства аминокислотных остатков, имеющих сходные боковые цепи, включая основные боковые цепи (например, лизин, аргинин, гистидин), кислые боковые цепи (например, аспарагиновую кислоту, глютаминовую кислоту), незаряженные полярные боковые цепи (например, глицин, аспарагин, глютамин, серин, треонин, тирозин, цистеин), неполярные боковые цепи (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан), бета-разветвленные боковые цепи (например, треонин, валин, изолейцин) и ароматические боковые цепи (например, тирозин, фенилаланин, триптофан, гистидин).

Процент идентичности в контексте двух или более последовательностей нуклеиновых кислот или полипептидных последовательностей относится к двум или более последовательностей, которые являются одинаковыми. Две последовательности являются «по существу идентичными», если две последовательности имеют определенный процент аминокислотных остатков или нуклеотидов, которые являются одинаковыми (например, составляющую 60% идентичность, в некоторых случаях составляющую 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичность по заданной области, или, если не указано, по всей последовательности), при сравнении и совмещении для максимального соответствия в окне сравнения, или на протяжении намеченного района, как определено с помощью одного из следующих алгоритмов сравнения последовательностей или путем совмещения вручную и визуального осмотра. Дополнительно, идентичность существует на протяжении района, длина которого составляет по крайней мере приблизительно 50 нуклеотидов (или 10 аминокислот), или более предпочтительно на протяжении района, длина которого составляет от 100 до 500 или 1000 или более нуклеотидов (или 20, 50, 200 или более аминокислот).

Для сравнения последовательностей, как правило, одна последовательность выполняет функцию контрольной последовательности, с которой сравнивают тестовые последовательности. При использовании алгоритма сравнения последовательностей тестовые и контрольные последовательности вводят в компьютер, задают координаты подпоследовательностей, если необходимо, и задаются параметры программы с использованием алгоритма сравнения последовательностей. Параметры программы по умолчанию могут использоваться, или альтернативные параметры могут быть заданы. Затем алгоритм сравнения последовательностей рассчитывает процент идентичности последовательностей для тестовых последовательностей относительно контрольной последовательности, на основе параметров программы. Методы совмещения последовательностей с целью сравнения хорошо известны в данной области техники. Оптимальное совмещение последовательностей с целью сравнения может быть проведено, например, с помощью алгоритма локальной гомологии Smith и Waterman, (1970) Adv. Appl. Math. 2:482c, с помощью алгоритма совмещения на основе гомологии Needleman и Wunsch, (1970) J. Mol. Biol. 48: 443, с помощью метода поиском подобия Pearson и Lipman, (1988) Proc. Nat'l. Acad. Sci. USA 85: 2444, с использованием компьютерных реализаций этих алгоритмов (GAP, BESTFIT, FASTA и TFASTA в пакете программного обеспечения Wisconsin Genetics, Genetics Computer Group, 575 Science Dr., Madison, WI), или с помощью совмещения вручную и визуального осмотра (смотрите, например, Brent et al., (2003) Current Protocols in Molecular Biology).

Двумя примерами алгоритмов, которые подходят для определения процента идентичности последовательностей и сходства последовательностей, являются алгоритмы BLAST и BLAST 2.0, описанные в Altschul et al., (1977) Nuc. Acids Res. 25: 3389-3402; и Altschul et al., (1990) J. Mol. Biol. 215: 403-410, соответственно. Программное обеспечение для выполнения анализов BLAST общедоступно через Национальный центр биотехнологической информации.

Процент идентичности между двумя аминокислотными последовательностями может быть также определен с использованием алгоритма Е. Meyers и W. Miller, (1988) Comput. Appl. Biosci. 4: 11-17), который был включен в программу ALIGN (версия 2.0), используя таблицу весов замен остатков РАМ120, штраф на длину гэпа - 12 и штраф за открытие гэпа - 4. Кроме того, процент идентичности между двумя аминокислотными последовательностями можно определить, используя алгоритм Needleman и Wunsch (1970) J. Mol. Biol. 48: 444-453), который был включен в программу GAP в пакете программ GCG (имеющихся на сайте www.gcg.com), используя или матрицу Blossom 62, или матрицу РАМ250 и штраф за открытие гэпа = 16, 14, 12, 10, 8, 6 или 4 и штраф за длину гэпа = 1, 2, 3, 4, 5 или 6.

В одном аспекте настоящим изобретением предусматриваются модификации исходной аминокислотной последовательности антитела или фрагмента (например, scFv), которые создают функционально эквивалентные молекулы. Например, VH или VL связывающего домена антитела против EGFRvIII, например, scFv, в составе CAR, могут быть модифицированы с сохранением составляющей по крайней мере приблизительно 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности каркасной области исходной VH или VL связывающего домена антитела против EGFRvIII, например, scFv. Настоящим изобретением предусматриваются модификации всей конструкции CAR, например, модификации в одной или более аминокислотных последовательностей различных доменов конструкции CAR для создания функционально эквивалентных молекул. Конструкция CAR может быть модифицирована с сохранением составляющей по крайней мере приблизительно 70%, 71%, 72%. 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности исходной конструкции CAR.

Трансмембранный домен

Что касается трансмембранного домена, в различных вариантах осуществления может быть сконструирован CAR, который включает трансмембранный домен, присоединенный к экстраклеточному домену CAR. Трансмембранный домен может включать одну или более дополнительных аминокислот, примыкающий к трансмембранному району, например, одну или более аминокислот, связанных с экстраклеточным районом белка, из которого был получен трансмембранный белок, (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 до 15 аминокислот экстраклеточного района) и/или одну или более дополнительных аминокислот, связанных с внутриклеточным районом белка, из которого получен трансмембранный белок, (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 до 15 аминокислот внутриклеточного района). В одном аспекте трансмембранным доменом является домен, который связан с одним из других доменов CAR. В некоторых случаях трансмембранный домен может быть выбран или модифицирован путем замены аминокислот во избежание связывания таких доменов с трансмембранными доменами тех же или отличных белков оболочки, например, чтобы свести к минимуму взаимодействия с другими членами рецепторного комплекса. В одном аспекте трансмембранный домен способен к гомодимеризации с другим CAR на поверхности CAR-T-клетки. В отличном аспекте аминокислотная последовательность трансмембранного домена может быть изменена или заменена таким образом, чтобы свести к минимуму взаимодействия со связывающими доменами природного партнера по связыванию, присутствующего в той же CAR-T-клетке.

Трансмембранный домен может быть получен или из природного, или из рекомбинантного источника. Если источник является природным, домен может быть получен из любого мембраносвязанного или трансмембранного белка. В одном аспекте трансмембранный домен способен к передаче сигналов на внутриклеточный домен(ы), всякий раз когда CAR связывается с мишенью. Трансмембранный домен, имеющий конкретное применение в этом изобретении, может включать по крайней мере трансмембранный район(ы), например, альфа, бета или дзета цепи Т-клеточного рецептора, CD28, CD3 эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.

В некоторых случаях трансмембранный домен может быть присоединен к экстраклеточному району CAR, например, антигенсвязывающему домену CAR, с помощью шарнирной области, например, шарнирной области из белка человека. Например, в одном варианте осуществления шарнирной областью может быть шарнирная область Ig (иммуноглобулина) человека, например, шарнирная область IgG4 или шарнирная область CD8a. В одном варианте осуществления шарнирная область или спейсер включает (например, состоит из) аминокислотную последовательность SEQ ID NO: 14. В одном аспекте трансмембранный домен включает (например, состоит из) трансмембранный домен SEQ ID NO: 15.

В одном аспекте шарнирная область или спейсер включает шарнирную область IgG4. Например, в одном варианте осуществления шарнирная область или спейсер включает шарнирную область с аминокислотной последовательностью ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKM (SEQ ID NO: 104). В некоторых вариантах осуществления шарнирная область или спейсер включает шарнирную область, кодируемую нуклеотидной последовательностью GAGAGCAAGTACGGCCCTCCCTGCCCCCCTTGCCCTGCCCCCGAGTTCCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGTGTGGTGGTGGACGTGTCCCAGGAGGACCCCGAGGTCCAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCCCGGGAGGAGCAGTTCAATAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAATACAAGTGTAAGGTGTCCAACAAGGGCCTGCCCAGCAGCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTCGGGAGCCCCAGGTGTACACCCTGCCCCCTAGCCAAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTGGACAAGAGCCGGTGGCAGGAGGGCAACGTCTTTAGCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGGGCAAGATG (SEQ ID NO: 105).

В одном аспекте шарнирная область или спейсер включает шарнирную область IgD. Например, в одном варианте осуществления шарнирная область или спейсер включает шарнирную область аминокислотной последовательности RWPESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTPECPSHTQPLGVYLLTPAVQDLWLRDKATFTCFVVGSDLKDAHLTWEVAGKVPTGGVEEGLLERHSNGSQSQHSRLTLPRSLWNAGTSVTCTLNHPSLPPQRLMALREPAAQAPVKLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPATYTCVVSHEDSRTLLNASRSLEVSYVTDH (SEQ ID NO: 106). В некоторых вариантах осуществления шарнирная область или спейсер включает шарнирную область, кодируемую нуклеотидной последовательностью AGGTGGCCCGAAAGTCCCAAGGCCCAGGCATCTAGTGTTCCTACTGCACAGCCCCAGGCAGAAGGCAGCCTAGCCAAAGCTACTACTGCACCTGCCACTACGCGCAATACTGGCCGTGGCGGGGAGGAGAAGAAAAAGGAGAAAGAGAAAGAAGAACAGGAAGAGAGGGAGACCAAGACCCCTGAATGTCCATCCCATACCCAGCCGCTGGGCGTCTATCTCTTGACTCCCGCAGTACAGGACTTGTGGCTTAGAGATAAGGCCACCTTTACATGTTTCGTCGTGGGCTCTGACCTGAAGGATGCCCATTTGACTTGGGAGGTTGCCGGAAAGGTACCCACAGGGGGGGTTGAGGAAGGGTTGCTGGAGCGCCATTCCAATGGCTCTCAGAGCCAGCACTCAAGACTCACCCTTCCGAGATCCCTGTGGAACGCCGGGACCTCTGTCACATGTACTCTAAATCATCCTAGCCTGCCCCCACAGCGTCTGATGGCCCTTAGAGAGCCAGCCGCCCAGGCACCAGTTAAGCTTAGCCTGAATCTGCTCGCCAGTAGTGATCCCCCAGAGGCCGCCAGCTGGCTCTTATGCGAAGTGTCCGGCTTTAGCCCGCCCAACATCTTGCTCATGTGGCTGGAGGACCAGCGAGAAGTGAACACCAGCGGCTTCGCTCCAGCCCGGCCCCCACCCCAGCCGGGTTCTACCACATTCTGGGCCTGGAGTGTCTTAAGGGTCCCAGCACCACCTAGCCCCCAGCCAGCCACATACACCTGTGTTGTGTCCCATGAAGATAGCAGGACCCTGCTAAATGCTTCTAGGAGTCTGGAGGTTTCCTACGTGACTGACCATT (SEQ ID NO:107).

В одном аспекте трансмембранный домен может быть рекомбинантный, в этом случае он будет содержать преимущественно гидрофобные остатки, такие как лейцин и валин. В одном аспекте триплет из фенилаланина, триптофана и валина может быть обнаружен на каждом конце рекомбинантного трансмембранного домена.

Необязательно, короткий олиго- или полипептидный линкер, например, длиной от 2 до 10 аминокислот, может формировать связь между трансмембранным доменом и цитоплазматическим районом CAR. Дублет глицин-серин является примером подходящего линкера. Например, в одном аспекте линкер включает аминокислотную последовательность GGGGSGGGGS (SEQ ID NO: 108). В некоторых вариантах осуществления линкер кодируется нуклеотидной последовательностью GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO:109).

Цитоплазматический домен

Цитоплазматический домен или район CAR включает внутриклеточный домен сигнализации. Внутриклеточный домен сигнализации, как правило, ответственен за активацию по крайней мере одной из обычных эффекторных функций иммуноцита, в который был введен CAR. Термин «эффекторная функция» относится к специализированной функции клетки. Эффекторной функцией Т-клетки, например, могут быть цитолитическая активность или хелперная активности, включая секрецию цитокинов. Таким образом, термин «внутриклеточный домен сигнализации» относится к части белка, которая трансдуцирует сигнал для эффекторной функции и предписывает клетке выполнение специализированной функции. Хотя обычно весь внутриклеточный домен сигнализации может использоваться, во многих случаях нет необходимости использовать всю цепь. Если используется усеченная часть внутриклеточного домена сигнализации, такая усеченная часть может использоваться вместо интактной цепи при условии, что она трансдуцирует сигнал для эффекторной функции. Таким образом, термин «внутриклеточный домен сигнализация» как подразумевается, включает любую усеченную часть внутриклеточного домена сигнализации, достаточную для трансдукции сигнала для эффекторной функции.

Примеры внутриклеточных доменов сигнализации для использования в CAR по настоящему изобретению включают цитоплазматические последовательности Т-клеточного рецептора (TCR) и корецепторов, которые действуют совместно, чтобы инициировать сигнальную трансдукцию после задействования антигенспецифического рецептора, а также любое производное или вариант этих последовательностей и любая рекомбинантная последовательность, которая имеет те же функциональные возможности.

Известно, что сигналы, генерируемые благодаря одному только TCR, являются недостаточными для полной активации Т-клетки, и что также требуется вторичный и/или костимулирующий сигнал. Таким образом, можно сказать, что активация Т-клетки осуществляется при посредничестве двух различных классов цитоплазматических сигнальных последовательностей: тех, которые инициируют антигензависимую первичную активацию через TCR, (внутриклеточных доменов первичной сигнализации) и тех, которые действуют независимым от антигена образом, чтобы обеспечить вторичный или костимулирующий сигнал (цитоплазматического домена вторичной сигнализации, например, костимулирующего домена).

Домен первичной сигнализации регулирует первичную активацию TCR комплекса или стимулирующим образом, или ингибирующим образом. Внутриклеточные домены первичной сигнализации, которые действуют стимулирующим образом, могут содержать мотивы сигнализации, которые известны как иммунорецепторные тирозиновые активирующие мотивы или ITAM.

Примеры ITAM-содержащих внутриклеточных доменов первичной сигнализации, которые имеют конкретное применение в настоящем изобретении, включают таковые из TCR дзета, FcR гамма, FcR бета, CD3 гамма, CD3 дельта, CD3 эпсилон, CD5, CD22, CD79a, CD79b, и CD66d. В одном варианте осуществления CAR по настоящему изобретению, например, CAR, выбираемый из группы, состоящей из SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79 и SEQ ID NO: 85, включает внутриклеточный домен сигнализации, например, домен первичной сигнализации CD3-дзета. В одном варианте осуществления домен первичной сигнализации включает модифицированный домен ITAM, например, мутированный домен ITAM, который обладает измененной (например, увеличенной или уменьшенной) активность по сравнению с природным доменом ITAM. В одном варианте осуществления домен первичной сигнализации включает модифицированный, ITAM-содержащий внутриклеточный домен первичной сигнализации, например, оптимизированный и/или усеченный ITAM-содержащий внутриклеточный домен первичной сигнализации. В одном варианте осуществления домен первичной сигнализации включает один, два, три, четыре или более мотивов ITAM.

Внутриклеточный домен сигнализации CAR может включать домен сигнализации CD3-дзета сам по себе, или он может быть объединен с любым другим желаемым внутриклеточным доменом(ами) сигнализации, используемым в связи с CAR по настоящему изобретению. Например, внутриклеточный домен сигнализации CAR может включать часть CD3 дзета-цепи и домен костимулирующей сигнализации. Домен костимулирующей сигнализации относится к части CAR, включающей внутриклеточный домен костимулирующей молекулы. Костимулирующей молекулой является молекула клеточной поверхности, отличная от антигенспецифического рецептора или его лигандов, которая необходима для эффективной ответной реакции лимфоцитов на антиген. Примеры таких молекул включают CD27, CD28, 4-1ВВ (CD137), OX40, CD30, CD40, PD-1, ICOS, связанный с функционированием лимфоцитов антиген-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, В7-H3 и лиганд, который специфически связывается с CD83, и т.п. Например, костимуляция CD27, как было продемонстрировано, приводит к увеличению роста, эффекторной функции и выживания CAR-T-клеток человека in vitro и увеличению выживания Т-клеток человека и противоопухолевой активностью in vivo (Song et al. Blood. 2012; 119 (3): 696-706).

Внутриклеточные сигнальные последовательности в цитоплазматической части CAR по настоящему изобретению могут быть связаны друг с другом в произвольном или определенном порядке. Необязательно, короткий олиго- или полипептидный линкер, например, длиной от 2 до 10 аминокислот (например, 2, 3, 4, 5, 6, 7, 8, 9 или 10 аминокислот), может формировать связь между внутриклеточной последовательностью сигнализации. В одном варианте осуществления дублет глицин-серин может использоваться в качестве подходящего линкера. В одном варианте осуществления одна аминокислота, например, аланин, глицин, может использоваться в качестве подходящего линкера.

В одном аспекте конструируют внутриклеточный домен сигнализации, который включает два или более, например, 2, 3, 4, 5 или более, доменов костимулирующей сигнализации. В одном варианте осуществления два или более, например, 2, 3, 4, 5 или более, доменов костимулирующей сигнализации разделены линкерной молекулой, например, линкерной молекулой, описанной здесь. В одном варианте осуществления внутриклеточный домен сигнализации включает два домена костимулирующей сигнализации. В некоторых вариантах осуществления линкерной молекулой является остаток глицина. В некоторых вариантах осуществления линкером является остаток аланина.

В одном аспекте конструируют внутриклеточный домен сигнализации, который включает домен сигнализации из CD3-дзета и домен сигнализации из CD28. В одном аспекте конструируют внутриклеточный домен сигнализации, который включает домен сигнализации из CD3-дзета и домен сигнализации из 4-1ВВ. В одном аспекте сигнальный домен 4-1ВВ является сигнальный домен SEQ ID NO: 16. В одном аспекте доменом сигнализации из CD3-дзета является домен сигнализации SEQ ID NO: 17.

В одном аспекте конструируют внутриклеточный домен сигнализации, который включает домен сигнализации из CD3-дзета и домен сигнализации из CD27. В одном аспекте домен сигнализации из CD27 включает аминокислотную последовательность QRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP (SEQ ID NO:102). В одном аспекте домен сигнализации из CD27 кодируется последовательностью нуклеиновой кислоты AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCC (SEQ ID NO:103).

В одном аспекте CAR-экспрессирующая клетка, описанная здесь, может, кроме того, включать второй CAR, например, второй CAR, который включает отличный антигенсвязывающий домен, например, к той же мишени (EGFRvIII) или отличной мишени.

В другом аспекте настоящим изобретением обеспечивается популяция CAR-экспрессирующих клеток, например, CAR-T-клеток. В некоторых вариантах популяция CAR-экспрессирующих клеток включает смесь клеток, экспрессирующих различных CAR. Например, в одном варианте осуществления популяция CAR-T-клеток может включать первую клетку, экспрессирующую CAR, содержащий описанный здесь связывающий домен антитела против EGFRvIII, и вторую клетку, экспрессирующую CAR, содержащий отличный связывающий домен антитела против EGFRvIII, например, связывающий домен антитела против EGFRvIII, описанный здесь, который отличается от связывающего домена антитела против EGFRvIII в CAR, экспрессируемого первой клеткой. В качестве другого примера, популяция CAR-экспрессирующих клеток может включать первую клетку, экспрессирующую CAR, который включает связывающий домен антитела против EGFRvIII, например, описанный здесь, и вторую клетку, экспрессирующую CAR, который включает антигенсвязывающий домен к мишени, отличной от EGFRvIII. В одном варианте осуществления популяция CAR-экспрессирующих клеток включает, например, первую клетку, экспрессирующую CAR, который включает внутриклеточный домен первичной сигнализации, и вторую клетку, экспрессирующую CAR, который включает домен вторичной сигнализации.

В другом аспекте настоящим изобретением обеспечивается популяция клеток, в которой по крайней мере одна клетка в популяции экспрессирует CAR, содержащий описанный здесь связывающий домен антитела против EGFRvIII, а вторая клетка экспрессирует другой агент, например, агент, который повышает активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агентом может быть агент, который ингибирует ингибиторную молекулу. Ингибиторные молекулы, например, PD1, могут, в некоторых вариантах осуществления, уменьшать способность CAR-экспрессирующей клетки к индукции эффекторного иммунного ответа. Примеры ингибиторных молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2В4 и TGFR бета.

РНК-трансфекция

Здесь описаны способы получения in vitro транскрибированной РНК для CAR. Настоящее изобретение также включает кодирующую CAR РНК-конструкцию, которую можно непосредственно трансфицировать в клетку. Способ получения мРНК для использования в трансфекции может включать in vitro транскрипцию (IVT) матрицы с использованием специально разработанных праймеров, с последующим добавление полиА, чтобы получить конструкцию, содержащую 3' и 5' нетранслируемые последовательности («UTR»), 5' кэп и/или участок внутренней посадки рибосомы (IRES), экспрессируемую нуклеиновую кислоту и поли(А)-хвост, обычно длиной 50-2000 оснований (SEQ ID NO: 116). РНК, полученная таким образом, может эффективно трансфицировать различные типы клеток. В одном аспекте матрица включает последовательности для CAR.

В одном аспекте EGFRvIII-специфический CAR кодируется информационной РНК (мРНК). В одном аспекте мРНК, кодирующую EGFRvIII-специфический CAR, вводят в Т-клетку для получения CAR-T-клетки.

В одном варианте осуществления in vitro транскрибированная РНК для CAR может быть введена в клетку в виде транзиторной трансфекции. РНК получают с помощью in vitro транскрипции, используя созданную с помощью полимеразной цепной реакции (ПЦР) матрицу. Представляющую интерес ДНК из любого источника можно непосредственно превратить с помощью ПЦР в матрицу для in vitro синтеза мРНК, используя соответствующие праймеры и РНК-полимеразу. Источником ДНК может быть, например, геномная ДНК, плазмидная ДНК, фаговая ДНК, кДНК, синтетическая последовательность ДНК или любой другой подходящий источник ДНК. Желаемой матрицей для in vitro транскрипции является CAR настоящего изобретения. Например, матрица для РНК для CAR включает экстраклеточный район, включающий одноцепочечный вариабельный домен противоопухолевого антитела; шарнирную область; трансмембранный домен (например, трансмембранный домен CD8a); и цитоплазматический район, который включает внутриклеточный домен сигнализации, например, включающий домен сигнализации CD3-дзета и домен сигнализации 4-1ВВ.

В одном варианте осуществления ДНК, используемая для ПЦР, содержит открытую рамку считывания. ДНК может происходить из встречающейся в природе последовательности ДНК генома организма. В одном варианте осуществления нуклеиновая кислота может включать некоторые или все 5' и/или 3' нетранслируемые участки (UTR). Нуклеиновая кислота может включать экзоны и интроны. В одном варианте осуществления ДНК, используемая для ПЦР, представляет собой последовательность нуклеиновой кислоты человека. В другом варианте осуществления ДНК, используемая для ПЦР, представляет собой последовательность нуклеиновой кислоты человека, включающую 5' и 3' UTR. Альтернативно, ДНК может быть искусственной последовательностью ДНК, которая в нормальных условиях не экспрессируется во встречающемся в природе организме. Приводимой в качестве примера искусственной последовательностью ДНК является последовательность, которая содержит части генов, которые лигированы вместе с образованием открытой рамки считывания, кодирующей слитый белок. Части ДНК, которые подвергают лигированию, могут происходить из одного организма или из более чем одного организма.

ПЦР используется для создания матрицы для in vitro транскрипции мРНК, которая используется для трансфекции. Способы выполнения ПЦР хорошо известны в данной области техники. Конструируют праймеры для использования в ПЦР, которые содержат участки, по существу комплементарные участкам ДНК, используемой в качестве матрицы для ПЦР. «По существу комплементарные», как здесь используются, относятся к последовательностям нуклеотидов, в которых большая часть или все основания в последовательности праймера являются комплементарными, или одно или более оснований являются некомплементарными, или несовпадающими. По существу комплементарные последовательности способны к отжигу или гибридизации с намеченной ДНК-мишенью в условиях отжига, используемых для ПЦР. Могут быть сконструированы праймеры, которые по существу комплементарны любой части ДНК-матрицы. Например, могут быть сконструированы праймеры для амплификации части нуклеиновой кислоты, которая в нормальных условиях транскрибируется в клетках, (открытой рамки считывания), включающей 5' и 3' UTR. Также могут быть сконструированы праймеры для амплификации части нуклеиновой кислоты, которая кодирует конкретный домен, представляющий интерес. В одном варианте осуществления конструируют праймеры для амплификации кодирующей области кДНК человека, включающей все или части 5' и 3' UTR. Праймеры, применимые для ПЦР, создают с помощью методов синтеза, которые хорошо известны в данной области техники. «Прямыми праймерами» являются праймеры, которые содержат участок нуклеотидов, по существу комплементарных нуклеотидам в ДНК-матрице, которые находятся слева от последовательности ДНК, которая должна быть амплифицирована. «Слева», как здесь используется, относится к положению 5' от последовательности ДНК, которая должна быть амплифицирована, относительно кодирующей цепи. «Обратными праймерами» являются праймеры, которые содержат участок нуклеотидов, по существу комплементарных нуклеотидам в двухцепочечной ДНК-матрице, которые находятся справа от последовательности ДНК, которая должна быть амплифицирована. «Справа», как здесь используется, относится к положению 3' от последовательности ДНК, которая должна быть амплифицирована, относительно кодирующей цепи.

Любая ДНК-полимераза, применимая для ПЦР, может использоваться в описываемых здесь способах. Реагенты и полимераза коммерчески доступны из ряда источников.

Могут также использоваться химические структуры, обладающие способностью поддерживать стабильность и/или эффективность трансляции. Предпочтительно РНК содержит 5' и 3' UTR. В одном варианте осуществления размер 5' UTR находится между 1 и 3000 нуклеотидов. Размер последовательностей 5' и 3' UTR, добавляемых к кодирующей области, может быть изменен с помощью различных способов, в том числе, но без ограничения, конструирования праймеров для ПЦР, которые подвергаются отжигу к различным участкам UTR. Используя этот подход, специалист со средним уровнем компетентности в данной области техники может изменять размеры 5' и 3' UTR, необходимые для достижения оптимальной эффективности трансляции после трансфекции транскрибированной РНК.

5' и 3' UTR могут быть встречающимися в природе, эндогенными 5' и 3' UTR для представляющей интерес нуклеиновой кислоты. Альтернативно, последовательности UTR, которые не являются эндогенными для представляющей интерес нуклеиновой кислоты, могут быть добавлены посредством включения последовательностей UTR в прямой и обратный праймеры или с помощью любых других модификаций матрицы. Последовательности UTR, которые не являются эндогенными для представляющей интерес нуклеиновой кислоты, могут использоваться для изменения стабильности и/или эффективности трансляции РНК. Например, известно, что AU-богатые элементы в последовательностях 3' UTR могут уменьшить стабильность мРНК. Следовательно, можно выбрать или сконструировать 3' UTR, которые увеличивают стабильность транскрибированной РНК, на основе свойств UTR, которые хорошо известны в данной области техники.

В одном варианте осуществления 5' UTR может содержать последовательность Козак эндогенной нуклеиновой кислоты. Альтернативно, когда 5' UTR, который не является эндогенным для представляющей интерес нуклеиновой кислоты, добавляют с помощью ПЦР, как описано выше, консенсусная последовательность Козак может быть переконструирована посредством добавления последовательности 5' UTR. Последовательность Козак может увеличить эффективность трансляции с некоторых РНК-транскриптов, но, по-видимому, не требуется для всех РНК для допуска эффективной трансляции. Необходимость в последовательностях Козак в случае многих мРНК известна в данной области техники. В других вариантах осуществления 5' UTR может быть 5' UTR из РНК-содержащего вируса, геномная РНК которого является стабильной в клетках. В других вариантах осуществления различные аналоги нуклеотидов могут использоваться в 3' или 5' UTR для препятствования деградации мРНК под действием экзонуклеаз.

Чтобы сделать возможным синтез РНК с ДНК-матрицы без необходимости в клонировании гена, промотор транскрипции должен быть присоединен к ДНК-матрице 5' от транскрибируемой последовательности. Когда последовательность, которая функционирует в качестве промотора для РНК-полимеразы, добавлена к 5'-концу прямого праймера, промотор для РНК-полимеразы становится включенным в продукт ПЦР 5' от открытой рамки считывания, которая должна быть транскрибирована. В одном предпочтительном варианте осуществления промотором является промотор для полимеразы T7, описанный здесь где-то в другом месте. Другие применимые промоторы включают, но без ограничения, промоторы для РНК-полимеразы T3 и SP6. Консенсусные нуклеотидные последовательности для промоторов T7, T3 и SP6 известны в данной области техники.

В предпочтительном варианте осуществления мРНК содержит и кэп-структуру на 5'-конце, и 3' поли(A) хвост, которые определяют связывание рибосомы, инициацию трансляции и стабильность мРНК в клетке. На замкнутой в круг ДНК-матрице, например, плазмидной ДНК, РНК-полимераза продуцирует длинный конкатемерный продукт, который не подходит для экспрессии в эукариотических клетках. Транскрипция плазмидой ДНК, линеаризованной на конце 3' UTR, приводит к мРНК с нормальным размером, которая не является эффективной в трансфекции эукариотических клеток, даже если она подвергается полиаденилированию после транскрипции.

На линейной ДНК-матрице РНК-полимераза фага T7 может удлинить 3'-конец транскрипта после последнего основания матрицы (Schenborn and Mierendorf, Nuc Acids Res., 13: 6223-6236 (1985); Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-1465 (2003).

Традиционным способом интеграции участков полиA/T в ДНК-матрицу является молекулярное клонирование. Однако последовательность полиA/T, интегрированная в плазмидную ДНК, может быть причиной нестабильности плазмиды, и поэтому плазмидные ДНК-матрицы, полученные из бактериальных клеток, часто «испорчены» в высокой степени делециями и другими аберрациями. Это делает процедуры клонирования не только трудными и трудоемкими, но часто ненадежными. Вот почему очень требуется способ, который делает возможным конструирование ДНК-матриц с 3' участком полиA/T без клонирования.

Сегмент полиA/T транскрипционной ДНК-матрицы можно синтезировать во время ПЦР, используя обратный праймер, содержащий полиT-хвост, такой как 100T-хвост (SEQ ID NO: 117) (размер может составлять 50-5000 T (SEQ ID NO: 118)), или создать после ПЦР с помощью любого способа, в том числе, но без ограничения, лигирования ДНК или in vitro рекомбинации. Поли(A)-хвосты также обеспечивают РНК стабильность и уменьшают их деградацию. Как правило, имеется положительная корреляция между размером поли(A)-хвоста и стабильностью транскрибированной РНК. В одном варианте осуществления размер поли(A)-хвоста находится между 100 и 5000 аденозинов (SEQ ID NO: 119).

Поли(A)-хвосты РНК могут быть дополнительно удлинены после in vitro транскрипции с помощью использования поли(A)-полимеразы, такой как поли(А)-полимераза E. coli (E-PAP). В одном варианте осуществления увеличение размера поли(A)-хвоста со 100 нуклеотидов до 300-400 нуклеотидов (SEQ ID NO: 120) приводит к приблизительно двукратному увеличению эффективности трансляции РНК. Кроме того, присоединение различных химических групп к 3'-концу может увеличить стабильность мРНК. Такое присоединение может включать модифицированные/искусственные нуклеотиды, аптамеры и другие соединения. Например, аналоги АТФ могут быть включены в поли(A)-хвост, используя поли(A)-полимеразу. Аналоги АТФ могут дополнительно увеличить стабильность РНК.

5' кэп-структуры также обеспечивают стабильность молекулам РНК. В предпочтительном варианте осуществления РНК, продуцированные с помощью способов, описываемых здесь, включают 5' кэп-структуру. 5' кэп-структуру обеспечивают, используя методы, известные в данной области техники и описанные здесь (Cougot, et al., Trends in Biochem. Sci., 29: 436-444 (2001); Stepinski, et al., RNA, 7: 1468-1495 (2001); Elango, et al., Biochim. Biophys. Res. Commun., 330: 958-966 (2005)).

РНК, продуцированные с помощью способов, описываемых здесь, могут также содержать последовательность участка внутренней посадки рибосомы (IRES). Последовательность IRES может быть любой вирусной, хромосомной или искусственно созданной последовательностью, которая инициирует кэп-независимое связывание рибосомы с мРНК и способствует инициации трансляции. Могут быть включены любые растворенные вещества, подходящие для электропорации в клетки, которые могут содержать факторы, содействующие клеточной проницаемости и жизнеспособности, такие как сахара, пептиды, липиды, белки, антиоксиданты и поверхностно-активные вещества.

РНК можно вести в клетки-мишени, используя любой из множества различных способов, например, коммерчески доступных способов, которые включают, но без ограничения, электропорацию (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Германия)), (ECM 830 (BTX) (Harvard Instruments, Boston, Mass.) или Gene Pulser II (BioRad, Denver, Colo.), Multiporator (Eppendort, Hamburg, Германия), трансфекцию с использованием катионных липосом, используя липофекцию, инкапсуляцию полимеров, трансфекцию с использованием пептидов или системы для биолистической доставки частиц, такие как «генные пушки» (смотрите, например, Nishikawa, et al., Hum Gene Ther., 12(8): 861-870 (2001).

НК-конструкции, кодирующие CAR.

Настоящим изобретением обеспечиваются молекулы нуклеиновых кислот, кодирующие одну или более конструкций CAR, описанных здесь. В одном аспекте молекула нуклеиновой кислоты обеспечивается в виде мРНК-транскрипта. В одном аспекте молекула нуклеиновой кислоты обеспечивается в виде ДНК-конструкции.

Соответственно, в одном аспекте настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей химерный антигенспецифический рецептор (CAR), причем CAR включает связывающий домен антитела против EGFRvIII (например, связывающий домен гуманизированного антитела против EGFRvIII), трансмембранный домен и внутриклеточный домен сигнализации, включающий стимулирующий домен, например, домен костимулирующей сигнализации и/или домен первичной сигнализации, например, дзета-цепь. В одном варианте осуществления связывающим доменом антитела против EGFRvIII является связывающий домен антитела против EGFRvIII, описанный здесь, например, связывающий домен антитела против EGFRvIII, который включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74 и SEQ ID NO: 80, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кроме того, включает последовательность, кодирующую костимулирующий домен. В одном варианте осуществления костимулирующим доменом является функциональный домен сигнализации белка, выбираемого из группы, состоящей из OX40, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137). В одном варианте осуществления костимулирующий домен включает последовательность SEQ ID NO: 16, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления трансмембранным доменом является трансмембранный домен белка, выбираемого из группы, состоящей из альфа, бета или дзета цепи T-клеточного рецептора, CD28, CD3 эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154. В одном варианте осуществления трансмембранный домен включает последовательность SEQ ID NO: 15, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления внутриклеточный домен сигнализации включает функциональный домен сигнализации 4-1BB и функциональный домен сигнализации CD3 дзета. В одном варианте осуществления внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 или SEQ ID NO: 102, или последовательность, идентичную ей на 95-99%, и последовательность SEQ ID NO: 17 или SEQ ID NO: 99, или последовательность, идентичную ей на 95-99%, причем последовательности, включающие внутриклеточный домен сигнализации, экспрессируются в одной и той же рамке и в виде одной полипептидной цепи. В одном варианте осуществления связывающий домен антитела против EGFRvIII соединен с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной здесь. В одном варианте осуществления шарнирная область включает SEQ ID NO: 14 или SEQ ID NO: 104, или SEQ ID NO: 106, или SEQ ID NO: 108, или последовательность, идентичную ей на 95-99%.

В другом аспекте настоящее изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей конструкцию CAR, включающую лидерную последовательность SEQ ID NO: 13, scFv-домен, имеющий последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86 (или последовательность, идентичную ей на 95-99%), шарнирную область SEQ ID NO: 14 или SEQ ID NO: 104, или SEQ ID NO: 106, или SEQ ID NO: 108 (или последовательности, идентичной ей на 95-99%), трансмембранный домен, имеющий последовательность SEQ ID NO: 15 (или последовательность, идентичную ей на 95-99%), костимулирующий домен 4-1ВВ, имеющий последовательность SEQ ID NO: 16, или костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 102 (или последовательность, идентичную ей на 95-99%), и стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99 (или последовательность, идентичную ей на 95-99%).

В другом аспекте настоящее изобретение относится к выделенной молекуле полипептида, кодируемой молекулой нуклеиновой кислоты. В одном варианте осуществления выделенная молекула полипептида включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 и SEQ ID NO: 90, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления выделенный полипептид включает последовательность SEQ ID NO: 73 или последовательность, идентичную ей на 95-99%. В одном варианте осуществления выделенный полипептид включает последовательность SEQ ID NO: 79 или последовательность, идентичную ей на 95-99%.

В другом аспекте настоящее изобретение относится к молекуле нуклеиновой кислоты, кодирующей молекулу химерного антигенспецифического рецептора (CAR), которая включает связывающий домен антитела против EGFRvIII, трансмембранный домен и внутриклеточный домен сигнализации, включающий стимулирующий домен, и причем указанный связывающий домен антитела против EGFRvIII включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, или последовательность, идентичную ей на 95-99%.

В одном варианте осуществления кодируемая молекула CAR, кроме того, включает последовательность, кодирующую костимулирующий домен. В одном варианте осуществления костимулирующим доменом является функциональный домен сигнализации белка, выбираемого из группы, состоящей из OX40, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18) и 4-1BB (CD137). В одном варианте осуществления костимулирующий домен включает последовательность SEQ ID NO: 16. В одном варианте осуществления трансмембранным доменом является трансмембранный домен белка, выбираемого из группы, состоящей из альфа, бета или дзета цепи T-клеточного рецептора, CD28, CD3 эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154. В одном варианте осуществления трансмембранный домен включает последовательность SEQ ID NO: 15. В одном варианте осуществления внутриклеточный домен сигнализации включает функциональный домен сигнализации 4-1BB и функциональный домен сигнализации дзета. В одном варианте осуществления внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 и последовательность SEQ ID NO: 17, причем последовательности, включающие внутриклеточный домен сигнализации, экспрессируются в одной и той же рамке и в виде одной полипептидной цепи. В одном варианте осуществления связывающий домен антитела против EGFRvIII соединен с трансмембранным доменом с помощью шарнирной области. В одном варианте осуществления шарнирная область включает SEQ ID NO: 14. В одном варианте осуществления шарнирная область включает SEQ ID NO: 104 или SEQ ID NO: 106, или SEQ ID NO: 108.

В другом аспекте настоящее изобретение относится к кодируемой молекуле CAR, включающей лидерную последовательность SEQ ID NO: 13, scFv-домен, имеющий последовательность, выбираемую из группы, состоящей из SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74, SEQ ID NO: 80 и SEQ ID NO: 86, или последовательность, идентичную ей на 95-99%, шарнирную область с SEQ ID NO: 14 или SEQ ID NO: 104, или SEQ ID NO: 106, или SEQ ID NO: 108, трансмембранный домен, имеющий последовательность SEQ ID NO: 15, костимулирующий домен 4-1ВВ, имеющий последовательность SEQ ID NO: 16, или костимулирующий домен CD27, имеющий последовательность SEQ ID NO: 102, и стимулирующий домен CD3 дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 99. В одном варианте осуществления кодируемая молекула CAR включает последовательность, выбираемую из группы, состоящей из SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79, SEQ ID NO: 85 и SEQ ID NO: 90, или последовательность, идентичную ей на 95-99%. В одном варианте осуществления кодируемая молекула CAR включает последовательность SEQ ID NO: 73 или последовательность, идентичную ей на 95-99%. В одном варианте осуществления выделенная молекула CAR включает последовательность SEQ ID NO: 79 или последовательность, идентичную ей на 95-99%.

Последовательности нуклеиновых кислот, кодирующие желаемые молекулы, можно получить, используя рекомбинантные методы, известные в данной области техники, такие как, например, посредством скрининга библиотек из клеток, экспрессирующих ген, посредством доставки гена из вектора, который, как известно, включает его, или посредством непосредственного выделения из клеток или тканей, содержащих их, используя стандартные методы. Альтернативно, представляющий интерес ген можно создать синтетически, а не клонировать.

Настоящим изобретением также обеспечиваются векторы, в которые вставлена ДНК настоящего изобретения. Векторы, происходящие из ретровирусов, например, лентивируса, являются подходящими инструментальными средствами для достижения длительного переноса генов, поскольку они делает возможной длительную, стабильную интеграцию трансгена и его воспроизведение в дочерних клетках. Лентивирусные векторы обладают дополнительным преимуществом по сравнению с векторами, происходящими из онко-ретровирусов, таких как вирусы мышиного лейкоза, поскольку они могут трансдуцировать непролиферирующиеся клетки, такие как гепатоциты. Они также обладают дополнительным преимуществом, состоящим в низкой иммуногенности.

Вкратце, экспрессия природных или синтетических нуклеиновых кислот, кодирующих CAR, обычно достигается при функциональной связи нуклеиновой кислоты, кодирующей полипептид CAR или его часть, с промотором и включении конструкции в экспрессионный вектор. Векторы могут быть подходящими для репликации и интеграции в эукариотах. Типичные векторы для клонирования содержат терминаторы транскрипции и трансляции, инициирующие последовательности и промоторы, применимые для регуляции экспрессии желаемой последовательности нуклеиновой кислоты.

Экспрессионные конструкции по настоящему изобретению могут также использоваться для иммунизации нуклеиновой кислотой и генотерапии, используя стандартные протоколы для доставки генов. Методы доставки генов известны в данной области техники. Смотрите, например, патенты США №№ 5399346, 5580859, 5589466, включенные сюда посредством ссылки в их полных объемах. В другом варианте осуществления настоящим изобретением обеспечивается вектор для генотерапии.

Нуклеиновую кислоту можно клонировать во множество типов векторов. Например, нуклеиновую кислоту можно клонировать в вектор, включающий, но без ограничения, плазмиду, фагемиду, производное фага, вирус животного и космиду. Представляющие особый интерес векторы включают экспрессионные векторы, векторы для репликации, векторы для создания зондов и векторы для секвенирования.

Кроме того, экспрессионный вектор может быть привнесен в клетку в форме вирусного вектора. Технология с использованием вирусных векторов хорошо известна в данной области техники и описана, например, в Sambrook и др. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York) и в других руководствах по вирусологии и молекулярной биологии. Вирусы, которые применимы в качестве векторов, включают, но без ограничения, ретровирусы, аденовирусы, аденоассоциированные вирусы, вирусы герпеса и лентивирусы. Как правило, подходящий вектор содержит начало репликации, функционирующее в по крайней мере одном организме, промоторную последовательность, удобные сайты для эндонуклеаз рестрикции и один или более селектируемых маркеров (например, WO 01/96584; WO 01/29058; и патент США № 6326193).

Было разработано множество систем на основе вирусов для переноса генов в клетки млекопитающих. Например, ретровирусы обеспечивают удобную платформу для систем для доставки генов. Выбранный ген можно вставить в вектор и упаковать в ретровирусные частицы, используя известные в данной области техники методы. Рекомбинантный вирус затем можно выделить и доставить в клетки субъекта или in vivo, или ex vivo. В данной области техники известен ряд ретровирусных систем. В некоторых вариантах осуществления используют аденовирусные векторы. В данной области техники известен ряд аденовирусных векторов. В одном варианте осуществления используют лентивирусные векторы.

Дополнительные элементы промотора, например, энхансеры, регулируют частоту инициации транскрипции. Типично они находятся 5' от сайта инициации в области, находящейся на расстоянии 30-110 п.о. от него, хотя ряд промоторов, как недавно было установлено, также содержит функциональные элементы 3' от сайта инициации. Часто расстояние между элементами промотора является трансформируемым, так что функция промотора сохраняется, когда элементы являются инвертированными или перемещенными относительно друг друга. В промоторе гена тимидинкиназы (tk) расстояние между элементами промотора может быть увеличено до 50 п.о. в отдалении, прежде чем активность начнет уменьшаться. В зависимости от промотора, судя по всему, индивидуальные элементы могут функционировать или кооперативно, или независимо для активации транскрипции.

Одним примером подходящего промотора является промоторная последовательность немедленно-раннего гена цитомегаловируса (CMV). Эта промоторная последовательность является сильной конститутивной промоторной последовательностью, способной к запуску высоких уровней экспрессии любой полинуклеотидной последовательности, функционально связанной с ней. Другим примером подходящего промотора является промотор гена фактора-1α элонгации (EF-1α). Однако могут также использоваться другие конститутивные промоторные последовательности, включая, но без ограничения, ранний промотор вакуолизирующего обезьяньего вируса (SV40), промотор вируса опухоли молочной железы мыши (MMTV), промотор длинного концевого повтора (LTR) вируса иммунодефицита человека (ВИЧ), промотор MoMuLV, промотор вируса птичьего лейкоза, немедленно ранний промотор вируса Эпштейна-Барра, промотор вируса саркомы Рауса, а также промоторы генов человека, такие как, но без ограничения, промотор гена актина, промотор гена миозина, промотор гена гемоглобина и промотор гена креатинкиназы. Кроме того, настоящее изобретение не должно ограничиваться использованием конститутивных промоторов. В качестве части настоящего изобретения также предусматриваются индуцируемые промоторы. Использование индуцируемого промотора обеспечивает молекулярный переключатель, способный включить экспрессию последовательности полинуклеотида, с которой он функционально связан, когда такая экспрессия является желательной, или выключить экспрессию, когда экспрессия нежелательна. Примеры индуцируемых промоторов включают, но без ограничения, промотор гена металлотионина, промотор гена глюкокортикоида, промотор гена прогестерона и тетрациклиновый промотор.

Для оценки экспрессии полипептида CAR или его частей, экспрессионный вектор, который вводят в клетку, может также содержать или ген селектируемого маркера, или ген-репортер, или то и другое для облегчения идентификации и отбора экспрессирующих клеток из популяции клеток, которые пытались трансфицировать или инфицировать посредством вирусных векторов. В других аспектах селектируемый маркер может переноситься на отдельном фрагменте ДНК и использоваться в процедуре котрансфекции. И селектируемые маркеры, и гены-репортеры могут быть фланкированы соответствующими регуляторными последовательностями, чтобы сделать возможной экспрессию в клетках-хозяевах. Применимые селектируемые маркеры включают, например, гены устойчивости к антибиотикам, такие как neo и т.п.

Гены-репортеры используются для идентификации возможно трансфицированных клеток и для оценки функциональности регуляторных последовательностей. Вообще, геном-репортером является ген, который не присутствует в являющемся реципиентом организме или ткани или не экспрессируется в нем и который кодирует полипептид, экспрессия которого обнаруживается по какому-либо легко выявляемому свойству, например, ферментативной активности. Экспрессию гена-репортера анализируют в соответствующий момент времени, после введения ДНК в являющиеся реципиентами клетки. Подходящие гены-репортеры могут включать гены, кодирующие люциферазу, бета-галактозидазу, хлорамфеникол-ацетилтрансферазу, секретируемую щелочную фосфатазу, или ген зеленого флуоресцентного белка (например, Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Подходящие экспрессионные системы хорошо известны и могут быть приготовлены, используя известные методы, или куплены. Вообще, конструкцию с минимальным 5' фланкирующим районом, демонстрирующую наибольший уровень экспрессии гена-репортера, определяют как промотор. Такие промоторные районы могут быть связаны с геном-репортером и использоваться для оценки агентов в отношении способности к модуляции регулируемой промотором транскрипции.

Способы введения и экспрессии генов в клетке известны в данной области техники. В связи с экспрессионным вектором, вектор можно без труда ввести в клетку-хозяина, например, клетку млекопитающего, бактериальную, дрожжевую клетку или клетку насекомого, с помощью любого способа в данной области техники. Например, экспрессионный вектор можно трансфицировать в клетку-хозяина с помощью физического, химического или биологического способа.

Физические способы введения полинуклеотида в клетку-хозяина включают преципитацию с использованием фосфата кальция, липофекцию, бомбардировку частицами, микроинъекцию, электропорацию и т.п. Способы получения клеток, включающих векторы и/или экзогенные нуклеиновые кислоты, хорошо известны в данной области техники. Смотрите, например, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). Предпочтительным способом введения полинуклеотида в клетку-хозяина является трансфекция с использованием фосфата кальция.

Биологические способы введения представляющего интерес полинуклеотида в клетку-хозяина включают использование ДНК- и РНК-векторов. Вирусные векторы, и в особенности ретровирусные векторы, стали наиболее широко используемым способом введения генов в клетки млекопитающего, например, человека. Другие вирусные векторы могут происходить из лентивируса, поксвирусов, вируса I простого герпеса, аденовирусов и аденоассоциированных вирусов, и т.п. Смотрите, например, патенты США № 5350674 и № 5585362.

Химические способы введения полинуклеотида в клетку-хозяина включают коллоидные дисперсионные системы, такие как макромолекулярные комплексы, нанокапсулы, микросферы, сферы и системы на основе липидов, включая эмульсии типа «масло-в-воде», мицеллы, смешанные мицеллы и липосомы. Приводимой в качестве примера коллоидной системой для применения в качестве носителя для доставки in vitro и in vivo является липосома (например, искусственная мембранная везикула).

В случае использования невирусной системы для доставки, приводимым в качестве примера носителем для доставки является наночастица, например, липосома или другая подходящая система для доставки субмикронного размера. Использование липидных композиций предполагается для введения нуклеиновых кислот в клетку-хозяина (in vitro, ex vivo или in vivo). В другом аспекте нуклеиновая кислота может быть ассоциированной с липидом. Нуклеиновая кислота, ассоциированная с липидом, может быть заключена в водную внутреннюю часть липосомы, распределена в липидном бислое липосомы, присоединена к липосоме через связующую молекулу, которая связывается и с липосомой, и с олигонуклеотидом, захвачена в липосому, образовывать комплекс с липосомой, быть диспергирована в растворе, содержащем липид, смешана с липидом, объединена с липидом, содержаться в виде суспензии в липиде, содержаться или образовывать комплекс с мицеллой, или быть иным образом ассоциирована с липидом. Липидные, липид/ДНК или липид/экспрессионный вектор ассоциированные композиции не ограничиваются какой-либо конкретной структурой в растворе. Например, они могут присутствовать в бислойной структуре, в виде мицелл, или быть с «разрушенной» структурой. Они могут также просто быть распределены в растворе, возможно, образуя агрегаты, которые являются неодинаковыми по размеру или форме. Липиды могут быть жирами, которые могут встречающимися в природе или синтетическими липидами. Например, липиды включают капельки жира, которые встречаются в природе в цитоплазме, а также класс соединений, которые содержат длинноцепочечные алифатические углеводороды и их производные, такие как жирные кислоты, спирты, амины, аминоспирты и альдегиды.

Липиды, подходящие для использования, можно получить из коммерческих источников. Например, димиристилфосфатидилхолин («DMPC») можно получить от Sigma, St. Louis, MO; дицетилфосфат («DCP») можно получить из K & K Laboratories (Plainview, NY); холестерин («Choi») можно получить от Calbiochem-Behring; димиристилфосфатидилглицерин («DMPG») и другие липиды можно получить от Avanti Polar Lipids, Inc. (Birmingham, AL). Маточные растворы липидов в хлороформе или смеси хлороформ/метанол можно хранить при приблизительно -20°C. Хлороформ используется в качестве единственного растворителя, поскольку он легче испаряется, чем метанол. «Липосома» является общим термином, охватывающим множество одно- и многослойных липидных везикул, образованных в результате создания замкнутых липидных бислоев или агрегатов. Липосомы можно охарактеризовать как имеющие везикулярные структуры с мембраной в виде фосфолипидного бислоя и внутренней водной средой. Многослойные липосомы имеют множество липидных слоев, разделенных водной средой. Они образуются самопроизвольно при суспендировании фосфолипидов в большом количестве водного раствора. Липидные компоненты подвергаются самоперестройке до образования замкнутых структур и захватывают воду и растворенные вещества между липидными бислоями (Ghosh et al., 1991 Glycobiology 5: 505-510). Однако также включены композиции, которые имеют структуры в растворе, отличные от нормальной везикулярной структуры. Например, липиды могут принять мицеллярную структуру или просто существовать в виде неоднородных агрегатов липидных молекул. Также предусматриваются комплексы липофектамин-нуклеиновая кислота.

Независимо от способа, используемого для введения экзогенных нуклеиновых кислот в клетку-хозяина или иначе подвергания клетки воздействию ингибитора по настоящему изобретению, для подтверждения присутствия рекомбинантной последовательности ДНК в клетке-хозяине можно выполнить множество анализов. Такие анализы включают, например, «молекулярно-биологические» анализы, хорошо известные квалифицированным в данной области техники специалистам, такие как блоттинг по Саузерну и Нозерн-блоттинг, ОТ-ПЦР и ПЦР; «биохимические» анализы, такие как детектирование присутствия или отсутствия конкретного пептида, например, с помощью иммунологического способа (ELISA и Вестерн-блоттинга) или с помощью описанных здесь анализов для идентификации агентов, которые не оказываются в объеме настоящего изобретения.

Настоящим изобретением, кроме того, обеспечивается вектор, включающий молекулу нуклеиновой кислоты, кодирующую CAR. В одном аспекте кодирующий CAR вектор можно непосредственно трансдуцировать в клетку, например, Т-клетку. В одном аспекте вектором является вектор для клонирования или экспрессионный вектор, например, включающий, но без ограничения, одну или более плазмид (например, экспрессионных плазмид, векторов для клонирования, миниколец, минивекторов, двойных хромосом), ретровирусных и лентивирусных векторных конструкций. В одном аспекте вектор способен к экспрессии конструкции CAR в Т-клетках млекопитающего. В одном аспекте Т-клеткой млекопитающего является Т-клетка человека.

Источники Т-клеток

До размножения и генетической модификации источник T-клеток получают от субъекта. Термин «субъект», как предполагается, включает живые организмы, в которых может быть вызван иммунный ответ (например, млекопитающих). Примеры субъектов включают людей, собак, кошек, мышей, крыс и их трансгенные виды. T-клетки можно получить из ряда источников, включая мононуклеарные клетки периферической крови, костный мозг, ткань лимфатических узлов, пуповинную кровь, ткань вилочковой железы, ткань из места инфекции, асцитические жидкости, плевральный выпот, ткань селезенки и опухоли. В некоторых аспектах настоящего изобретения может использоваться любой ряд линий Т-клеток, имеющихся в данной области техники. В некоторых аспектах настоящего изобретения T-клетки можно получить из дозы крови, полученной от субъекта, используя любой ряд методов, известных квалифицированному специалисту, таких как разделение с использованием Ficoll™. В одном предпочтительном аспекте клетки циркулирующей крови индивидуума получают с помощью афереза. Аферезный продукт типично содержит лимфоциты, включая T-клетки, моноциты, гранулоциты, B-клетки, другие ядросодержащие лейкоциты, эритроциты и тромбоциты. В одном аспекте клетки, полученные с помощью афереза, можно промыть для удаления фракции плазмы и поместить в соответствующий буфер или среду для стадий последующей обработки. В одном аспекте настоящего изобретения клетки промывают забуференным фосфатом солевым раствором (PBS). В альтернативном аспекте в растворе для промывки отсутствует кальций и может отсутствовать магний или могут отсутствовать многие, если не все двухвалентные катионы. Стадии первоначальной активации в отсутствие кальция могут привести к увеличенной активации. Как это будет совершенно понятно специалистам со средним уровнем компетентности в данной области техники, стадия промывки может выполняться с использованием способов, известных квалифицированным в данной области техники специалистам, например, с использованием полуавтоматической «проточной» центрифуги (например, клеточного процессора Cobe 2991, Baxter CytoMate, или Haemonetics Cell Saver 5) в соответствии с инструкциями производителя. После промывки клетки можно ресуспендировать во множестве биосовместимых буферов, таких как, например, не содержащий Ca, не содержащий Mg PBS, PlasmaLyte A, или другой солевой раствор с буфером или без него. Альтернативно, нежелательные компоненты аферезного образца можно удалить, а клетки непосредственно суспендировать в среде для культивирования.

В одном аспекте T-клетки выделяют из лимфоцитов периферической крови посредством лизиса эритроцитов и истощения моноцитов, например, с помощью центрифугирования через градиент PERCOLL™ или с помощью проточного элютрационного центрифугирования. Конкретную субпопуляцию T-клеток, например, CD3+, CD28+, CD4+, CD8+, CD45RA+ и CD45RO+ T-клеток, можно далее выделить с использованием методов позитивного или негативного отбора. Например, в одном аспекте T-клетки выделяют посредством инкубации со сферами, конъюгированными с антителами против CD3/CD28 (например, 3x28), такими как DYNABEADS® M-450 CD3/CD28 T, в течение периода времени, достаточного для позитивного отбора желаемых T-клеток. В одном аспекте период времени составляет приблизительно 30 минут. В дальнейшем аспекте период времени находится в диапазоне от 30 минут до 36 часов или больше и включает все целые числа в нем. В дальнейшем аспекте период времени составляет по крайней мере 1, 2, 3, 4, 5 или 6 часов. Тем не менее, в другом предпочтительном аспекте период времени составляет от 10 до 24 часов. В одном аспекте период времени инкубации составляет 24 часа. Более длинные периоды времени инкубации могут использоваться для выделения T-клеток в любой ситуации, когда существует мало T-клеток по сравнению с другими типами клеток, например, при выделении инфильтрирующих опухоль лимфоцитов (TIL) из опухолевой ткани или от индивидуумов с ослабленным иммунитетом. Кроме того, использование более длинных периодов времени инкубации может увеличить эффективность захвата CD8+ T-клеток. Таким образом, с помощью просто укорочения или удлинения периода времени допускают связывание T-клеток со сферами с антителами против CD3/CD28, и/или посредством увеличения или уменьшения отношения сфер к T-клеткам (описываемого здесь далее), субпопуляции T-клеток можно предпочтительно отбирать в начале культивирования или в другие моменты времени во время процесса. Кроме того, посредством увеличения или уменьшения отношения антител против CD3 и/или CD28 на сферах или других поверхностях, субпопуляции Т-клеток можно предпочтительно отбирать в начале культивирования или в другие моменты времени во время процесса. Квалифицированному специалисту будет понятно, что множество циклов отбора можно также использовать в связи с этим изобретением. В некоторых аспектах может быть желательным выполнение процедуры отбора и использование «не отобранных» клеток в процессе активации и размножения. «Не отобранные» клетки могут быть также подвергнуты дальнейшим циклам отбора.

Обогащение популяции T-клеток с помощью негативного отбора может выполняться с использованием комбинации антител, направленных против маркеров поверхности, присущих только негативно отбираемым клеткам. Одним способом является клеточный сортинг и/или отбор посредством негативной магнитной иммуноадгезии или проточной цитометрии, в случае которой используется смесь моноклональных антител, направленных против маркеров клеточной поверхности, присутствующих на негативно отбираемых клетках. Например, для обогащения в отношении CD4+ клеток с помощью негативного отбора, смесь моноклональных антител типично включает антитела против CD14, CD20, CD1lb, CD16, HLA-DR и CD8. В некоторых аспектах может быть желательным обогащение в отношении или позитивный отбор регуляторных T-клеток, которые типично экспрессируют CD4+, CD25+, CD62Lвысокий уровень, GITR+ и FoxP3+. Альтернативно, в некоторых аспектах регуляторные T-клетки истощают с использованием сфер, конъюгированных с антителами против C25, или другого схожего способа отбора.

В одном варианте осуществления можно отобрать популяцию T-клеток, которая экспрессирует один или более из IFN-γ, TNFα, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, гранзима B и перфорина, или других подходящих молекул, например, других цитокинов. Методы скрининга на предмет клеточной экспрессии могут быть определены, например, с использованием способов, описанных в публикации PCT-заявки № WO 2013/126712.

Для выделения желаемой популяции клеток с помощью позитивного или негативного отбора, концентрация клеток и поверхности (например, частиц, таких как сферы) может варьировать. В некоторых аспектах может быть желательным значительное уменьшение объема, в котором сферы и клетки смешивают вместе, (например, увеличение концентрации клеток) для обеспечения максимального контакта клеток и сфер. Например, в одном аспекте используют концентрацию, составляющую 2 биллиона клеток/мл. В одном аспекте используют концентрацию, составляющую 1 биллион клеток/мл. В дальнейшем аспекте используют концентрацию, превышающую 100 миллионов клеток/мл. В дальнейшем аспекте используют концентрацию клеток, составляющую 10, 15, 20, 25, 30, 35, 40, 45 или 50 миллионов клеток/мл. Тем не менее, в другом аспекте используют концентрацию клеток, выбираемую из 75, 80, 85, 90, 95 или 100 миллионов клеток/мл. В дальнейших аспектах могут использоваться концентрации, составляющие 125 или 150 миллионов клеток/мл. Использование высоких концентраций может привести к увеличению выхода клеток, активации клеток и размножению клеток. Кроме того, использование высоких концентраций клеток создает возможность для более эффективного захвата клеток, которые могут слабо экспрессировать представляющие интерес антигены-мишени, таких как CD28-негативные T-клетки, или из образцов, в которых присутствует множество опухолевых клеток, (т.е. лейкозной крови, ткани опухоли и т.д.). Такие популяции клеток могут иметь терапевтическое значение, и их желательно было бы получить. Например, использование высоких концентраций клеток создает возможность для более эффективного отбора CD8+ T-клеток, которые обычно имеют более слабую экспрессию CD28.

В связанном с этим аспекте может быть желательным использование более низких концентраций клеток. В результате значительного разбавления смеси T-клеток и поверхности (например, частиц, таких как сферы) минимизируются взаимодействия между частицами и клетками. Это позволяет отобрать клетки, которые экспрессируют высокие количества желаемых антигенов, которые связываются с частицами. Например, CD4+ T-клетки экспрессируют CD28 на более высоких уровнях и более эффективно захватываются, чем CD8+ T-клетки в разбавленных концентрациях. В одном аспекте используемая концентрация клеток составляет 5×106/мл. В других аспектах используемая концентрация может составлять от приблизительно 1×105/мл до 1×106/мл и любое целое число в этом диапазоне.

В других аспектах клетки могут подвергаться инкубации на вращающем устройстве в течение переменных промежутков времени при переменных скоростях или при 2-10°C, или при комнатной температуре.

T-клетки для стимуляции могут быть также заморожены после стадии промывки. Без желания ограничиться какой-либо теорией, стадия замораживания и последующего оттаивания обеспечивает более однородный продукт в результате удаления гранулоцитов и в некоторой мере моноцитов в популяции клеток. После стадии промывки, которая удаляет плазму и тромбоциты, клетки можно суспендировать в растворе для замораживания. Хотя множество растворов и параметров для замораживания известно в данной области техники и будет применимо в этой связи, один способ включает использование PBS, содержащего 20% DMSO и 8% сывороточного альбумина человека, или сред для культивирования, содержащих 10% декстрана 40 и 5% декстрозы, 20% сывороточного альбумина человека и 7,5% DMSO, или 31,25% PlasmaLyte-A, 31,25% декстрозы 5%, 0,45% NaCl, 10% декстрана 40 и 5% декстрозы, 20% сывороточного альбумина человека и 7,5% DMSO, или других подходящих сред для замораживания клеток, содержащих, например, Hespan и PlasmaLyte A, клетки затем замораживают до -80°C со скоростью 1° в минуту и хранят в газообразной фазе бака для хранения с жидким азотом. Могут использоваться другие способы контролируемого замораживания, а также неконтролируемое замораживание непосредственно при -20°C или в жидком азоте.

В некоторых аспектах замороженные клетки оттаивают и промывают, как здесь описывается, и допускается их выдерживание в течение одного часа при комнатной температуре до активации, используя способы по настоящему изобретению.

В связи с настоящим изобретением также предусматривается коллекция образцов крови или аферезных продуктов от субъекта в период времени до того момента, когда могли бы понадобится размноженные клетки, описываемые здесь. Как таковой, источник клеток, подвергаемых размножению, может быть получен в любой необходимый момент времени, и быть требуемыми клетками, такими как T-клетки, выделенными и замороженными для применения позже в терапии с использованием T-клеток для любого ряда заболеваний или состояний, в случае которых могла бы полезной терапия с использованием T-клеток, таких как те, которые здесь описаны. В одном аспекте образец крови или аферезный продукт отбирают у здорового в целом субъекта. В некоторых аспектах образец крови или аферезный продукт отбирают у здорового в целом субъекта, который подвержен риску развития заболевания, но у которого еще не развилось заболевание, и представляющие интерес клетки выделяют и замораживают для применения позже. В некоторых аспектах T-клетки могут быть размножены, заморожены и использованы позже. В некоторых аспектах образцы получают от пациента вскоре после диагностирования конкретного заболевания, описанного здесь, но до каких-либо лечений. В дальнейшем аспекте клетки выделяют из образца крови или аферезного продукта от субъекта до какого-либо ряда соответствующих способов лечения, включая, но без ограничения, лечение такими средствами, как натализумаб, эфализумаб, противовирусные средства, химиотерапия, облучение, иммуносупрессанты, такие как циклоспорин, азатиоприн, метотрексат, микофенолят и FK506, антитела или другие иммуноаблативные средства, такие как CAMPATH, антитела против CD3, цитоксан, флударабин, циклоспорин, FK506, рапамицин, микофеноловая кислота, стероиды, FR901228 и облучение.

В дальнейшем аспекте настоящего изобретения T-клетки получают от пациента непосредственно после лечения, которое оставляет субъекта с функциональными Т-клетками. В этой связи было отмечено, что после некоторых лечений рака, в частности, лечений лекарственными средствами, которые повреждают иммунную систему, вскоре после лечения во время периода времени, когда должно бы в норме происходить восстановление пациентов от лечения, качество получаемых T-клеток может быть оптимальным или улучшенным в отношении их способности к размножению ex vivo. Так же, после ex vivo манипуляции, используя описываемые здесь способы, эти клетки могут быть в предпочтительном состоянии для усиленного приживления и in vivo размножения. Таким образом, в связи с настоящим изобретением предусматривается получение клеток крови, включая T-клетки, дендритные клетки или другие клетки гемопоэтической линии, во время этой фазы восстановления. Кроме того, в некоторых аспектах режимы мобилизации (например, мобилизации с использованием GM-CSF) и установления определенного состояния могут использоваться для создания состояния у субъекта, при котором репопуляция, рециркуляция, регенерация и/или размножение конкретных типов клеток является преимущественной, в особенности во время определенного временного окна после терапии. Иллюстративные типы клеток включают T-клетки, B-клетки, дендритные клетки и другие клетки иммунной системы.

Активация и размножение T-клеток

T-клетки можно активировать и размножить, в общем используя способы, описанные, например, в патентах США №№ 6352694, 6534055, 6905680, 6692964, 5858358, 6887466, 6905681, 7144575, 7067318, 7172869, 7232566, 7175843, 5883223, 6905874, 6797514, 6867041; и публикации заявки на патент США № 20060121005.

Как правило, T-клетки по настоящему изобретению размножают посредством контактирования с поверхностью с присоединенным к ней агентом, который стимулирует связанный с комплексом CD3/TCR сигнал, и лигандом, который стимулирует костимулирующую молекулу на поверхности T-клеток. В частности, популяции T-клеток можно стимулировать, как здесь описано, например, посредством контактирования с антителом против CD3, или его антигенсвязывающим фрагментом, или антителом против CD2, иммобилизованным на поверхности, или посредством контактирования с активатором протеинкиназы C (например, бриостатином) вместе с кальциевым ионофором. Для костимуляции вспомогательной молекулы на поверхности T-клетки используют лиганд, который связывается со вспомогательной молекулой. Например, популяцию T-клеток можно привести в контакт с антителом против CD3 и антителом против CD28, в условиях, подходящих для стимуляции пролиферации T-клеток. Для стимуляции пролиферации или CD4+ T-клеток, или CD8+ T-клеток используют антитело против CD3 и антитело против CD28. Примеры антитела против CD28 включают 9.3, B-T3, XR-CD28 (Diaclone, Besancon, Франция), как могут использоваться и другие общеизвестные в данной области техники способы (Berg et al., Transplant Proc. 30(8): 3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9): 1319-1328, 1999; Garland et al., J. Immunol Meth. 227(1-2): 53-63, 1999).

В некоторых аспектах первичный стимулирующий сигнал и костимулирующий сигнал для T-клетки могут быть обеспечены с использованием различных протоколов. Например, агенты, формирующие каждый сигнал, могут находиться в растворе или быть связанными с поверхностью. В случае связывания с поверхностью, агенты могут быть связаны с одной и той же поверхностью (т.е. находиться в «цис»-форме) или с отдельными поверхностями (т.е. находиться в «транс»-форме). Альтернативно, один агент может быть связан с поверхностью, а другой агент находиться в растворе. В одном аспекте агент, формирующий костимулирующий сигнал, связан с поверхностью клетки, а агент, формирующий сигнал первичной активации, находится в растворе или связан с поверхностью. В некоторых аспектах оба агента могут находиться в растворе. В другом аспекте агенты могут находиться в растворимой форме, а затем быть сшиты с поверхностью, например, клеткой, экспрессирующей Fc-рецепторы или антитело или другой связывающий агент, который будет связываться с агентами. В этой связи смотрите, например, публикации заявок на патенты США №№ 20040101519 и 20060034810 для искусственных антигенпрезентирующих клеток (aAPC), которые предусмотрены для применения для активации и размножения T-клеток в настоящем изобретении.

В одном аспекте два агенты иммобилизованы на сферах, или на одной и той же сфере, т.е. «цис», или на отдельных сферах, т.е. «транс». В качестве примера, агентом, формирующим сигнал первичной активации, является антитело против CD3 или его антигенсвязывающий фрагмент, а агентом, формирующим костимулирующий сигнал, является антитело против CD28 или его антигенсвязывающий фрагмент; и оба агента коиммобилизованы на одной и той сфере в эквивалентных молекулярных количествах. В одном аспекте используют составляющее 1:1 отношение каждого антитела, связанного со сферами, для размножения CD4+ T-клеток и роста T-клеток. В некоторых аспектах настоящего изобретения используют отношение антитело против CD3:антитело против CD28, которые связаны со сферами, из условия, чтобы отмечалось увеличение размножения T-клеток по сравнению с размножением, отмечаемым при использовании отношения 1:1. В одном конкретном аспекте отмечается увеличение от приблизительно 1 до приблизительно 3 раз по сравнению с размножением, отмечаемым при использовании отношения 1:1. В одном аспекте отношение антитело против CD3:антитело против CD28, которые связаны со сферами, находится в диапазоне от 100:1 до 1:100 и включает любые целые числа в нем. В одном аспекте настоящего изобретения с частицами связано больше антитела против CD28, чем антитела против CD3, т.е. отношение антитело против CD3:антитело против CD28 меньше 1. В некоторых аспектах настоящего изобретения отношение антитела против CD28 к антителу против CD3, которые связаны со сферами, больше чем 2:1. В одном конкретном аспекте используют составляющее 1:100 отношение CD3:CD28 антител, связанных со сферами. В одном аспекте используют составляющее 1:75 отношение CD3:CD28 антител, связанных со сферами. В дальнейшем аспекте используют составляющее 1:50 отношение CD3:CD28 антител, связанных со сферами. В одном аспекте используют составляющее 1:30 отношение CD3:CD28 антител, связанных со сферами. В одном предпочтительном аспекте используют составляющее 1:10 отношение CD3:CD28 антител, связанных со сферами. В одном аспекте используют составляющее 1:3 отношение CD3:CD28 антител, связанных со сферами. Тем не менее, в другом аспекте используют составляющее 3:1 отношение CD3:CD28 антител, связанных со сферами.

Отношения частиц к клеткам в диапазоне от 1:500 до 500:1 и любые целые числа в нем могут использоваться для стимуляции T-клеток и других клеток-мишеней. Как это совершенно понятно специалистам со средним уровнем компетентности в данной области техники, отношение частиц к клеткам может зависеть от размера частиц по сравнению с клеткой-мишенью. Например, сферы с маленькими размерами могли бы только связать малое число клеток, в то время как более большие сферы могли бы связать большое число. В некоторых аспектах отношение частиц к клеткам находится в диапазоне от 1:100 до 100:1 и включает любые целые числа в нем, и в дальнейших аспектах отношение, которое включает диапазон от 1:9 до 9:1 и любые целые числа в нем, может также использоваться для стимуляции T-клеток. Отношение связанных с антителом против CD3 и антителом против CD28 частиц к T-клеткам, которое приводит к стимуляции T-клеток, может варьировать, как отмечено выше, однако некоторые предпочтительные отношения включают 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1 и 15:1, при этом предпочтительное отношение составляет по крайней мере 1:1 частиц на T-клетку. В одном аспекте используют составляющее 1:1 или меньше отношение частиц к клеткам. В одном конкретном аспекте предпочтительное отношение частица:клетка составляет 1:5. В дальнейших аспектах отношение частиц к клеткам может варьировать в зависимости от дня стимуляции. Например, в одном аспекте отношение частиц к клеткам составляет от 1:1 до 10:1 в первый день, и дополнительные частицы добавляют к клеткам каждый день или через день после этого вплоть до 10 дней, в конечных отношениях от 1:1 до 1:10 (на основе подсчета клеток в день добавления). В одном конкретном аспекте отношение частиц к клеткам составляет 1:1 в первый день стимуляции и доводится до 1:5 на третий и пятый день стимуляции. В одном аспекте частицы добавляют ежедневно или через день до конечного отношения 1:1 в первый день и 1:5 на третий и пятый день стимуляции. В одном аспекте отношение частиц к клеткам составляет 2:1 в первый день стимуляции и доводится до 1:10 на третий и пятый день стимуляции. В одном аспекте частицы добавляют ежедневно или через день до конечного отношения 1:1 в первый день и 1:10 на третий и пятый день стимуляции. Квалифицированному в данной области техники специалисту будет понятно, что множество других отношений может быть подходящим для использования в настоящем изобретении. В частности, отношения будут варьировать в зависимости от размера частиц и от размера и типа клеток. В одном аспекте самые типичные отношения для применения находятся вблизи 1:1, 2:1 и 3:1 в первый день.

В дальнейших аспектах настоящего изобретения клетки, такие как T-клетки, объединяют с покрытыми агентами сферами, сферы и клетки впоследствии разделяют, и затем клетки подвергают культивированию. В альтернативном аспекте, до культивирования, покрытые агентами сферы и клетки не разделяют, а культивируют вместе. В дальнейшем аспекте сферы и клетки сначала концентрируют посредством приложения силы, такой как магнитная сила, что приводит к увеличенному лигированию маркеров клеточной поверхности, тем самым индуцируя стимуляцию клеток.

В качестве примера, белки клеточной поверхности можно лигировать посредством допуска контактирования парамагнитных сфер, к которым присоединены антитело против CD3 и антитело против CD28, (3×28 сфер), с T-клетками. В одном аспекте объединяют клетки (например, 104-109 T-клеток) и сферы (например, DYNABEADS® M-450 CD3/CD28 T парамагнитные сферы в соотношении 1:1) в буфере, например, PBS (без двухвалентных катионов, таких как кальция и магния). Снова, специалисты со средним уровнем компетентности в данной области техники могут легко понять, что может использоваться любая концентрация клеток. Например, представляющая интерес клетка-мишень может быть очень редкой в образце и составлять лишь 0,01% от образца, или весь образец (т.е. 100%) может включать представляющую интерес клетку-мишень. Соответственно, любое количество клеток находится в условиях настоящего изобретения. В некоторых аспектах может быть желательным значительное уменьшение объема, в котором смешивают вместе частицы и клетки, (т.е. увеличение концентрации клеток) для обеспечения максимального контакта клеток и частиц. Например, в одном аспекте используют концентрацию, составляющую 2 биллиона клеток/мл. В одном аспекте используют концентрацию, превышающую 100 миллионов клеток/мл. В дальнейшем аспекте используют концентрацию клеток, составляющую 10, 15, 20, 25, 30, 35, 40, 45 или 50 миллионов клеток/мл. Тем не менее в другом аспекте используют концентрацию клеток, выбираемую из 75, 80, 85, 90, 95 или 100 миллионов клеток/мл. В дальнейших аспектах могут использоваться концентрации, составляющие 125 или 150 миллионов клеток/мл. Использование высоких концентраций может привести к увеличению выхода клеток, активации клеток и размножения клеток. Кроме того, использование высоких концентраций клеток создает возможность для более эффективного захвата клеток, которые могут слабо экспрессировать представляющие интерес антигены-мишени, таких как CD28-негативные T-клетки. Такие популяции клеток могут иметь терапевтическое значение, и их желательно было бы получить в некоторых аспектах. Например, использование высоких концентраций клеток создает возможность для более эффективного отбора CD8+ T-клеток, которые обычно имеют более слабую экспрессию CD28.

В одном аспекте настоящего изобретения смесь можно подвергнуть культивированию в течение интервала от нескольких часов (приблизительно 3 часов) до приблизительно 14 дней или любого часового целого значения в нем. В одном аспекте смесь можно подвергнуть культивированию в течение 21 дня. В одном аспекте настоящего изобретения сферы и T-клетки культивируют вместе в течение приблизительно восьми дней. В одном аспекте сферы и T-клетки культивируют вместе в течение 2-3 дней. Также может быть желательно несколько циклов стимуляции, так что время культивирования T-клеток может составлять 60 дней или более. Подходящие для культивирования T-клеток условия включают соответствующую среду (например, минимальную питательную среду или среду RPMI 1640 или X-vivo 15, (Lonza)), которая может содержать факторы, необходимые для пролиферации и жизнеспособности, включая сыворотку (например, фетальную бычью или человеческую сыворотку), интерлейкин-2 (IL-2), инсулин, IFN-γ, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFβ и TNF-α, или любые другие добавки для роста клеток, известные квалифицированному специалисту. Другие добавки для роста клеток включают, но без ограничения, поверхностно-активное вещество, плазманат и восстанавливающие агенты, такие как N-ацетилцистеин и 2-меркаптоэтанол. Среды могут включать RPMI 1640, AIM-V, DMEM, MEM, α-MEM, F-12, X-Vivo 15 и X-Vivo 20, Optimizer, с добавленными аминокислотами, пируватом натрия и витаминами, или бессывороточные или дополненные соответствующим количеством сыворотки (или плазмы) или определенным рядом гормонов, и/или количеством цитокина(ов), достаточным для роста и размножения T-клеток. Антибиотики, например, пенициллин и стрептомицин, включают только в экспериментальные культуры, но не в культуры клеток, инфузия которых субъекту должна быть проведена. Клетки-мишени поддерживают в условиях, необходимых для поддержания роста, например, при соответствующей температуре (например, 37°C) и атмосферных условиях (например, воздух плюс 5% CO2).

T-клетки, которые были подвергнуты различным периодам времени стимуляции, могут демонстрировать различные характеристики. Например, типичная кровь или аферезные продукты в виде мононуклеарных клеток периферической крови содержат популяцию T-клеток-хелперов (TH, CD4+), которая больше популяции цитотоксических Т-клеток или Т-клеток-супрессоров (TС, CD8+). Ex vivo размножение T-клеток при стимуляции рецепторов CD3 и CD28 порождает популяцию T-клеток, которая до приблизительно дней 8-9 состоит преимущественно из TH-клеток, в то время как через приблизительно 8-9 дней популяция T-клеток включает большую в возрастающей степени популяцию TС-клеток. Соответственно, в зависимости от цели лечения, преимущественной может быть инфузия субъекту популяции T-клеток, состоящей преимущественно из TH-клеток. Так же, если была выделена антигенспецифическая субпопуляция TС-клеток, может быть выгодным размножение этой субпопуляции в большей степени.

Кроме того, помимо маркеров CD4 и CD8, другие фенотипические маркеры могут значительно варьировать, но по большей части, воспроизводимо в ходе процесса размножения клеток. Таким образом, такая воспроизводимость создает возможность для приспособления продукта - активированной T-клетки для конкретных целей.

После конструирования EGFRvIII-специфического CAR, для оценки активности молекулы могут использоваться различные анализы, такие как, но без ограничения, способность к размножению Т-клеток после стимуляции, к поддержанию размножения T-клеток в отсутствие рестимуляции и противораковые активности в соответствующих in vitvo моделях и моделях на животных. Анализы для оценки эффектов EGFRvIII-специфического CAR описаны подробнее ниже.

Анализ с использованием Вестерн-блоттинга экспрессии CAR в первичных Т-клеток может быть использован для обнаружения присутствия мономеров и димеров. Смотрите, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Очень кратко, Т-клетки (1:1 смесь CD4+ и CD8+ Т-клеток), экспрессирующие CAR, размножают in vitro в течение более 10 дней с последующим лизисом и электрофорезом в SDS-ПААГ в восстанавливающих условиях. CAR, содержащие полноразмерный цитоплазматический домен TCR-ζ и эндогенную TCR-ζ цепь, детектируют с помощью Вестерн-блоттинга, используя антитело против TCR-ζ цепи. Те же подмножества Т-клеток используются для анализа с использованием электрофореза в SDS-ПААГ в невосстанавливающих условиях, чтобы обеспечить оценку ковалентного образования димера.

In vitro размножение CAR+ Т-клеток после антигенной стимуляции можно измерить с помощью проточной цитометрии. Например, смесь CD4+ и CD8+ Т-клеток стимулируют с использованием αCD3/αCD28 aAPC с последующей трансдукцией лентивирусными векторами, экспрессирующими GFP под контролем анализируемых промоторов. Приводимые в качестве примера промоторы включают промоторы гена IE CMV, EF-1α, убиквитина C или фосфоглицерокиназы (PGK). Флуоресценция GFP оценивается на 6-й день культивирования в подмножествах CD4+ и/или CD8+ Т-клеток с помощью проточной цитометрии. Смотрите, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Альтернативно, смесь CD4+ и CD8+ Т-клеток стимулируют покрытыми αCD3/αCD28 магнитными сферами в день 0 и трансдуцируют CAR в день 1, используя бицистронный лентивирусный вектор, экспрессирующий CAR вместе с eGFP с помощью последовательности пропуска рибосомой 2А. Культуры повторно стимулируют с использованием или EGFRvIII+ U-87 клеток (U-87-EGFRvIII), U-87 клеток дикого типа (U-87 дикого типа), или клеток К562, экспрессирующих hCD32 и 4-1BBL, в присутствии антитела против CD3 и СD28 (BBL K562-3/28) после промывки. Экзогенный IL-2 добавляют к культурам через день в количестве 100 МЕ/мл. GFP+ Т-клетки подсчитывают с помощью проточной цитометрии, используя основанный на сферах подсчет. Смотрите, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009).

Длительное размножение CAR+ Т-клеток в отсутствие повторного стимулирования может также быть измерено. Смотрите, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Вкратце, средний объем Т-клеток (фл) измеряется на 8-й день культивирования, используя счетчик частиц Coulter Multisizer III, после стимуляции покрытыми αCD3/αCD28 магнитными сферами в день 0 и трансдукции указанным CAR в день 1.

Оценка пролиферации клеток и продукции цитокинов была описана ранее, например, в Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Вкратце, оценка CAR-опосредованной пролиферации осуществляется в титрационных микропланшетах путем смешивания промытых Т-клеток с клетками-мишенями, такими как клетки asU87MG, ВНК или СНО, экспрессирующие EGFRvIII или EGFR дикого типа (wt) или CD32 и CD137 (KT32-BBL), для окончательного соотношения Т-клетки:клетки-мишени=1:1. Моноклональные антитела против CD3 (клон ОКТ3) и против CD28 (клон 9.3) добавляют к культурам с клетками KT32-BBL в качестве положительного контроля для стимулирования пролиферации Т-клеток, поскольку эти сигналы поддерживают длительное размножение CD8+ T-клеток ex vivo. Т-клетки подсчитывают в культурах, используя флуоресцентные сферы CountBright™ (Invitrogen, Carlsbad, CA) и проточную цитометрию, как описано производителем. CAR+ Т-клетки определяют по экспрессии GFP, используя Т-клетки, которые созданы с использованием экспрессирующих связанный с eGFP-2A CAR лентивирусных векторов. В случае CAR+ Т-клеток, не экспрессирующих GFP, CAR+ T-клетки детектируют с помощью биотинилированного рекомбинантного белка EGFRvIII и дополнительного конъюгата авидин-PE. CD4+ и CD8+ экспрессию на Т-клеткам также одновременно детектируют с помощью специфических моноклональных антител (BD Biosciences). Измерения цитокинов выполняются на супернатантах, собранных через 24 часа после рестимулирования, используя набор Cytometric Bead Array для исследования цитокинов Th1/Th2 человека (BD Biosciences, San Diego, CA) в соответствии с инструкциями изготовителя. Флуоресценцию оценивают с помощью проточного цитометра FACScalibur, и данные анализируют в соответствии с инструкциями изготовителя.

Цитотоксичность может быть оценена с помощью стандартного анализа высвобождения 51Cr. Смотрите, например, Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Вкратце, в клетки-мишени (клетки U87MG, ВНК или СНО, экспрессирующие EGFRvIII или EGFR дикого типа (wt), вводят 51Cr (в виде NaCrО4, New England Nuclear, Boston, MA) при 37°С в течение 2 часов с частым перемешиванием, дважды промывают в полной RPMI и высевают в титрационные микропланшеты. Эффекторные Т-клетки смешивают с клетками-мишенями в лунках, в полной среде RPMI при различных соотношениях эффекторные клетки:клетки-мишени (E:T). Также готовят дополнительные лунки, содержащие только среду (самопроизвольное высвобождение, SR) или 1%-ный раствор детергента Triton-X 100 (полное высвобождение, ТR). Через 4 часа инкубации при 37°С собирают супернатант из каждой лунки. Выводившийся 51Cr затем измеряют с помощью счетчика гамма-частиц (Packard Instrument Co., Waltham, MA). Каждое условие выполняют в по крайней мере трех повторах, и процент лизиса рассчитывают по формуле: % лизиса = (ER-SR)/(ТR-SR), где ER представляет собой среднее значение 51Cr, выводившегося в случае каждого экспериментального условия. Также могут использоваться альтернативные анализы цитотоксичности, такие как анализы цитотоксичности на основе потока, как описано в примере 8.

Люцифераза жука-щелкуна красного и жука-щелкуна зеленого может использоваться, чтобы одновременно следовать за прогрессированием опухоли и направленной миграцией Т-клеток, поскольку в случае каждой из них используется один и тот же субстрат люциферин, но излучается свет на противоположных концах спектра видимого света.

Другие анализы, в том числе те, которые описаны в разделе «Примеры» здесь, а также те, которые известны в данной области техники, также могут использоваться для оценки конструкций EGFRvIII-специфических CAR по настоящему изобретению.

Терапевтическое применение для EGFRvIII-экспрессирующих заболеваний и нарушений

EGFRvIII представляет собой специфический для опухоли, лиганд-независимый, конститутивно активный вариант рецептора эпидермального фактора роста. Настоящим изобретением обеспечиваются композиции и способы для лечения заболеваний и нарушений, связанных с EGFRvIII. Примером заболевания или нарушения, связанного с EGFRvIII, является глиома.

Глиома относится к раку центральной нервной системы, который начинается в глиальных клетках (например, клетках, которые окружают и поддерживают нервные клетки и включают олигодендроциты, астроциты, микроглии и эпендимальные клетки). Глиомы особенно опасны в плане и коэффициента заболеваемости, и злокачественности и подразделяются на семь или более типов, таких как глиобластома и анапластическая астроцитома в соответствии с их детализированным патологическим типом ткани. Стадия заболевания (размер опухоли, наличие дистальных метастазов) и гистологическая злокачественность используются при определении степени злокачественности первичных опухолей головного мозга. Гистологическая злокачественность подразделяется на четыре уровня, т.е. G1-G4 в соответствии с Руководством по лечению опухолей головного мозга ((2002) Kanehara & Co., Ltd.), и они соответствуют WHO1-WHO4, соответственно. Чем больше число, тем выше степень злокачественности. Например, злокачественность глиобластомы равна G4 (WHO4), в то время как злокачественность анапластической астроцитомы равна G3 (WHO3), и как G3, так и G4 определяются как злокачественные. Таким образом, в соответствии с некоторыми вариантами осуществления способы по этому изобретению нацелены на злокачественные глиомы. В других аспектах настоящее изобретение нацелено на мультиформную глиобластому (GBM). В дальнейших вариантах осуществления композиции и способы по настоящему изобретению могут использоваться при лечении других глиом, включая, но без ограничения, анапластическую астроцитому, гигантоклеточную глиобластому, глиосаркому, анапластическую олигодендроглиому, анапластическую эпендимому, карциному сосудистого сплетения, анапластическую ганглиоглиому, пинеобластому, медуллоэпителиому, эпендимобластому, медуллобластому, супратенториальную примитивную нейроэктодермальную опухоль и атипичную тератоидную/рабдоидную опухоль.

Глиобластома является самой распространенной первичной опухолью головного мозга у взрослых. Более половины из 18000 пациентов, у которых диагностируются злокачественные первичные опухоли головного мозга в США каждый год, имеют мультиформную глиобластому. Мультиформная глиобластома представляет собой анапластическую, исключительно клеточную опухоль, с высокими показателями пролиферации, разрастанием мелких сосудов и фокальным некрозом. Признаки и симптомы зависят от нескольких факторов (размера, скорости роста, локализации опухоли в головном мозге) и представлены в основном головной болью, судорогами, неврологические расстройства, изменениями психического состояния. Прогноз мультиформной глиобластомы остается мрачным. Время жизни составляет менее 2 лет для большинства пациентов. Общее состояние по шкале Карнофского (KPS) является одним из самых важных прогностических факторов: пациенты с KPS >70 живы через 18 месяцев в приблизительно 18% случаев, по сравнению с 13% пациентов с более низкими оценками KPS. Первичная мультиформная глиобластома развивается de novo из глиальных клеток, как правило, имеет историю болезни в течение менее шести месяцев, является более распространенной у пожилых пациентов и представляет собой мелкоклеточную опухоль по гистологии. Вторичная мультиформная глиобластома развивается в течение месяцев или лет из уже существующих астроцитом с низкой степенью злокачественности, преимущественно поражает молодых людей и представляет собой гигантоклеточную опухоль по гистологии.

Злокачественные глиомы также известны как глиомы с высокой степенью злокачественности. Они могут поражать головной мозг и спинной мозг. В некоторых аспектах композиции и способы по настоящему изобретению могут использоваться для лечения субъектов, имеющих злокачественную глиому в головном мозге, например, такую, которую выбирают из анапластической астроцитомы (АА), мультиформной глиобластомы (GBM), анапластической олигодендроглиомы (АО) и анапластической олигоастроцитомы (АОА). В некоторых аспектах композиции и способы по настоящему изобретению могут использоваться для лечения субъектов, имеющих мультиформную глиобластому (GBM).

Мультиформная глиобластома является самой злокачественной стадией астроцитомы, со временем дожития менее 2 лет для большинства пациентов. Гистологически эти опухоли характеризуются высокими показателями пролиферации, пролиферацией эндотелиальных клеток и фокальным некрозом. В высокой степени пролиферативной характер этих поражений, по-видимому, является результатом нескольких митогенных эффектов. Один из признаков GBM является пролиферация эндотелиальных клеток. Множество факторов ангиогенеза и их рецепторов обнаруживается в GBM.

Существуют биологические подмножества астроцитом, которые могут отражать клиническую гетерогенность, наблюдаемую в случае этих опухолей. Эти подмножества включают глиомы ствола головного мозга, которые являются формой диффузной, фибриллярной астроцитомы у людей, которые часто развиваются по злокачественному курсу. GBM ствола головного мозга имеют общие генетические признаки с GBM у взрослых, которые поражают молодых пациентов. Плейоморфная ксантоастроцитома (PXA) является поверхностной, астроцитарной опухолью с низкой степенью злокачественности, которая преимущественно поражает молодых взрослых людей. Хотя эти опухоли имеют аномальные гистологические признаки, они, как правило, являются медленно растущими опухолями, которые могут поддаваться хирургическому лечению. Некоторые PXA, однако, могут возвращаться в виде GBM. Волосовидная астроцитома является самой распространенной астроцитарной опухолью у детей и клинически и гистопатологически отличается от диффузной, фибриллярной астроцитомы, которая поражает взрослых. Волосовидные астроцитомы не имеют те же геномные изменения, что и диффузная, фибриллярная астроцитома. Субэпендимальные гигантоклеточные астроцитомы (SEGA) являются перивентрикулярными астроцитарными опухолями с низкой степенью злокачественности, которые, как правило, сопровождаются эпилойэй (TS), и гистологически идентичны так называемым «оплываниями свечи», которые выстилают желудочки пациентов с TS. Подобно другим опухолевым поражениям в ТС, они являются медленно растущими и могут быть больше похожи на гамартомы, чем на истинные новообразования. Десмопластическая астроцитома головного мозга у детей грудного возраста (DCAI) и десмопластическая ганглиоглиома у детей грудного возраста (DIGG) представляют собой большие, поверхностные, обычно кистозные, доброкачественные астроцитомы, которые поражают детей в первый год или два жизни.

Олигодендроглиомы и олигоастроцитомы (смешанные глиомы) представляют собой диффузные, глиальные опухоли в основном ЦНС, которые являются клинически и биологически наиболее близкородственными с диффузными, фибриллярными астроцитомами. Опухоли, однако, гораздо меньше распространены, чем астроцитомы, и имеют, как правило, лучшие прогнозы, чем диффузные астроцитомы. Олигодендроглиомы и олигоастроцитомы могут развиваться или в анапластическую олигодендроглиому, или анапластическую олигоастроцитому WHO степени III, или в GBM WHO степени IV. Таким образом, генетические изменения, которые приводят к олигодендроглиальным опухолям, представляют собой еще один путь к GBM.

Эпендимомы представляют собой клинически разнородную группу глиом, которые варьируют от агрессивных внутрижелудочковых опухолей у детей до доброкачественных опухолей спинного мозга у взрослых. Перерождения эпендимомы в GBM редки. Опухоли сосудистого сплетения также представляют собой разнообразную группу опухолей, которые преимущественно возникают в системе желудочков мозга, начиная от агрессивных супратенториальных внутрижелудочковых опухолей у детей до доброкачественных опухолей мостомозжечкового угла у взрослых. Опухоли сосудистого сплетения иногда регистрировали у пациентов с синдромом Ли-Фраумени и заболеванием Гиппеля-Линдау (VHL).

Медуллобластомы представляют собой злокачественные, примитивные опухоли, которые возникают в задней черепной ямке, в основном у детей. Эти опухоли также встречаются у молодых взрослых людей. Медуллобластомы часто являются хирургически удаляемыми с последующим лечением с использованием химиотерапии и/или облучения. Они могут возвращаться локально или иногда как падающий метастаз из задней черепной ямки в позвоночник. Менингиомы представляют собой распространенные внутричерепные опухоли, которые возникают в мозговых оболочках и сдавливают находящийся ниже мозг. Хотя они, как правило, считаются доброкачественными и лишь редко открыто злокачественными, борьба с этими опухолями часто представляет клинические проблемы. Гистологические степени менингиом варьируют, при этом большинство являются доброкачественными, WHO степень I/IV (82%); реже атипичными, WHO степень II/IV (15%); и редко они встречаются как анапластические или злокачественные, WHO степень III/IV (3%).

Шванномы представляют собой доброкачественные опухоли, которые возникают на периферических нервах. Шванномы могут возникнуть на черепно-мозговых нервах, особенно вестибулярной части восьмого черепного нерва (вестибулярные шванномы, невриномы слухового нерва), где они появляются в виде опухолей мостомозжечкового угла. Гемангиобластомы являются опухолями неясного происхождения, которые состоят из эндотелиальных клеток, перицитов и так называемых стромальных клеток. Эти доброкачественные опухоли чаще всего возникают в мозжечке и спинном мозге молодых взрослых людей. Множественные гемангиобластомы характерны для заболевания Гиппеля-Линдау (VHL). Гемангиоперицитомы (HPC) являются дуральными опухолями, которые могут демонстрировать локально агрессивное поведение и могут метастазировать. Гистогенез дуральной гемангиоперицитомы (HPC) уже давно обсуждается, при этом некоторые авторы определяют ее самостоятельную единицу, а другие определяют ее как подтип менингиомы.

Симптомы как первичных, так и метастатических опухолей головного мозга часто зависят от местоположения в головном мозге и размера опухоли. Поскольку различные отделы мозга отвечают за конкретные функции, клинические симптомы будут сильно варьировать. Опухоли в лобной доле головного мозга могут вызывать слабость и паралич, нарушения настроения, трудности мышления, спутанность сознания и дезориентацию, и широкие эмоциональные перепады настроения. Опухоли в теменной доле могут вызывать судороги, онемение или паралич, трудности в написании от руки, неспособность выполнять простые математические задачи, трудности с определенными движениями и потерю тактильного чувства. Опухоли в затылочной доле могут привести к потере зрения в половине каждого поля зрения, зрительные галлюцинации и судороги. Опухоли в височной доле могут вызывать судороги, нарушения восприятия и нарушения в пространстве и сенсорную афазию. Если опухоль возникает в мозжечке, человек может иметь атаксию, потерю координации, головные боли и рвоту. Опухоли в гипоталамусе могут вызывать эмоциональные изменения и изменения в восприятии горячего и холодного. Кроме того, опухоли в гипоталамусе могут влиять на рост и питание у детей. За исключением мозжечка, опухоль с одной стороны головного мозга вызывает симптомы и повреждения на противоположной стороне тела.

Композиции и способы по настоящему изобретению могут использоваться для лечения субъекта, который был охарактеризован как имеющий клетки или ткани, экспрессирующие EGFRvIII, или у которого подозревается наличие клеток или тканей, экспрессирующих EGFRvIII. Например, субъекты, которым принесет пользу лечение в соответствии с настоящим изобретением, включают субъектов с глиомой или субъектов с подозрением на наличие глиомы, например, о чем свидетельствует наличие одного или более из следующего: головных болей, тошноты и рвоты, судорог, потери зрения, боли, слабости, онемения в конечностях и/или поражения черепно-мозговых нервов в результате повышения внутричерепного давления. В конкретных вариантах осуществления подвергаемой лечению глиомой является мультиформная глиобластома. В соответствии с этим вариантом осуществления мультиформная глиобластома может быть в головном мозге или спинном мозге.

Настоящим изобретением также обеспечиваются способы ингибирования пролиферации или уменьшения популяции EGFRvIII-экспрессирующих клеток, при этом способы включают приведение популяции клеток, включающей EGFRvIII-экспрессирующую клетку, в контакт с экспрессирующей CAR клеткой, описанной здесь, например, Т-клеткой, которая связывается с EGFRvIII-экспрессирующей клеткой. В конкретном варианте осуществления настоящим изобретением обеспечиваются способы ингибирования пролиферации или уменьшения популяции раковых клеток, экспрессирующих EGFRvIII, при этом способы включают приведение популяции EGFRvIII-экспрессирующих раковых клеток в контакт с экспрессирующей CAR клеткой, описанной здесь, например, Т-клеткой, которая связывается с EGFRvIII-экспрессирующей клеткой. В другом варианте осуществления настоящим изобретением обеспечиваются способы ингибирования пролиферации или уменьшения популяции раковых клеток, экспрессирующих EGFRvIII, при этом способы включают приведение популяции EGFRvIII-экспрессирующих раковых клеток в контакт с экспрессирующей EGFRvIII-специфический CAR T-клеткой, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В некоторых вариантах осуществления экспрессирующая EGFRvIII-специфический CAR T-клетка по настоящему изобретению уменьшает количество или процент клеток и/или раковых клеток на по крайней мере 25%, по крайней мере 30%, по крайней мере 40%, по крайней мере 50%, по крайней мере 65%, по крайней мере 75%, по крайней мере 85%, по крайней мере 95% или по крайней мере 99% у субъекта с или модели на животном глиомы(ой) или другого(им) рака(ом), связанного(ым) с EGFRvIII-экспрессирующими клетками, по сравнению с отрицательным контролем. В одном аспекте субъектом является человек.

Настоящим изобретением также обеспечиваются способы предотвращения, лечения заболевания, связанного с EGFRvIII-экспрессирующими клетками, (например, глиобластомы), и/или борьбы с ним, при этом способы включают введение субъекту, нуждающемуся в этом, экспрессирующей EGFRvIII-специфический CAR T-клетки, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В одном аспекте субъектом является человек.

Настоящим изобретением также обеспечиваются способы предотвращения рецидива рака, связанного с EGFRvIII-экспрессирующими клетками, при этом способы включают введение субъекту, нуждающемуся в этом, экспрессирующей EGFRvIII-специфический CAR T-клетки, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В одном варианте осуществления способы включают введение субъекту, нуждающемуся в этом, эффективного количества экспрессирующей EGFRvIII-специфический CAR T-клетки, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой, в комбинации с эффективным количеством другой терапии.

В одном аспекте настоящее изобретение относится к вектору, включающему EGFRvIII-специфический CAR, функционально связанный с промотором для экспрессии в Т-клетках млекопитающих. В одном аспекте настоящим изобретением обеспечивается рекомбинантная T-клетка, экспрессирующая EGFRvIII-специфический CAR, для применения в лечении опухолей, экспрессирующих EGFRvIII. Рекомбинантную Т-клетку, экспрессирующую CAR на основе антитела против EGFRvIII, называют экспрессирующей EGFRvIII-специфический CAR T-клеткой. В одном аспекте экспрессирующая EGFRvIII-специфический CAR T-клетка по настоящему изобретению способна к контактированию опухолевой клетки с по крайней мере одним EGFRvIII-специфическим CAR по настоящему изобретению, представленным на поверхности, таким образом, что экспрессирующая EGFRvIII-специфический CAR T-клетка активируется в ответ на антиген, и CAR-T-клетка воздействует на опухолевую клетку, и рост опухоли ингибируется.

В одном аспекте настоящее изобретение относится к способу ингибирования роста EGFRvIII-экспрессирующей опухолевой клетки, включающему приведение опухолевой клетки в контакт с экспрессирующей EGFRvIII-специфический CAR T-клеткой, описанной здесь, так что CAR-T-клетка активируется в ответ на антиген и воздействует на раковую клетку, при этом рост опухоли ингибируется. В одном аспекте активированная CAR-T-клетка воздействует на раковые клетки и уничтожает их.

В одном аспекте настоящее изобретение относится к способу лечения рака у субъекта. Способ включает введение субъекту экспрессирующей EGFRvIII-специфический CAR Т-клетки, описанной здесь, так что осуществляется лечение рака у субъекта. Примером рака, который поддается лечению с помощью экспрессирующей EGFRvIII-специфический CAR Т-клетки по настоящему изобретению, является рак, связанный с экспрессией EGFRvIII. В одном аспекте раком, связанным с экспрессией EGFRvIII, является глиобластома.

В одном аспекте рак, связанный с EGFRvIII, выбирают из группы, состоящей из мультиформной глиобластомы (GBM), анапластической астроцитомы, гигантоклеточной глиобластомы, глиосаркомы, анапластической олигодендроглиомы, анапластической эпендимомы, карциномы сосудистого сплетения, анапластической ганглиоглиомы, пинеобластомы, медуллоэпителиомы, эпендимобластомы, медуллобластомы, супратенториальной примитивной нейроэктодермальной опухоли и атипичной тератоидной/рабдоидной опухоли, немелкоклеточного рака легкого, рака легкого, молочной железы, предстательной железы, яичников, колоректального рака и рака мочевого пузыря и любой их комбинации.

Настоящее изобретение включает тип клеточной терапии, в случае которой T-клетки генетически модифицируют для экспрессии химерного антигенспецифического рецептора (CAR), и проводят инфузию CAR-Т-клетки реципиенту, нуждающемуся в этом. Клетка, инфузия которой проведена, способна к уничтожению опухолевых клеток у реципиента. В некоторых вариантах осуществления CAR-модифицированные Т-клетки способны к репликации in vivo, что приводит к длительному сохранению, которое может приводить к длительному контролю опухоли. В различных аспектах Т-клетки введенные пациенту, или их потомство сохраняются в организме пациента в течение по крайней мере четырех месяцев, пяти месяцев, шести месяцев, семи месяцев, восьми месяцев, девяти месяцев, десяти месяцев, одиннадцати месяцев, двенадцати месяцев, тринадцати месяцев, четырнадцати месяц, пятнадцати месяцев, шестнадцати месяцев, семнадцати месяцев, восемнадцати месяцев, девятнадцати месяцев, двадцати месяцев, двадцати одного месяца, двадцати двух месяцев, двадцать трех месяцев, двух лет, трех лет, четырех лет или пяти лет после введения Т-клетки пациенту.

В одном аспекте CAR-модифицированные T-клетки, описанные здесь, могут также выступать в качестве типа вакцины для ex vivo иммунизации и/или in vivo терапии для млекопитающего. В одном аспекте млекопитающим является человек.

Что касается ex vivo иммунизации, по крайней мере одно из следующего имеет место in vitro до введения клетки млекопитающему: i) размножение клеток, ii) введение нуклеиновой кислоты, кодирующей CAR, в клетки и/или iii) криоконсервация клеток.

Ex vivo процедуры хорошо известны в данной области техники и подробнее обсуждаются ниже. Вкратце, клетки выделяют от млекопитающего (например, человека) и генетически модифицируют (например, трансдуцируют или трансфицируют in vitro) с использованием вектора, экспрессирующего CAR, описанного здесь. CAR-модифицированную клетку можно ввести млекопитающему-реципиенту для обеспечения терапевтического эффекта. Млекопитающим-реципиентом может быть человек, и CAR- модифицированная клетка может быть аутологичной по отношению к реципиенту. Альтернативно, клетки могут быть аллогенными, сингенными или ксеногенными по отношению к реципиенту.

Процедура для ex vivo размножения гемопоэтических стволовых клеток и клеток-предшественников, описанная в патенте США № 5199942, который включен сюда посредством ссылки, может применяться для клеток по настоящему изобретению. В данной области техники известны другие подходящие способы, по этой причине настоящее изобретение не ограничивается каким-либо конкретным способом ex vivo размножения клеток. Вкратце, ex vivo культивирование и размножение T-клеток включает: (1) получение CD34+ гемопоэтических стволовых клеток и клеток-предшественников от млекопитающего, исходя из сбора периферической крови или эксплантатов костного мозга; и (2) размножение таких клеток ex vivo. Помимо факторов клеточного роста, описанных в патенте США № 5199942, другие факторы, такие как flt3-L, IL-1, IL-3 и c-kit-лиганд, могут использоваться для культивирования и размножения клеток.

Помимо использования вакцины на основе клеток в плане ex vivo иммунизации, настоящим изобретением также обеспечиваются композиции и способы для in vivo иммунизации для вызова иммунного ответа, направленного против антигена у пациента.

В целом, клетки, активированные и размноженные, как здесь описывается, могут использоваться при лечении и предупреждении заболеваний, которые возникают у индивидуумов с ослабленным иммунитетом. В частности, CAR-модифицированные T-клетки по настоящему изобретению используются при лечении заболеваний, нарушений и состояний, связанных с экспрессией EGFRvIII. В некоторых аспектах клетки по настоящему изобретению используются при лечении пациентов, подверженных риску развития заболеваний, нарушений и состояний, связанных с экспрессией EGFRvIII. Таким образом, настоящим изобретением обеспечиваются способы лечения или предупреждения заболеваний, нарушений и состояний, связанных с экспрессией EGFRvIII, включающие введение субъекту, нуждающемуся в этом, терапевтически эффективного количества CAR-модифицированных T-клеток по настоящему изобретению.

CAR-модифицированные T-клетки по настоящему изобретению могут вводиться или отдельно, или в виде фармацевтической композиции в комбинации с разбавителями и/или с другими компонентами, такими как IL-2 или другие цитокины, или популяциями клеток, или другими лекарственными терапиями, например, описанными здесь.

Настоящим изобретением также обеспечиваются способы ингибирования пролиферации или уменьшения популяции EGFRvIII-экспрессирующих клеток, при этом способы включают приведение популяции клеток, включающей EGFRvIII-экспрессирующую клетку, в контакт с экспрессирующей EGFRvIII-специфический CAR T-клеткой, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В конкретном аспекте настоящим изобретением обеспечиваются способы ингибирования пролиферации или уменьшения популяции раковых клеток, экспрессирующих EGFRvIII, при этом способы включают приведение популяции EGFRvIII-экспрессирующих раковых клеток в контакт с экспрессирующей EGFRvIII-специфический CAR T-клеткой, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В одном аспекте настоящим изобретением обеспечиваются способы ингибирования пролиферации или уменьшения популяции раковых клеток, экспрессирующих EGFRvIII, при этом способы включают приведение популяции EGFRvIII-экспрессирующих раковых клеток в контакт с экспрессирующей EGFRvIII-специфический CAR T-клеткой, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В некоторых аспектах экспрессирующая EGFRvIII-специфический CAR T-клетка по настоящему изобретению уменьшает количество или процент клеток и/или раковых клеток на по крайней мере 25%, по крайней мере 30%, по крайней мере 40%, по крайней мере 50%, по крайней мере 65%, по крайней мере 75%, по крайней мере 85%, по крайней мере 95% или по крайней мере 99% у субъекта с или модели на животном глиомы(ой) или другого(им) рака(ом), связанного(ым) с EGFRvIII-экспрессирующими клетками, по сравнению с отрицательным контролем. В одном аспекте субъектом является человек.

Настоящим изобретением также обеспечиваются способы предотвращения, лечения заболевания, связанного с EGFRvIII-экспрессирующими клетками, (например, глиобластомы) и/или борьбы с ним, при этом способы включают введение субъекту, нуждающемуся в этом, экспрессирующей EGFRvIII-специфический CAR T-клетки, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В одном аспекте субъектом является человек.

Настоящим изобретением также обеспечиваются способы предотвращения рецидива рака, связанного с EGFRvIII-экспрессирующими клетками, при этом способы включают введение субъекту, нуждающемуся в этом, экспрессирующей EGFRvIII-специфический CAR T-клетки, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой. В одном аспекте способы включают введение субъекту, нуждающемуся в этом, эффективного количества экспрессирующей EGFRvIII-специфический CAR T-клетки, описанной здесь, которая связывается с EGFRvIII-экспрессирующей клеткой, в комбинации с эффективным количеством другой терапии.

Комбинированные терапии

CAR-экспрессирующая клетка, описанная здесь, может использоваться в комбинации с другими известными агентами и терапиями. Вводимые «в комбинации», как здесь используется, означает, что два (или более) различных метода лечения назначаются субъекту во время поражения субъекта заболеванием, например, два или более лечений назначаются после диагностирования у субъекта заболевания и до того, как заболевание было вылечено или устранено, или лечение было прекращено по другим причинам. В некоторых вариантах осуществления назначение одного лечения все еще происходит, когда начинается назначение второго лечения, так что существует перекрывание, что касается введения. Это иногда упоминается здесь как «одновременное» или «параллельное» назначение (доставка). В других вариантах осуществления назначение одного лечения заканчивается до начала назначения другого лечения. В некоторых вариантах осуществления того или другого случая лечение является более эффективным из-за комбинированного введения. Например, второе лечение является более эффективным, например, отмечается эквивалентный эффект при использовании менее интенсивного второго лечения, или второе лечение ослабляет симптомы в большей степени, чем можно было бы увидеть, если бы второе лечение было назначено в отсутствие первого лечения, или аналогичная ситуация наблюдается с первым лечением. В некоторых вариантах осуществления назначение является таким, что ослабление симптома, или уменьшение другого параметра, связанного с заболеванием, больше, чем можно было бы наблюдать в случае одного лечения, назначенного в отсутствие другого. Эффект двух лечений может быть частично аддитивным, полностью аддитивным или более чем аддитивным. Назначение может быть таким, что эффект первого назначенного лечения является все еще выявляемым, когда назначают второе лечение.

CAR-экспрессирующая клетка, описанная здесь, и по крайней мере одно дополнительное терапевтическое средство могут вводиться одновременно, в одной и той же композиции или в отдельных композиций, или последовательно. В случае последовательного введения первой можно вводить CAR-экспрессирующую клетку, описанную здесь, а вторым можно вводить дополнительный агент, или порядок введения может быть обратным.

В других аспектах CAR-экспрессирующую клетку, описанную здесь, можно использовать в схеме лечения в комбинации с хирургическим вмешательством, химиотерапией, облучением, иммунодепрессантами, такими как циклоспорин, азатиоприн, метотрексат, микофенолат и FK506, антителами или другими иммуноаблативными агентами, такими как CAMPATH, антитела против CD3 или другие терапии с использованием антител, цитоксин, флударабин, циклоспорин, FK506, рапамицин, микофенольная кислота, стероиды, FR901228, цитокины, и облучение. Приводимые в качестве примера иммунотерапевтические методы для злокачественной глиомы представлены в Johnson et al., 2010, Curr Neurol Neurosci Rep 10: 259-266. В некоторых вариантах осуществления CAR-экспрессирующую клетку, описанную здесь, можно использовать в схеме лечения в комбинации с агентом, мишенью которого являются экстраклеточные матричные белки, такие как тенасцин, например, антителом против тенасцина, например, 211Аt-меченным антителом против тенасцина. В некоторых вариантах осуществления CAR-экспрессирующую клетку, описанную здесь, можно использовать в схеме лечения в комбинации с иммуномодулирующим агентом, таким как интерферон альфа, интерферон бета, пептидный ингибитор TGF-β2 или поли-ICLC. В некоторых вариантах осуществления CAR-экспрессирующую клетку, описанную здесь, можно использовать в схеме лечения в комбинации с пептидной вакциной против фактора транскрипции WT1, такой как та, которая описана в Izumoto et al., 2008, J Neurosurg 108: 963-971.

В одном варианте осуществления CAR-экспрессирующую клетку, описанную здесь, можно использовать в комбинации с химиотерапевтическим агентом. Приводимые в качестве примера химиотерапевтические агенты включают алкилирующий агент, агент на основе платины, ингибитор ангиогенеза (например, ингибитор пути с участием VEGF, ингибитор тирозинкиназы (например, ингибитор пути с участием EGF), ингибитор mTOR.

Основные химиотерапевтические агенты, рассматриваемые для применения в комбинированной терапии, включают анастрозол (Arimidex®), бикалутамид (Casodex®), блеомицина сульфат (Blenoxane®), бусульфан (Myleran®), бусульфан в инъекционной форме (Busulfex®), капецитабин (Xeloda®), N4-пентоксикарбонил-5-дезокси-5-фторцитидин, карбоплатин (Paraplatin®), кармустин (BiCNU®), хлорамбуцил (Leukeran®), цисплатин (Platinol®), кладрибин (Leustatin®), циклофосфамид (Cytoxan® или Neosar®), цитарабин, цитозинарабинозид (Cytosar-U®), цитарабин в липосомальной форме для инъекции (DepoCyt®), дакарбазин (DTIC-Dome®), дактиномицин (Актиномицин D, Космеган), даунорубицина гидрохлорид (Cerubidine®), даунорубицина цитрат в липосомальной форме для инъекции (DaunoXome®), дексаметазон, доцетаксел (Taxotere®), доксорубицина гидрохлорид (Adriamycin®, Rubex®), этопозид (Vepesid®), флударабина фосфат (Fludara®), 5- фторурацил (Adrucil®, Efudex®), флутамид (Eulexin®), тезацитибин, гемцитабин (дифтордезоксицитидин), гидроксимочевину (Hydrea®), Идарубицин (Idamycin®), ифосфамид (IFEX®), иринотекан (Camptosar®), L-аспарагиназу (ELSPAR®), лейковорина кальция, мелфалан (Alkeran®), 6-меркаптопурин (Purinethol®), метотрексат (Folex®), митоксантрон (Novantrone®), милотарг, паклитаксел (Taxol®), Phoenix (Yttrium90/MX-DTPA), пентостатин, полифепросан 20 с кармустином, имплантат (Gliadel®), тамоксифена цитрат (Nolvadex®), тенипозид (Vumon®), 6-тиогуанин, тиотепу, тирапазамин (Tirazone®), топотекана гидрохлорид для инъекции (Hycamptin®), винбластин (Velban®), винкристин (Oncovin®), и винорелбин (Navelbine®).

Приводимые в качестве примера алкилирующие агенты включают, без ограничения, азотистые иприты, производные этиленимина, алкилсульфонаты, нитрозомочевины и триазены: урациловый иприт (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desmethyldopan®, Haemanthamine®, Nordopan®, Uracil nitrogen mustard®, Uracillost®, Uracilmostaza®, Uramustin®, Uramustine®), хлорметин (Mustargen®), циклофосфамид (Cytoxan®, Neosar®, Clafen®, Endoxan®, Procytox®, Revimmune™), ифосфамид (Mitoxana®), мелфалан (Alkeran®), Хлорамбуцил (Leukeran®), пипоброман (Amedel®, Vercyte®), триэтиленмеламин (Hemel®, Hexalen®, Hexastat®), триэтилентиофосфорамин, Темозоломид (Temodar®), тиотепу (Thioplex®), бусульфан (Busilvex®, Myleran®), кармустин (BiCNU®), ломустин (CeeNU®), стрептозоцин (Zanosar®) и Дакарбазин (DTIC-Dome®). Дополнительные приводимые в качестве примера алкилирующие агенты включают, без ограничения, Оксалиплатин (Eloxatin®); Темозоломид (Temodar® и Temodal®); Дактиномицин (также известный как актиномицин-D, Cosmegen®); Мелфалан (также известный как L-PAM, L-сарколизин и фенилаланиновый иприт, Alkeran®); Алтретамин (также известный как гексаметилмеламин (HMM), Hexalen®); Кармустин (BiCNU®); Бендамустин (Treanda®); Бусульфан (Busulfex® и Myleran®); Карбоплатин (Paraplatin®); Ломустин (также известный как CCNU, CeeNU®); Цисплатин (также известный как CDDP, Platinol® и Platinol®-AQ); Хлорамбуцил (Leukeran®); Циклофосфамид (Cytoxan® и Neosar®); Дакарбазин (также известный как DTIC, DIC и имидазолкарбоксамид, DTIC-Dome®); Алтретамин (также известный как гексаметилмеламин (HMM), Hexalen®); Ифосфамид (Ifex®); Преднумустин; Прокарбазин (Matulane®); Мехлоретамин (также известный как азотистый иприт, мустин и мехлоретамина гидрохлорид, Mustargen®); Стрептозоцин (Zanosar®); Тиотепу (также известную как тиофосфороамид, TESPA и TSPA, Thioplex®); Циклофосфамид (Endoxan®, Cytoxan®, Neosar®, Procytox®, Revimmune®) и Бендамустина НС1 (Treanda®).

Приводимые в качестве примера агенты на основе платины включают, без ограничения, карбоплатин, цисплатин и оксалиплатин.

Приводимые в качестве примера ингибиторы ангиогенеза включают, без ограничения, A6 (Angstrom Pharmacueticals), АВТ-510 (Abbott Laboratories), АВТ-627 (Атрасентан) (Abbott Laboratories/Xinlay), АВТ-869 (Abbott Laboratories), Актимид (CC4047, Помалидомид) (Celgene Corporation), AdGVPEDF.11D (GenVec), ADH-1 (Эксгерин) (Adherex Technologies), AEE788 (Novartis), AG-013736 (Акситиниб) (Pfizer), AG3340 (Приномастат) (Agouron Pharmaceuticals), AGX1053 (AngioGenex), AGX51 (AngioGenex), ALN-VSP (ALN-VSP О2) (Alnylam Pharmaceuticals), AMG 386 (Amgen), AMG706 (Amgen), Апатиниб (YN968D1) (Jiangsu Hengrui Medicine), AP23573 (Ридафоролимус/MK8669) (Ariad Pharmaceuticals), AQ4N (Novavea), ARQ 197 (ArQule), ASA404 (Novartis/Antisoma), Атипримод (Callisto Pharmaceuticals), ATN-161 (Attenuon), AV-412 (Aveo Pharmaceuticals), AV-951 (Aveo Pharmaceuticals), Авастин (Бевацизумаб) (Genentech), AZD2171 (Цедираниб/Рецентин) (AstraZeneca), BAY 57-9352 (Телатиниб) (Bayer), BEZ235 (Novartis), BIBF1120 (Boehringer Ingelheim Pharmaceuticals), BIBW 2992 (Boehringer Ingelheim Pharmaceuticals), BMS-275291 (Bristol-Myers Squibb), BMS-582664 (Бриваниб) (Bristol-Myers Squibb), BMS-690514 (Bristol-Myers Squibb), Кальцитриол, CCI-779 (Торисел) (Wyeth), CDP-791 (ImClone Systems), Цефлатонин (Гомогаррингтонин/HHT) (ChemGenex Therapeutics), Целебрекс (Целекоксиб) (Pfizer), CEP-7055 (Цефалон/Sanofi), CHIR-265 (Chiron Corporation), NGR-TNF, COL-3 (Метастат) (Collagenex Pharaceuticals), Комбретастатин (Oxigene), CP-751871 (Фигитумумаб) (Pfizer), CP-547,632 (Pfizer), CS-7017 (Daiichi Sankyo Pharma), CT-322 (Ангиоцепт) (Adnexus), Куркумин, Дальтепарин (Фрагмин) (Pfizer), Дисульфирам (Antabuse), E7820 (Eisai Limited), E7080 (Eisai Limited), EMD 121974 (Циленгитид) (EMD Pharmaceuticals), ENMD-1198 (EntreMed), ENMD-2076 (EntreMed), Эндостар (Simcere), Эрбитукс (ImClone/Bristol-Myers Squibb), EZN-2208 (Enzon Pharmaceuticals), EZN-2968 (Enzon Pharmaceuticals), GC1008 (Genzyme), Генистеин, GSK1363089 (Форетиниб) (GlaxoSmithKline), GW786034 (Пазопаниб) (GlaxoSmithKline), GT-111 (Vascular Biogenics Ltd.), IMC-1121B (Рамуцирумаб) (ImClone Systems), IMC-18F1 (ImClone Systems), IMC-3G3 (ImClone LLC), INCB007839 (Incyte Corporation), INGN 241 (Introgen Therapeutics), Ирессу (ZD1839/Гефитиниб), LBH589 (Фаридак/Панобиностат) (Novartis), Луцентис (Ранибизумаб) (Genentech/Novartis), LY317615 (Энзастаурин) (Eli Lilly and Company), Макуген (Пегаптаниб) (Pfizer), MEDI522 (Абегрин) (MedImmune), MLN518 (Тандутиниб) (Millennium), Неовастат (AE941/Бенефин) (Aeterna Zentaris), Нексавар (Bayer/Onyx), NM-3 (Genzyme Corporation), Носкапин (Cougar Biotechnology), NPI-2358 (Nereus Pharmaceuticals), OSI-930 (OSI), Паломид 529 (Paloma Pharmaceuticals, Inc), Panzem в капсулах (2ME2) (EntreMed), Panzem NCD (2ME2) (EntreMed), PF-02341066 (Pfizer), PF-04554878 (Pfizer), PI-88 (Progen Industries/Medigen Biotechnology), PKC412 (Novartis), Полифенон E (экстракт зеленого чая) (Polypheno E International, Inc), PPI-2458 (Praecis Pharmaceuticals), PTC299 (PTC Therapeutics), PTK787 (Ваталаниб) (Novartis), PXD101 (Белиностат) (CuraGen Corporation), RAD001 (Эверолимус) (Novartis), RAF265 (Novartis), Регорафениб (BAY73-4506) (Bayer), Ревлимид (Celgene), Retaane (Alcon Research), SN38 (липосомальный) (Neopharm), SNS-032 (BMS-387032) (Sunesis), SOM230 (Пасиреотид) (Novartis), Скваламин (Genaera), Сурамин, Сутент (Pfizer), Тарцеву (Genentech), TB-403 (Thrombogenics), Темпостатин (Collard Biopharmaceuticals), Тетратиомолибрат (Sigma-Aldrich), TG100801 (TargeGen), Талидомид (Celgene Corporation), Тинзапарин натрий, TKI258 (Novartis), TRC093 (Tracon Pharmaceuticals Inc.), VEGF Trap (Aflibercept) (Regeneron Pharmaceuticals), VEGF Trap-Eye (Regeneron Pharmaceuticals), Веглин (VasGene Therapeutics), Бортезомиб (Millennium), XL184 (Exelixis), XL647 (Exelixis), XL784 (Exelixis), XL820 (Exelixis), XL999 (Exelixis), ZD6474 (AstraZeneca), Вориностат (Merck) и ZSTK474.

Приводимые в качестве примера ингибиторы рецепторов фактора роста эндотелия сосудов (VEGF) включают, но без ограничения, Бевацизумаб (Avastin®), акситиниб (Inlyta®); Бриваниб аланинат (BMS-582664, (S)-((R)-1-(4-(4-фтор-2-метил-1Н-индол-5-илокси)-5-метилпирроло[2,1-f][1,2,4]триазин-6-илокси)пропан-2-ил)2-аминопропаноат); Сорафениб (Nexavar®); Пазопаниб (Votrient®); Сунитиниб малат (Sutent®); Цедираниб (AZD2171, CAS 288383-20- 1); Варгатеф (BIBF1120, CAS 928326-83-4); Форетиниб (GSK1363089); Телатиниб (BAY57-9352, CAS 332012-40-5); Апатиниб (YN968D1, CAS 811803-05-1); Иматиниб (Gleevec®); Понатиниб (AP24534, CAS 943319-70-8); Тивозаниб (AV951, CAS 475108-18-0); Регорафениб (BAY73-4506, CAS 755037-03-7); Ваталаниба дигидрохлорид (РТК787, CAS 212141-51-0); Бриваниб (БМС-540215, CAS 649735-46-6); Вандетаниб (Caprelsa® или AZD6474); Мотесаниба дифосфат (AMG706, CAS 857876-30-3, N-(2,3-дигидро-3,3-диметил-1H-индол-6-ил)-2-[(4-пиридинилметил)амино]-3-пиридинкарбоксамид, описанный в публикации РСТ-заявки № WO 02/066470); Довитиниба ангидрид молочной кислоты (TKI258, CAS 852433-84-2); Линфаниб (ABT869, CAS 796967-16-3); Кабозантиниб (XL184, CAS 849217-68-1); Лестауртиниб (CAS 111358-88-4); N-[5-[[[5-(1,1-диметилэтил)-2-оксазолил]метил]тио]-2-тиазолил]-4-пиперидинкарбоксамид (BMS38703, CAS 345627-80-7); (3R,4R)-4-амино-1-((4-((3-метоксифенил)амино)пирроло[2,1-f][1,2,4]триазин-5-ил)метил)пиперидин-3-ол (BMS690514); N-(3,4-дихлор-2-фторфенил)-6-метокси-7-[[(3aα,5β,6aα)-октагидро-2-метилциклопента[с]пиррол-5-ил]метокси]-4-хиназолинамин (XL647, CAS 781613-23-8); 4-метил-3-[[1-метил-6-(3-пиридинил)-1Н-пиразоло[3,4-d]пиримидин-4-ил]амино]-N-[3-(трифторметил)фенил]бензамид (BHG712, CAS 940310-85-0) и Афлиберцепт (Eylea®).

Приводимые в качестве примера ингибиторы пути с участием EGF включают, без ограничения, тирфостин 46, EKB-569, эрлотиниб (Tarceva®), гефитиниб (IRESSA®), эрбитукс, нимотузумаб, лапатиниб (Tykerb®), цетуксимаб (моноклональное антитело против EGFR), 188Re-меченный нимотузумаб (моноклональное антитело против EGFR) и такие соединения, которые в общем и конкретно раскрыты в WO 97/02266, ЕР 0564409, WO 99/03854, ЕР 0520722, ЕР 0566226, ЕР 0787722, ЕР 0837063, патенте США № 5747498, WO 98/10767, WO 97/30034, WO 97/49688, WO 97/38983 и WO 96/33980. Приводимые в качестве примера антитела против EGFR включают, но без ограничения, Цетуксимаб (Erbitux®); Панитумумаб (Vectibix®); Матузумаб (EMD-72000); Трастузумаб (Herceptin®); Нимотузумаб (hR3); Залутумумаб; TheraCIM h-R3; MDX0447 (CAS 339151-96-1); и ch806 (мАт-806, CAS 946414-09-1). Приводимые в качестве примера ингибиторы рецепторов эпидермального фактора роста (EGFR) включают, но без ограничения, Эрлотиниба гидрохлорид (Tarceva®), Гефитниб (IRESSA®); N-[4-[(3-хлор-4-фторфенил)амино]-7-[[(3"S")-тетрагидро-3-фуранил]окси]-6-хиназолинил]-4(диметиламино)-2-бутенамид, Tovok®); Вандетаниб (Caprelsa®); Лапатиниб (Tykerb®); (3R,4R)-4-амино-1-((4-((3-метоксифенил)амино)пирроло[2,1-f][1,2,4]триазин-5-ил)метил)пиперидин-3-ол (BMS690514); Канертиниба дигидрохлорид (CI-1033); 6-[4-[(4-этил-1-пиперазинил)метил]фенил]-N-[(1R)-1-фенилэтил]-7H-пирроло[2,3-d]пиримидин-4-амин (AEE788, CAS 497839-62-0); Мубритиниб (TAK165); Пелитиниб (EKB569); Афатиниб (BIBW2992); Нератиниб (HKI-272); N-[4-[[1-[(3-фторфенил)метил]-1H-индазол-5-ил]амино]-5-метилпирроло[2,1-f][1,2,4]триазин-6-ил]карбаминовой кислоты, (3S)-3-морфолинилметиловый эфир (BMS599626); N-(3,4-дихлор-2-фторфенил)-6-метокси-7-[[(3аα,5β,6аα)-октагидро-2-метилциклопента[с]пиррол-5-ил]метокси]-4-хиназолинамин (XL647, CAS 781613-23-8); и 4-[4-[[(1R)-1-фенилэтил]амино]-7Н-пирроло[2,3-d]пиримидин-6-ил]фенол (PKI166, CAS 187724-61-4).

Приводимые в качестве примера ингибиторы mTOR включают, без ограничения, рапамицин (Rapamune®) и их аналоги и производные; SDZ-RAD; Темсиролимус (Torisel®; также известен как CCI-779); Ридафоролимус (официально известный как деферолимус, (1R,2R,4S)-4-[(2R)-2[(1R,9S,12S,15R,16E,18R,19R,21R,23S,24E,26E,28Z,30S,32S,35R)-1,18-дигидрокси-19,30-диметокси-15,17,21,23,29,35-гексаметил-2,3,10,14,20-пентаоксо-11,36-диокса-4-азатрицикло[30.3.1.04,9]гексатриаконта-16,24,26,28-тетраен-12-ил]пропил]-2-метоксициклогексилдиметилфосфинат, также известный как АР23573 и MK8669, и описанный в публикации РСТ-заявки № WO 03/064383); Эверолимус (Afinitor® или RAD001); Рапамицин (AY22989, Sirolimus®); Симапимод (CAS 164301-51-3); (5-{2,4-бис[(3S)-3-метилморфолин-4-ил]пиридо[2,3-d]пиримидин-7-ил}-2-метоксифенил)метанол (AZD8055); 2-Амино-8-[транс-4-(2-гидроксиэтокси)циклогексил]-6-(6-метокси-3-пиридинил)-4-метил-пиридо[2,3-d]пиримидин-7(8Н)-он (PF04691502, CAS 1013101-36-4) и N2-[1,4-диоксо-4-[[4-(4-оксо-8-фенил-4H-1-бензопиран-2-ил)морфолини-4-ил]метокси]бутил]-L-аргинилглицил-L-α-аспартил-L-серин, внутренняя соль (SF1126, CAS 936487-67-1).

Приводимые в качестве примера ингибиторы фосфоинозитид-3-киназы (PI3K) включают, но без ограничения, 4-[2-(1Н-индазол-4-ил)-6-[[4-(метилсульфонил)пиперазин-1-ил]метил]тиено[3,2-d]пиримидин-4-ил]морфолин (также известный как GDC 0941 и описанный в публикации РСТ-заявки № WO 09/036082 и WO 09/055730); 2-метил-2-[4-[3-метил-2-оксо-8-(хинолин-3-ил)-2,3-дигидроимидазо[4,5-с]хинолин-1-ил]фенил]пропионитрил (также известный как BEZ 235 или NVP-BEZ 235 и описанный в публикации РСТ-заявки № WO 06/122806); 4-(трифторметил)-5-(2,6-диморфолинопиридин-4-ил)пиридин-2-амин (также известный как BKM120 или NVP-BKM120 и описанный в публикации РСТ-заявки № WO2007/084786); Тозасертиб (VX680 или МК-0457, CAS 639089-54-6); (5Z)-5-[[4-(4-пиридинил)-6-хинолинил]метилен]-2,4-тиазолидиндион (GSK1059615, CAS 958852-01-2); (1Е,4S,4aR,5R,6aS,9aR)-5-(Ацетилокси)-1-[(ди-2-пропениламино)метилен]-4,4a,5,6,6a,8,9,9a-октагидро-11-гидрокси-4-(метоксиметил)-4a,6а-диметил-циклопента[5,6]нафто[1,2-с]пиран-2,7,10(1Н)-трион (PX866, CAS 502632-66-8); и 8-фенил-2-(морфолин-4-ил)хромен-4-он (LY294002, CAS 154447-36-6). Приводимые в качестве примера ингибиторы протеинкиназы В (РКВ) или AKT включают, но без ограничения, 8-[4-(1-аминоциклобутил)фенил]-9-фенил-1,2,4-триазоло[3,4-f][1,6]нафтиридин-3(2Н)-он (МК-2206, CAS 1032349-93-1); Перифосин (KRX0401); 4-додецил-N-1,3,4-тиадиазол-2-ил-бензолсульфонамид (РНТ-427, CAS 1191951-57-1); 4-[2-(4-амино-1,2,5-оксадиазол-3-ил)-1-этил-7-[(3S)-3-пиперидинилметокси]-1Н-имидазо[4,5-с]пиридин-4-ил]-2-метил-3-бутин-2-ол (GSK690693, CAS 937174-76-0); 8-(1-гидроксиэтил)-2-метокси-3-[(4-метоксифенил)метокси]-6H-дибензо[b,d]пиран-6-он (паломид 529, P529 или SG-00529); Трицирбин (6-амино-4-метил-8-(β-D-рибофуранозил)-4H,8H-пирроло[4,3,2-де]пиримидо[4,5-с]пиридазин); (αS)-α-[[[5-(3-метил-1H-индазол-5-ил)-3-пиридинил]окси]метил]-бензолэтанамин (A674563, CAS 552325-73-2); 4-[(4-хлорфенил)метил]-1-(7Н-пирроло[2,3-d]пиримидин-4-ил)-4-пиперидинамин (CCT128930, CAS 885499-61-6); 4-(4-хлорфенил)-4-[4-(1H-пиразол-4-ил)фенил]пиперидин (AT7867, CAS 857531-00-1); и Арчексин (RX-0201, CAS 663232-27-7).

Лекарственные средства, которые или блокируют кальций-зависимую фосфатазу кальциневрин (циклоспорин и FK-506), или ингибируют киназу p70S6, которая важна для индуцируемой фактором роста передачи сигнала, (рапамицин) (Liu et al., Cell 66: 807-815, 1991; Henderson et al., Immun. 73: 316-321, 1991; Bierer et al., Curr. Opin. Immun. 5: 763-773, 1993), могут также использоваться. В дальнейшем аспекте клеточные композиции по настоящему изобретению могут вводиться пациенту в сочетании с (например, до, одновременно или после) трансплантацией костного мозга, Т-клеточной аблативной терапией, используя химиотерапевтические средства, такие как флударабин, наружная дистанционная лучевая терапия (XRT), циклофосфамид и/или антитела, такие как ОКТ3 или САМРАТН. В одном аспекте клеточные композиции по настоящему изобретению вводят после В-клеточной аблативной терапии, такой как агенты, которые вступают в реакцию с CD20, например, Ритуксан. Например, в одном варианте осуществления субъекты могут пройти стандартное лечение высокой дозой химиотерапии с последующей трансплантацией стволовых клеток периферической крови. В некоторых вариантах осуществления, после трансплантации, субъектам осуществляют инфузию размноженных иммунных клеток по настоящему изобретению. В дополнительном варианте осуществления размноженные клетки вводят до или после хирургического вмешательства.

В одном варианте осуществления субъекту может вводиться агент, который уменьшает или облегчает побочный эффект, связанный с введением CAR-экспрессирующей клетки. Побочные эффекты, связанные с введением CAR-экспрессирующей клетки, включают, но без ограничения, CRS и гемофагоцитарный лимфогистиоцитоз (HLH), также называемый синдромом активации макрофагов (MAS). Симптомы CRS включают высокую температуру, тошноту, преходящую гипотензию, гипоксию и т.п. Соответственно, способы, описанные здесь, могут включать введение CAR-экспрессирующей клетки, описанной здесь, субъекту и последующее введение агента для борьбы с повышенными уровнями растворимого фактора в результате лечения CAR-экспрессирующей клеткой. В одном варианте осуществления повышенным у субъекта растворимым фактором является один или более из IFN-γ, TNFα, IL-2 и IL-6. Таким образом, агентом, вводимым с целью лечения этого побочного эффекта, может быть агент, который нейтрализует один или более из этих растворимых факторов. Такие агенты включают, но без ограничения, стероид, ингибитор TNFα и ингибитор IL-6. Примером ингибитора TNFα является энтанерцепт. Примером ингибитора IL-6 является Тоцилизумаб (toc).

В одном варианте осуществления субъекту может вводиться агент, который увеличивает активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агентом может быть агент, который ингибирует ингибиторную молекулу. Ингибиторные молекулы, например, запрограммированной смерти 1 (PD1), могут, в некоторых вариантах осуществления, уменьшать способность CAR-экспрессирующей клетки к вызову иммунной эффекторной реакции. Примеры ингибиторных молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2В4 и TGFR бета. Ингибирование ингибиторной молекулы, например, путем ингибирования на уровне ДНК, РНК или белка, может оптимизировать функционирование CAR-экспрессирующей клетки. В вариантах осуществления ингибиторная нуклеиновая кислота, например, ингибиторная нуклеиновая кислота, например, дсРНК, например, короткая интерферирующая РНК или шпилечная РНК, могут использоваться для ингибирования экспрессии ингибиторной молекулы в CAR-экспрессирующей клетке. В одном варианте осуществления ингибитором является шпилечная РНК. В одном варианте осуществления ингибиторная молекула ингибируется в CAR-экспрессирующей клетке. В этих вариантах осуществления молекула дцРНК, которая ингибирует экспрессию ингибиторной молекулы, связана с нуклеиновой кислотой, кодирующей компонент, например, все компоненты, CAR. В одном варианте осуществления ингибитором ингибиторного сигнала может быть, например, антитело или фрагмент антитела, которое(ый) связывается с ингибиторной молекулой. Например, агент может представлять собой антитело или фрагмент антитела, которое(ый) связывается с PD1, PD-L1, PD-L2 или CTLA4 (например, ипилимумаб (также упоминаемый как MDX-010 и MDX-101 и продаваемый как Yervoy®; Bristol-Myers Squibb; Тремелимумаб (моноклональное антитело изотипа IgG2, доступное от Pfizer, ранее известное как тицилимумаб, СР 675206)).

PD1 является ингибиторным член семейства рецепторов CD28, которое также включает CD28, CTLA-4, ICOS и BTLA. PD-1 представлен на активированных В-клетках, Т-клетках и миелоидных клетках (Agata et al., 1996, Int. Immunol 8: 765-75). Было установлено, что два лиганда для PD1, PD-L1 и PD-L2, подавляют активацию Т-клеток после связывания с PD1 (Freeman et al., 2000, J Exp Med 192: 1027-34; Latchman et al., 2001, Nat Immunol 2: 261-8; Carter et al., 2002 Eur J Immunol 32: 634-43). PD-Ll присутствует в большом количестве в раках человека (Dong et al., 2003, J Mol Med 81: 281-7; Blank et al. 2005 Cancer Immunol. Immunother 54: 307-314; Konishi et al. 2004 Clin Cancer Res 10: 5094). Иммуносупрессия может быть отменена путем ингибирования локального взаимодействия PD1 с PD-L1. Антитела, фрагменты антител и другие ингибиторы PD1, PD-L1 и PD-L2 доступны в данной области техники и могут использоваться в комбинации с CD123-CAR, описанным здесь. Например, ниволумаб (также упоминаемый как BMS-936558 или MDX1106; Bristol-Myers Squibb) представляет собой полностью человеческое моноклональное антитело изотипа IgG4, которое специфически блокирует PD-1. Ниволумаб (клон 5C4) и другие человеческие моноклональные антитела, которые специфически связываются с PD-1, раскрыты в патенте США 8008449 и WO2006/121168. Пидилизумаб (CT-011; Cure Tech) представляет собой гуманизированное моноклональное антитело изотипа IgG1k, которое связывается с PD-1. Пидилизумаб и другие гуманизированные моноклональные антитела против PD1 описаны в WO2009/101611. Ламбролизумаб (также упоминаемый как MK03475; Merck) представляет собой гуманизированное моноклональное антитело изотипа IgG4, которое связывается с PD1. Ламбролизумаб и другие гуманизированные антитела против PD1 описаны в патенте США № 8354509 и WO2009/114335. MDPL3280A (Genentech/Roche) представляет собой моноклональное антитело класса IgG1 с оптимизированным Fc человека, которое связывается с PD-L1. MDPL3280A и другие человеческие моноклональные антитела против PD-L1 описаны в патенте США № 7943743 и публикации заявки на патент США № 20120039906. Другие связывающиеся с PD-L1 агенты включают YW243.55.S70 (вариабельные области тяжелой и легкой цепей приведены в SEQ ID NO: 20 и 21 в WO2010/077634) и MDX-1 105 (также упоминаемый как BMS-936559, и, например, связывающиеся с PD-L1 агенты, раскрытые в WO2007/005874). AMP-224 (В7-DCIg; Amplimmune; например, описанный в WO2010/027827 и WO2011/066342) представляет собой растворимый рецептор в виде слияния с Fc против PD-L1, который блокирует взаимодействие между PD1 и B7-H1. Другие антитела против PD1 включают AMP 514 (Amplimmune), среди прочего, например, антитела против PD1, описанные в патенте США № 8609089, заявках на патенты США 2010028330 и/или 20120114649. Агентом, который увеличивает активность CAR-экспрессирующей клетки, может быть, например, слитый белок, включающий первый домен и второй домен, причем первый домен представляет собой ингибиторную молекулу или ее фрагмент, а второй домен представляет собой полипептид, который ассоциируется с положительным сигналом, например, полипептидом который ассоциируется с положительный сигналом, является CD28, ICOS и их фрагменты, например, внутриклеточный домен сигнализации CD28 и/или ICOS. В одном варианте осуществления слитый белок экспрессируют в той же клетке, которая экспрессировала CAR. В другом варианте осуществления слитый белок экспрессируют в клетке, например, Т-клетке, которая не экспрессирует CAR на основе антитела против EGFRvIII.

В одном варианте осуществления агентом, который увеличивает активность CAR-экспрессирующей клетки, описанной здесь, является miR-17-92.

Фармацевтические композиции и способы лечения

Фармацевтические композиции по настоящему изобретению могут включать CAR-экспрессирующую клетку, например, множество CAR-экспрессирующих клеток, описанных здесь, в сочетании с одним или более фармацевтически или физиологически приемлемыми носителями, разбавителями или наполнителями. Такие композиции могут включать буферы, такие как нейтральный забуференный физиологический раствор, забуференный фосфатом физиологический раствор и т.п.; углеводы, такие как глюкоза, манноза, сахароза или декстраны, маннит; белки; полипептиды или аминокислоты, такие как глицин; антиоксиданты; хелатирующие агенты, такие как EDTA или глутатион; адъюванты (например, гидроксид алюминия); и консерванты. В одном аспекте композиции по настоящему изобретению приготовлены для внутривенного введения.

Фармацевтические композиции по настоящему изобретению могут вводиться способом, подходящим для подвергаемого лечению (или предотвращению) заболевания. Количество и частота введения будет зависеть от таких факторов, как состояние пациента, а также типа и тяжести заболевания пациента, хотя соответствующие дозировки могут быть определены с помощью клинических испытаний.

В одном варианте осуществления фармацевтическая композиция по существу не содержит примесь, например, отсутствуют детектируемые уровни примеси, например, выбираемой из группы, состоящей из эндотоксина, микоплазмы, компетентного по репликации лентивируса (RCL), р24, нуклеиновой кислоты VSV-G, gag ВИЧ, остаточных покрытых антителом против CD3/CD28 сфер, мышиных антител, объединенной сыворотки крови человека, бычьего сывороточного альбумина, бычьей сыворотки, компонентов культуральных сред, клеточных или плазмидных компонентов для упаковки вектора, бактерии и грибка. В одном варианте осуществления бактерией является по крайней мере одна, выбираемая из группы, состоящей из Alcaligenes faecalis, Candida albicans, Escherichia coli, Haemophilus influenza, Neisseria meningitides, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pneumonia и группы А Streptococcus pyogenes.

Когда показано «иммунологически эффективное количество», «противоопухолевое эффективное количество», «опухоль-ингибирующее эффективное количество» или «терапевтическое количество», точное количество композиций по настоящему изобретению для введения может быть определено врачом с учетом индивидуальных различий в возрасте, весе, размере опухоли, степени инфицирования или метастазирования, и состояния пациента (субъекта). Как правило, можно утверждать, что фармацевтическая композиция, включающая Т-клетки, описанные здесь, может вводиться в дозе, составляющей от 104 до 109 клеток/кг веса тела, а в некоторых случаях от 105 до 106 клеток/кг веса тела, в том числе все целые значения в пределах этих диапазонов. Включающие Т-клетки композиции могут также вводиться множество раз в этих дозах. Клетки могут вводиться с помощью методов инфузии, которые общеизвестны в иммунотерапии (смотрите, например, Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988).

В некоторых аспектах может быть желательным введение субъекту активированных Т-клеток и затем впоследствии повторный забор крови (или выполнение афереза), активирование Т-клеток из него в соответствии с настоящим изобретением и подвергание пациента реинфузии этих активированных и размноженных Т-клеток. Этот процесс может осуществляться несколько раз каждые несколько недель. В некоторых аспектах Т-клетки могут быть активированы из заборов крови от 10 см3 до 400 см3. В некоторых аспектах Т-клетки активируются от заборов крови, составляющих 20 см3, 30 см3, 40 см3, 50 см3, 60 см3, 70 см3, 80 см3, 90 см3 или 100 см3.

Введение рассматриваемых композиций может осуществляться любым удобным способом, в том числе путем аэрозольной ингаляции, инъекции, приема внутрь, переливания, имплантации или трансплантации. Композиции, описанные здесь, могут вводиться пациенту трансартериально подкожно, внутрикожно, внутрь опухоли, внутрь узлов, интрамедуллярно, внутримышечно, с помощью внутривенной (IV) инъекции или внутрибрюшинно. В одном аспекте включающую Т-клетки композицию по настоящему изобретению вводят пациенту с помощью внутрикожной или подкожной инъекции. В одном аспекте включающую Т-клетки композицию по настоящему изобретению вводят с помощью внутривенной инъекции. Композиции Т-клеток могут вводиться непосредственно в опухоль, лимфатический узел или места инфекции.

В конкретном приводимом в качестве примера аспекте субъекты могут подвергаться лейкаферезу, в случае которого лейкоциты собирают, обогащают или истощают ex vivo с целью отбора и/или изоляции представляющей интерес клетки, например, Т-клетки. Эти изоляты Т-клеток можно размножить с помощью методов, известных в данной области техники, и обработать из условия, чтобы могли быть введены одна или более конструкций CAR по настоящему изобретению, тем самым создавая CAR-Т-клетку по настоящему изобретению. Субъекты, нуждающиеся в этом, могут затем пройти стандартное лечение высокой дозой химиотерапии с последующей трансплантацией стволовых клеток периферической крови. В некоторых аспектах после или одновременно с трансплантацией, субъектов подвергают инфузии размноженных CAR-Т-клеток по настоящему изобретению. В дополнительном аспекте размноженные клетки вводят до или после хирургического вмешательства.

Доза указанных выше лечений, назначаемых пациенту, будет варьировать в зависимости от точной природы состояния, подлежащего лечению, и реципиента лечения. Увеличение или уменьшение дозы для введения человеку может выполняться в соответствии с принятой в данной области техники практикой.

ПРИМЕРЫ

Настоящее изобретение далее подробно описано со ссылкой на следующие экспериментальные примеры. Эти примеры представлены лишь с целью иллюстрации и, как предполагается, не являются ограничением, если не предусмотрено иное. Таким образом, настоящее изобретение не следует никоим образом рассматривать как ограниченное следующими примерами, а точнее оно, как должно подразумеваться, охватывает всякие и все вариации, которые станут очевидны в результате представленных здесь идей.

Без дальнейшего описания, полагают, что специалист со средним уровнем компетентности в данной области техники может, используя предшествующее описание и следующие иллюстративные примеры, приготовить и использовать соединения по настоящему изобретению и осуществить на практике заявленные способы. Следующие рабочие примеры конкретно показывают различные аспекты настоящего изобретения и не должны рассматриваться как ограничение никоим образом остальной части описания.

Пример 1: Перенаправленные аутологичные Т-клетки, созданные для экспрессии направленного на EGFRvIII химерного антигенспецифического рецептора у пациентов с диагнозом EGFRvIII+ глиобластома

Следующие эксперименты были разработаны для разрешения вопроса, будут ли Т-клетки человека, перенаправленные на поверхностный белок EGFRvIII с помощью основанного на антителе химерного антигенспецифического рецептора (CAR), эффективными в уничтожении EGFRvIII+ модели глиобластомы у мышей NSG. Кроме того, были разработаны эксперименты для оценки приживления и сохранения этих клеток. Были проверены три различных формы CAR, включающие два различных одноцепочечных вариабельных фрагмента (часть CAR, связывающуюся с антигеном EGFRvIII) и внутриклеточные домены сигнализации (4-1BB и CD3 дзета с и без CD28).

Мышь NOD/scid/γcnulll (NSG) с иммунодефицитом является отличной моделью для ксенотрансплантации - приживления линий опухолевых клеток человека (линия опухоли головного мозга U87, которая является EGFR+ и имеет варианты, созданные, чтобы быть EGFRvIII+) и Т-клеток человека. После приживления Т-клетки человека могут сохраняться у мышей NSG в течение приблизительно 2 месяцев, или до развития смертельной ксеногенной GVHD (гомологичной болезни) (xGVHD), что зависит от дозы и донора вводимых с помощью инфузии Т-клеток человека.

Вкратце, был создан новый CAR (CAR на основе 3C10) на основе лентивируса, включающий scFv, происходящий из моноклонального антитела против EGFRvIII - 3C10. Этот CAR был протестирован in vitro и в ксеногенных моделях на мышах. Модели на мышах NOD/scid/γc(-/-) (NSG) широко использовались для доклинических оценок терапии с использованием CAR, в том числе оценки длительного сохранения введенных с помощью инфузии Т-клеток человека. Мыши NSG, несущие опухоли U87-EGFRvIII дня 7 в головном мозге, получали внутрибрюшинные инъекции темозоломида (1 мг/дозу) ежедневно в дни 7-11 и внутривенные инфузии: 2×106 Т-клеток человека, трансдуцированных ex vivo вектором, кодирующим CAR на основе NSG, или контрольным вектором, кодирующим улучшенный зеленый флуоресцентный белок (EGFP), в дни 7 и 17. В день 21 BLI-сигналы были не детектируемыми у всех мышей, получивших CAR-трансдуцированные Т-клетки, в то время как мыши, подвергнутые лечению трансдуцированными контролем Т-клетками, демонстрируют возобновление роста опухоли у 4 из 5 мышей после транзиторного противоопухолевого эффекта, вызванного темозоломидом. В отдельном эксперименте мышей, подвергнутых лечению CAR-Т-клетками, умерщвляли в день 21, и инфильтрацию CAR-трансдуцированными Т-клетками оценивали с помощью иммуногистохимии, используя конъюгированное с биотином мАт против F(аb')2 (специфичное в отношении 3C10CAR) и стрептавидин-фикоэритрин (РЕ). Введенные с помощью внутривенной инфузии CAR-Т-клетки, как представлялось на основе интенсивных PE-сигналов, сильно инфильтрировали опухоль, в то время как контрольная ткань, окрашенная стрептавидином-PE, но без мАт против F(аb')2, продемонстрировала лишь фоновые сигналы.

Теперь представляются материалы и методы, используемые в этих экспериментах.

Материалы и методы

Модель на мышах NSG

Недавно была создана колония мышей NOD/scid/γcnulll (NSG) с иммунодефицитом. У мышей NSG отсутствуют Т- и В-клетки, клетки-природные киллеры, а также ослаблена функция дендритных клеток. Было подтверждено, что приживление активированных Т-клеток было лучше у мышей NSG, чем в предыдущей модели на мышах NOD/scid/β2Mnull. По этой причине модель NSG использовали в экспериментах по ксенотрансплантации материала человека.

Структура и характеристики биологической системы

Хотя многие из моноклональных и поликлональных Ат, направленных против EGFRvIII, обладают перекрестной реактивностью с EGFR дикого типа или другими неспецифическими белками, моноклональное антитело (мАт) 3C10, которое было первоначально создано путем иммунизации мышей 14-аминокислотным пептидом, включающим EGFRvIII-специфический стык, продемонстрировало очень специфическое распознавание EGFRvIII с незначительным выявляемым связыванием EGFR дикого типа (Okamoto et al., 1996, Br J Cancer 73: 1366-1372). Лентивирусный вектор высокой степени чистоты использовали для трансдукции Т-клеток.

Приготовление клеток для инфузии мышам

Клетками для инфузии мышам являются Т-клетки человека. Обогащенные мононуклеарными клетками человека аферезные продукты получают лейкаферезом, проводимым здоровым донорам-добровольцам в University of Pennsylvania Human Immunology Core. Все образцы получают в соответствии с протоколом, утвержденным Экспертным советом университета, и информированное письменное согласие получают от каждого донора. Т-клетки подвергают негативному отбору, используя смесь с обогащением Т-клетками человека RosetteSep (Stemcell Technologies, Vancouver, Канада). Т-клетки передаются в лабораторию TRP, где их активируют с использованием CD3/28 сфер высокой степени чистоты и размножают в RPMI с глутамином, 10% FBS, 20 мМ Hepes, 100 Е/мл пенициллина и 100 мкг/мл стрептомицина. Трансдукция вектора происходит через 24 часа, при этом упакованные лентивирусные векторы добавляют непосредственно к активированным культурам. От клеток отделяют сферы в день 5, и рост контролируется с помощью Coulter Multisizer 3 (Beckman Coulter, Fullerton, CA) в отношении изменений размера (фл) и общего числа клеток, сохраняя концентрацию от 0,7E6 (0,7×106) до 2E6 клеток/мл. Эффективность трансдукции для CAR-трансдуцированных Т-клеток проверяют с помощью проточной цитометрии путем окрашивания или козьим антимышиным антителом (GAM, для CAR на основе 3C10), или козьим античеловеческим антителом (GAH, для CAR на основе 139). Мышам осуществляют инфузию 1 млн CAR+ Т-клеток на мышь с помощью введения в хвостовую вену в день 0 исследования.

Лечение темозоломидом (TMZ)

Мыши, несущие внутрикожно опухоль U87-EGFRvIII и получающие CAR+ Т-клетки в день 0, впоследствии получают внутрибрюшинные инъекции (i.p.) TMZ на дни 0-4 (ежедневно в течение 5 дней): TMZ растворяют в DMEM в концентрации = 6,67 мг/мл. Каждая мышь получает 50 мкл раствора TMZ (333 мкг/дозу; приблизительно 17 мг/кг/доза) с помощью внутрибрюшинных инъекций.

CAR-T-клетки для клинического применения

EGFRvIII-CAR-Т-клетки получают в лаборатории по продукции клеток и вакцин для клинический исследований (CVPF), и клеточный продукт представляет собой аутологичные Т-лимфоциты. Обогащение CD3+ Т-клетками продукта лейкафереза осуществляют с помощью истощения моноцитов путем проточного элютриационного центрифугирования. В день 0 процесс продукции начинают с активации обогащенных Т-клеток, используя покрытые мАт против CD3/CD28 магнитные сферы. Культуру Т-клеток подвергают воздействию кодирующего EGFRvIII-специфический CAR лентивирусного вектора и размножению. Процесс продукции Т-клеток инициируется в статической тканевой культуре (в день 0-5) с последующим переносом в биореактор Wave, если это необходимо для дополнительного размножения в соответствии с условиями перфузии. В конце культивирования от клеток отделяют магнитные сферы, клетки промывают, концентрируют и подвергают криоконсервации. Модифицированный Т-клеточный продукт подвергают криоконсервации в криомешках в объеме, зависящем от числа клеток (в конечной концентрации, составляющей максимум 108/мл), используя морозильник с контролируемой скоростью. Замороженные, экспрессирующие EGFRvIII-специфический CAR Т-клеточные продукты хранят в морозильной камере, поставленной на контроль, при ≤-130°С. Результаты экспериментов описаны ниже.

Искоренение внутричерепных EGFRvIII-экспрессирующих глиобластом с помощью CAR-Т-клеток

Глиобластома (GBM) является самой распространенной и самой злокачественной первичной опухолью головного мозга и обуславливает приблизительно 12000 связанных с раком смертельных случаев в США каждый год. Медиана выживаемости пациентов с GBM короче 15 месяцев после лечения комбинацией химиотерапии (темозоломидом) с лучевой терапией (RT). Терапия с использованием адоптивного переноса клеток (АСТ) в виде аутологичных Т-клеток, особенно Т-клеток, трансдуцированных химерными антигенспецифическими рецепторами (CAR), раскрыла перспективы предварительных испытаний на раке системы крови. АСТ с использованием CAR-T-клеток может быть особенно подходящей для пациентов с GBM, поскольку гораздо лучше можно манипулировать и контролировать специфичность(ю), количество(м) и функциональный(ым) фенотип(ом) клеток, полученных ex vivo, чем природных Т-клеток, индуцированных с помощью in vivo иммунизации.

Вариант III рецептора эпидермального фактора роста (EGFRvIII) является самым распространенным вариантом EGFR, который наблюдается в опухолях человека, но редко наблюдается в нормальной ткани. Этот белок является результатом делеции в рамке считывания экзонов 2-7 и образования нового остатка глицина на стыке экзонов 1 и 8 в экстраклеточном домене EGFR, в результате чего создается специфический в отношении опухоли эпитоп. EGFRvIII экспрессируется в 24%-67% GBM, но не в нормальных тканях.

Для разработки эффективной CAR-терапии для GBM были созданы три новые лентивирусные конструкции CAR, направленные на EGFRvIII. Каждый из этих векторов кодирует одноцепочечный вариабельный фрагмент (scFv), происходящий из EGFRvIII-специфических мышиных моноклональных антител (мАт) 3C10 или EGFRvIII-специфических гуманизированных моноклональных антител (мАт), названных «139» (фиг. 6). ScFv 3C10 был связан с шарнирной областью CD8a, 4-1BB- и CD3ζ-доменами с или без трансмембранных и внутриклеточных доменов CD28 (3C10BBz28-CAR и 3C10BBz-CAR, соответственно). ScFv 139 был связан с шарнирной областью CD8a, 4-1BB- и CD3ζ-доменами (139BBz-CAR). Т-клетки человека, трансдуцированные каждым из этих CAR, продемонстрировали специфический и сильный лизис EGFRvIII-экспрессирующих клеток GBM - U87 (U87-EGFRvIII); смотрите фиг. 7. Мыши с ослабленным иммунитетом NOD/scid/γc(-/-) (NSG), имеющие опухоли U87-EGFRvIII дня 7 в головном мозге, получили внутривенные инфузии из 1×106 Т-клеток человека, трансдуцированных ex vivo: 1) 139BBz-CAR; 2) 3C10BBz-CAR; 3) 3C10BBz28-CAR; 4) контрольным CD19BBz-CAR, мишенью которого является CD19 человека. Эти мыши также получали внутрибрюшинные инъекции темозоломида (330 мкг/доза) ежедневно в дни 7-11. Рост опухоли контролировали с помощью биолюминесцентной визуализации (BLI), поскольку клетки U87-EGFRvIII также экспрессируют люциферазу. Все мыши, подвергнутые лечению только физиологическим раствором, умерли в день 21 из-за быстрого роста опухоли, и лечение темозоломидом без ACT приводило к подавлению, но не искоренению опухолей U87-EGFRvIII. Мыши, получающие CD19BBz-CAR-T-клетки и темозоламид, продемонстрировали некоторые аллогенные реакции против U87-EGFRvIII, но опухоли продолжали расти у этих мышей. С другой стороны, у всех мышей, получающих 139BBz-CAR-, 3C10BBZ-CAR- или 3C10BBz28-CAR-трансдуцированные Т-клетки, BLI-сигналы уменьшилась до уровней, меньше исходных, к дню 21, что говорит о полном искоренении опухолей (фиг. 8). Важно отметить, что мыши, получающие 3C10BBz-CAR-T-клетки, устраняли опухоль быстрее, чем или 3C10BBz28- или 139BBz-CAR-T-клетки, что говорит о том, что комбинация 3C10 с BBz может обеспечить лучшую ответную реакцию у пациентов. Рост опухоли и периферические иммунные реакции контролировали для определения, является ли какой-либо из трех векторов, кодирующих EGFRvIII-CAR, лучше других по длительным противоопухолевым эффектам.

Представленные здесь результаты всецело поддерживают разработку клинического испытания фазы I ACT с использованием Т-клетки, экспрессирующей EGFRvIII-специфический CAR, у пациентов с GBM, которые одновременно получают стандарт лечения - химиотерапию с использованием темозоломида.

План клинического испытания

Открытое предварительное исследование с использованием одной группы было разработано для определения безопасности, переносимость и возможности приживления EGFRvIII-CAR-T-клеток у пациентов с вновь диагностированными EGFRvIII+ GBM. Как правило, всем субъектам вводят дозы аутологичных EGFRvIII-CAR-Т-клеток. Приемлемых субъектов подвергают лейкаферезу для получения большого количества мононуклеарных клеток периферической крови (РВМС) для получения EGFRvIII-CART-клеток. Т-клетки очищают от РВМС, трансдуцируют кодирующим CAR на основе гуманизированного 3C10 лентивирусным вектором, размножают in vitro и подвергают криоконсервации в соответствующих аликвотах-дозах. Клетки, подвергаемые инфузии, оттаивают у постели непосредственно перед инфузией в день 0.

Субъектов подвергают анализам крови для оценки безопасности и приживления и сохранения EGFRvIII-CAR-T-клеток регулярно по неделю 4 включительно (день 28). Субпопуляции циркулирующих Т-клеток, которые содержат вектор, кодирующий 3C10-CAR, оценивают в различные моменты времени после инфузии и сравнивают с образцом на исходном уровне. После 28 дня субъекты оцениваются ежемесячно до 6 месяцев с использованием истории болезни, физикального обследования, ЯМР-томографии головного мозга и анализов крови или в соответствии со стандартом лечения.

Анализы крови с целью научных исследований проводятся одновременно с этим посещениями. Спустя шесть месяцев пациентов контролируют каждые 2 месяца в течение двух лет. После момента времени, равного двум годам, субъекты входят в пролонгированное исследование для ежегодного контролирования по телефону и с помощью вопросника в течение еще тринадцати лет для оценки с целью диагностирования длительных проблем со здоровьем, таких, как развитие новых злокачественностей, в соответствии с правилами FDA, относящимися к исследованиям по переносам генов.

Без желания ограничиться какой-либо конкретной теорией, полагают, что из-за очень ограниченной экспрессии белка EGFRvIII не предвидят какой-либо вид эффективной активации Т-клеток вне опухоли. Предпочтительно, когда осуществляют лишь одну инфузию EGFRvIII-CART-клеток, и поэтому также не предвидят развитие реакций аллергического типа. Однако одной токсичностью, с которой можно столкнуться, является воспаление в результате неспецифической активации Т-клеток в месте опухоли. Симптомы и признаки отека головного мозга будут тщательно контролироваться, и с ним будет осуществляться борьба. В некоторых вариантах осуществления воспаление в результате неспецифической активации Т-клеток можно лечить путем введения противовоспалительного агента, такого как стероидный агент.

Пример 2: Котрансдукция miR-17-92 увеличивает противоопухолевую активность Т-клеток, трансдуцированных химерным антигенспецифическим рецептором на основе антитела против EGFRvIII, у мышей с ксенотрансплантатами глиобластомы человека

Экспрессия miR-17-92 придает фенотип 1-го типа и увеличивает выживаемость Т-клеток. Сообщалось, что экспрессия miR-17-92 подавлена в Т-клетках, полученных из пациентов с глиобластомой (GBM). Для увеличения эффективности терапии с использованием адоптивного переноса клеток против GBM, используя Т-клетки, трансдуцированные химерными антигенспецифическими рецепторами, (CAR-T-клетки) был сконструирован новый лентивирусный вектор для miR-17-92 и CAR, состоящего из специфического в отношении варианта III рецептора эпидермального фактора роста (EGFRvIII) одноцепочечного вариабельного фрагмента (scFv), связанного последовательно с модулем сигнализации - CD3ζ цепью Т-клеточного рецептора и костимулирующими мотивами CD137 (4-1BB) и CD28 (pELNS-3C10-CAR). Помимо антигенспецифических и сильных цитотоксических активностей против клеток GBM U87, стабильно экспрессирующих EGFRvIII (U87-EGFRvIII), CAR-T-клетки, котрансдуцированные miR-17-92, продемонстрировали увеличенную стойкость к подавляющим Т-клетки эффектам трансформирующего фактора роста (TGF)-β и темозоломида по сравнению с CAR-Т-клетками без котрансдукции miR-17-92. У мышей, несущих внутричерепные ксенотрансплантаты U87-EGFRvIII, CAR-Т-клетки с или без экспрессией(и) miR-17-92 с трансгена продемонстрировали схожие уровни сильных терапевтических эффектов, не демонстрируя какой-либо неконтролируемый рост CAR-T-клеток. Однако, когда эти мыши были повторно подвергнуты инъекции клеток U87-EGFRvIII в головном мозге, мыши, получающие котрансдуцированные CAR-T-клетки, продемонстрировали улучшенную защиту по сравнению с мышами, подвергнутыми лечению CAR-Т-клетками без котрансдукции miR-17-92. Эти данные подтверждают, что miR-17-92 может быть включена в CAR для увеличения эффективности у пациентов с GBM.

Результаты экспериментов описаны ниже.

Конструирование лентивирусных векторов для EGFRvIII-специфических CAR и miR-17-92

Был создан лентивирусный вектор для CAR, который распознает EGFRvIII через одноцепочечный вариабельный фрагмент (scFv), происходящий из специфического в отношении EGFRvIII моноклонального антитела (мАт) человека 3C10 (pELNS-3C10-CAR) (смотрите фиг. 1А). В этой конструкции промотор EF-1α управляет экспрессией слитого белка CAR, включающего происходящий из 3C10 scFv, трансмембранный домен (ТМ) CD28, а также 4-1ВВ и внутриклеточные домены (ICD) и CD3ζ домены. Также была создана лентивирусная конструкция для miR-17-92, используя самоинактивирующийся вектор (SIN) на основе FG12, (FG12-EF1α-miR-17-92) (смотрите фиг. 1B). В этом векторе промотор EF1α управляет экспрессией miR-17-92, и промотор UbiC человека управляет экспрессией гена улучшенного зеленого флуоресцентного белка (EGFP), гена-маркера для отслеживания трансдуцированных клеток. Сокращения, используемые на схеме: RSV/5'LTR ВИЧ-1: гибрид промотор-R RSV/длинный концевой повтор U5, EF-1α: промотор 1α-субъединицы фактора элонгации человека, VH: вариабельная область тяжелой цепи иммуноглобулина 3С10, VL: вариабельная область легкой цепи иммуноглобулина 3C10, Δ-3'- LTR ВИЧ-1: 3' длинный концевой повтор с самоинактивацией с делецией в районе U3, CMV/5' LTR ВИЧ-1: гибрид промотор-R LTR/длинный концевой повтор U5, UbiC: промотор гена убиквитина С.

In vitro характеристики Т-клеток человека, трансдуцированных CAR и miR-17-92

Полученные от здоровых доноров CD3+ Т-клетки трансдуцировали pELNS-3C10-CAR, и клетки оценивали в отношении уровней экспрессии трансгена с помощью проточной цитометрии для экспрессии 3C10-CAR и miR-17-92 с помощью антитела против (Fab')2 мыши и EGFP, соответственно (фиг. 2А, слева). Используя Ат против F(аb')2 мыши, которое является специфическим для происходящего из 3C10 scFv на Т-клетках человека, почти половина (48,9%) Т-клеток, экспрессирующих происходящий из 3C10 scFv на своей поверхности, была обнаружена.

Для получения Т-клеток человека, экспрессирующих как CAR, так и экспрессируемый с трансгена miR-17-92, CD3+ Т-клетки котрансдуцировали pELNS-3C10-CAR и FG12-EF1α-miR-17-92 путем последовательного инфицирования двумя лентивирусными векторами. Через 24 часа после первоначальной трансдукции pELNS-3C10-CAR, Т-клетки трансдуцировали FG12-EF1α-miR-17-92. Было отмечено, что приблизительно четверть (23,6%) от общего количества Т-клеток экспрессировала как CAR, так и EGFP (фиг. 2А, справа). Для последующих in vitro исследований, CAR-трансдуцированные Т-клетки (CAR-Т-клетки) были обогащены, используя биотинилированное Ат против F(аb')2 и анти-биотин MACS. Основываясь на эффективности котрансфекции (фиг. 2А, справа), по крайней мере 50% CAR-Т-клеток также экспрессировали EGFR (следовательно, экспрессируемый с трансгена miR-17-92). В соответствии с ПЦР в режиме реального времени, в подвергнутых обогащению с использованием Ат против F(аb')2, miR-17-92-котрансдуцированых CAR-Т-клетках отмечалась экспрессия miR-17-92, превышающая в 3-4 раза таковую в Т-клетках, трансдуцированных только CAR (фиг. 2b). На фиг. 2В представлены уровни экспрессии членов кластера miR-17-92, miR-17-3р, miR-17-5p и miR-92a-1, в трансдуцированных Т-клетках, измеренные с помощью количественной ПЦР в режиме реального времени. Представлены средние значения + среднеквадратическое отклонение 3 повторных измерений одного из трех экспериментов со схожими результатами. * означает р<0,05 между двумя группами, используя коэффициент Стьюдента. На фиг. 2C представлены EGFRvIII-специфические цитотоксические активности трансдуцированных Т-клеток, оцененные с помощью 12-часового анализа высвобождения 51Cr при различных соотношениях E:T, в отношении 51Cr-меченных U87-EGFRvIII или контрольных U87 клеток. Контрольные клетки были контроль(EGFP)-трансдуцированными Т-клетками. Значения означают среднее значение + среднеквадратическое отклонение в лунках в виде трех повторов.

В то время как контроль-трансдуцированные Т-клетки продемонстрировали лишь фоновые уровни лизиса обеих линий родительских клеток U87 (EGFRvIII-негативных) и U87-EGFRvIII, Т-клетки, трансдуцированные CAR, продемонстрировали сильный и специфический лизис EGFRvIII-экспрессирующих клеток GBM человека - U87 (U87-EGFRvIII) с лишь фоновыми уровнями цитотоксических эффектов против родительских клеток U87 (фиг. 2С). В этих 12-часовых анализах высвобождения 51Cr, котрансдукция CAR-Т-клеток, используя miR-17-92, не повышала значительно их специфическую цитотоксическую активность в отношении клеток-мишеней U87-EGFRvIII.

Котрансдукция miR-17-92 дает увеличенное высвобождение IFN-γ и придает стойкость к подавляющим эффектам, вызываемым TGF-β и темозоломидом (TMZ - стандартом лечения)

В предыдущем исследовании (Sasaki et al, 2010, J. Transl Med 8: 17) CD4+ Т-клетки, полученные от трансгенных по miR-17-92 мышей, продемонстрировали увеличенную продукцию IFN-γ по сравнению с аналогами, полученными от мышей дикого типа; и трансфекция Т-клеток человека Jurkat, используя miR-17-92, приводит к повышенной стойкости к индуцируемой активацией гибели клеток (AICD).

Были проведены эксперименты для оценки, обеспечивает ли котрансдукция CAR-Т-клеток, используя miR-17-92, увеличенную продукцию IFN-γ, пролиферацию клеток и меньшую степень апоптоза, когда они подвергаются воздействию химиотерапевтического агента TMZ или иммуносупрессивного цитокина TGF-β.

Когда CAR-T-клетки стимулировали, используя EGFRvIII-трансдуцированные искусственные антигенпрезентирующие клетки (aAPC) без TGF-β или TMZ, клетки экспрессировали схожие уровни IFN-γ с или без котрансдукции(ей). Однако, когда клетки подвергали воздействию увеличивающихся доз TGF-β или TMZ, CAR-Т-клетки без котрансдукции miR-17-92 продуцировали IFN-γ на значительно пониженных уровнях, в то время как в котрансдуцированных CAR-Т-клетках сохранялась продукция IFN-γ на высоком уровне (фиг. 3а). Неокрашенные столбики и окрашенные столбики представляют результаты от CAR-Т-клеток (без miR-17-72) и котрансдуцированных miR-17-92 CAR-Т-клеток, соответственно. На фиг. 3А показан IFN-γ, продуцированный трансдуцированными Т-клетками в течение 25 часа в конце 24 часа 96-часового сокультивирования. На фиг. 3В показано, что относительные уровни пролиферации между группами оценивали с помощью анализа WST1 после 3-дневного курса сокультивирования. На фиг. 3C и 3D показан апоптоз CAR-Т-клеток, оцененный с использованием Аннексина-V и PI. На фиг. 3С представлена средняя интенсивность флуоресценции для Аннексина-V на CAR-Т-клетках, подвергнутых воздействию TMZ. Значения означают среднее значение + среднеквадратическое отклонение в лунках в виде трех повторов. (* означает р<0,05). На фиг. 3D представлены гистограммы для Аннексина-V+ и/или PI+, построенные на основе данных проточной цитометрии в одном из трех экспериментов со схожими результатами.

Были проведены эксперименты для оценки эффектов котрансдукции miR-17-92 на пролиферацию CAR-Т-клеток в присутствии TMZ в культуре. Эксперименты были разработаны с индукцией пролиферации CAR-Т-клеток с помощью EGFRvIII-экспрессирующей аAPC, и пролиферацию оценивали с помощью анализа WST-1 (фиг. 3B). Без TMZ, miR-17-92-котрансдуцированные CAR-T-клетки продемонстрировали тенденцию к более быстрой скорости пролиферации по сравнению с контрольными CAR-Т-клетками, но различие не было значимым. Чтобы конкретно оценить эффект TMZ на пролиферацию CAR-Т-клеток, на фиг. 3В, скорость пролиферации клеток в каждой группе представлена относительно пролиферации тех же клеток без TMZ. При добавлении в культуру увеличивающихся концентраций TMZ, степень подавления роста была значительно меньше в случае miR-17-92-котрансдуцированных CAR-Т-клеток, чем в контрольных CAR-Т-клетках.

Были проведены эксперименты для оценки, будет ли котрансдукция miR-17-92 делать CAR-T-клетки более устойчивыми к TMZ-индуцированному апоптозу. С этой целью проводились оценки с помощью проточной цитометрии Аннексин V+ и йодид пропидия (PI)+ CAR-T-клеток в увеличивающихся концентрациях TMZ (фиг. 3С и 3D). Было отмечено дозозависимое увеличение как характеризующихся апоптозом на ранних стадиях (Аннексин V+ PI-) клеток, апоптозных/некротических клеток (Аннексин V+ PI+), так и некротических (Аннексин V- PI+) клеток, и miR-17-92-котрансдуцированные CAR-T-клетки продемонстрировали меньшую степень апоптозных изменения по сравнению с контрольными CAR-Т-клетками.

Внутривенная инъекция CAR-Т-клеток в комбинации с TMZ приводит к полной ремиссии укоренившихся опухолей U87-EGFRvIII у мышей NSG

Были проведены эксперименты для оценки эффективности CAR-Т-клеток у мышей с ослабленным иммунитетом NOD/scid/γc(-/-) (NSG), имеющих укоренившиеся (день 7) внутричерепные опухоли U87-EGFRvIII. Мыши получали однократные внутривенные инфузии miR-17-92-котрансдуцированных CAR-T-клеток, CAR-T-клеток без котрансдукции miR-17-9, или контроль-трансдуцированных Т-клеток (2×106/мышь) через хвостовую вену. Поскольку пациенты с недавно диагностированной GBM обычно получают терапию с использованием TMZ, эксперименты были разработаны с назначением внутрибрюшинных (i.p.) ежедневных инъекций TMZ в течение 5 дней, начиная со дня инфузии Т-клеток (фиг. 4А). На фиг. 4В представлен анализ Каплана-Мейера. Медиана выживаемости мышей, получивших CAR-Т-клетки (с или без котрансдукции miR-17-92), была значительно больше таковой для мышей с контроль-трансдуцированными Т-клетками (р<0,05). Само по себе лечение TMZ было неэффективным, поскольку все контрольные мыши, получающие TMZ и контроль-трансдуцированные Т-клетки, умерли в пределах 3-х недель (21 день) после инфузии Т-клеток (фиг. 4В). Хотя одна из пяти мышей с CAR-Т-клетками и две из пяти мышей с miR-17-92-котрансдуцированными CAR-Т-клетками умерли из-за прогрессирования опухоли к дню 22, все остальные мыши в этих группах жили больше 40 дней. Представлены результаты одного из двух независимых экспериментов со схожими результатами. Не было статистически значимого различия в выживаемости мышей, получающих miR-17-92-котрансдуцированные CAR-T-клетки в сравнение с CAR-Т-клетками без котрансдукции miR-17-92 (критерий Кокса: р=0,5485).

miR-17-92-котрансдуцированные CAR-T-клетки обеспечивают постоянную защиту от опухолей U87-EGFRvIII у мышей

Для определения того, могут ли CAR-T-клетки, инфузия которых была осуществлена мышам в эксперименте, представленном на фиг. 4, обеспечить длительную защиту хозяев от опухолей U87- EGFRvIII, оставшимся в живых повторно инокулировали клетки U87-EGFRvIII в контралатеральное полушарие головного мозга в день 49 (фиг. 5). Хотя повторно инокулированные опухолевые клетки росли у всех трех мышей, получавших CAR-Т-клетки, ни одна из мышей, получавших miR-17-92-котрансдуцированные CAR-Т-клетки, не продемонстрировала BLI-сигналы, выходящие за рамки фонового уровня. Эти результаты дают веские основания предполагать, что котрансдукции кластера miR-17-92 обеспечивает длительную сохраняемость CAR-Т-клеток, тем самым обеспечивая длительную защиту хозяина от роста опухоли. Продольные измерения среднего потока фотонов опухолевого происхождения + среднеквадратическое отклонение от 2-х групп мышей. Фоновый уровень люминесценции (до 103 фотонов в секунду) был определен на основе уровней, отмечаемых у мышей без опухолей, изображения которых получали параллельно с мышами с опухолями в группах лечения.

miR-17-92 можно включить в CAR для увеличения эффективности

Представленные здесь результаты демонстрируют эффекты коэкспрессии miR-17-92 в Т-клетках, трансдуцированных новым CAR на основе антитела против EGFRvIII (3C10-CAR), включающим scFv 3C10 с CD3ζ цепью, CD137 (4-1BB) и CD28. Представленные результаты показывают, что коэкспрессия miR-17-92 придает увеличенную стойкость к подавляющим рост Т-клеток эффектам TGF-β и темозоломида. In vivo Т-клетки, котрансдуцированные как 3C10-CAR, так и miR-17-92, продемонстрировали более длительные терапевтические эффекты, чем Т-клетки, трансдуцированные только 3C10-CAR.

Лентивирусная трансдукция miR-17-92 в настоящем исследовании обеспечивает эктопическую сверхэкспрессию miR-кластера в трансдуцированных Т-клетках. Однако в физиологических условиях уровни экспрессии эндогенной miR-17-92 в Т-клетках, по-видимому, жестко регулируются. В CD8+ Т-клетках человека экспрессия miR-17-92 выявляется на высоких уровнях в «необученных» клетках, но уменьшается по мере дифференцировки клеток (Salaun et al., 2011, J Transl Med 9: 44). В модели вирусной инфекции лимфоцитарного хориоменингита на мышах, экспрессия miR-17-92 сильно увеличивается после активации Т-клеток, однако уменьшается после клонального размножения и далее заглушается во время развития памяти (Wu et al, 2012, Proc Natl Acad Sci USA 109: 9965-9970). В этом исследовании, на которое ссылаются, miR-17-92 является необходимой для быстрого размножения Т-клеток и экспрессии IFN-γ в них. Однако сверхэкспрессия miR-17-92 смещает дифференциацию в сторону короткоживущих терминальных эффекторных клеток. Неспособность уменьшить экспрессию miR-17-92 приводит к постепенной потере клеток памяти и развитию дефектных центральных клеток памяти (Wu et al, 2012, Proc Natl Acad Sci USA 109: 9965-9970). Эти наблюдения необязательно согласуются с результатами, представленными здесь, поскольку отмечалась сохраняемость miR-17-92-котрансдуцированных CAR-Т-клеток и их практическая способность защитить хозяев от повторного инокулированных клеток U87-EGFRvIII. Без желания быть ограниченными какой-либо конкретной теорией, полагают, что это наблюдение связано с комбинаторными эффектами костимулирующих молекул, предусмотренных в CAR, и miR-17-92.

Хотя miR-17-92 была описана как онкогенная микроРНК (van Haaften and Agami, 2010, Genes & Development 24: 1-4), сама по себе сверхэкспрессия miR-17-92, как известно, не является онкогенной в лимфоцитах (Xiao et al., 2008, Nat Immunol 9: 405-414). Действительно, неконтролируемая пролиферация miR-17-92-трансдуцированных Т-клеток в настоящем исследовании не отмечалась. Тем не менее, в качестве альтернативного подхода для лучшего обеспечения безопасности, транзиторная трансдукция Т-клеток самой miR-17-92, вместо лентивирусного стабильного переноса, и многократная инъекция этих Т-клеток может представлять собой рациональный подход без связанных опасений по поводу безопасности интеграции вирусных векторов (Zhao et al., 2010, Cancer Research 70: 9053-9061).

Что касается CAR, мишенью которого является EGFRvIII, для терапии GBM, недавно Morgan и др. оценили последовательности scFv, происходящие из семи различных мАт против EGFRvIII, в том числе 3C10 и 139 человека, в γ-ретровирусных CAR (Morgan et al., 2012, Hum Gene Ther 23: 1043-1053). Определение in vitro характеристик этих CAR выявило 3C10 и 139 в качестве двух из трех клонов, которые приводили к специфической продукции IFN-γ в ответ на EGFRvIII-экспрессирующие клетки-мишени, но не на клетки, экспрессирующие ген EGFR дикого типа.

Важно также понимать, что EGFRvIII экспрессируется только в выборке пациентов с GBM и части клеток GBM даже в случаях «EGFRvIII-позитивных» клеток (Heimberger et al., 2005, Clin. Cancer Res. 11: 1462-1466). Иммунотерапия, мишенью которой является EGFRvIII в качестве одной мишени, скорее всего, приведет к разрастанию клеток GBM, в которых была уменьшена экспрессия антигена, на который направлена иммунотерапия (Sampson et al., 2010, J Clin Oncol 28: 4722-4729). В ряде предыдущих исследований были разработаны CAR к GBM-связанным антигенам, таким как IL-13Rα2 (Kong et al., 2012, Clin Cancer Res 18: 5949-5960; Kahlon et al., 2004, Cancer Res. 64: 9160- 9166), HER-2 (Ahmed et al., 2010, Clinical Cancer Research 16: 474-485) и EphA2 (Chow, K.K. et al., T Cells Redirected to EphA2 for the Immunotherapy of Glioblastoma. Mol Ther (2012). Без желания ограничиться какой-либо конкретной теорией, полагают, что в эффективной терапии с использованием CAR должны в конечном счете использоваться Т-клетки, которые способны противостоять GBM-индуцированным механизмам подавления и быть направленными на несколько антигенов, так что подвергнутые инфузии Т-клетки будут проявлять эффективные и устойчивые терапевтические эффекты против GBM с гетерогенными профилями экспрессии антигена.

Представленные здесь результаты демонстрируют преимущества использования T-клеток, котрансдуцированных pELNS-3C10-CAR и FG12-EF1а-miR-17-92. В качестве альтернативного подхода для достижения коэкспрессии CAR и трансгена miR-17-92, был сконструирован лентивирусный вектор на основе pELNS, который экспрессирует как ген 3C10-CAR, так и ген miR-17-92 в виде одного транскрипта. Использование этого одного «сдвоенного» вектора может иметь преимущество в плане относительно простых процедур трансдукции и прямых регуляторных процессов по сравнению с подходом на основе двух векторов. Кроме того, все Т-клетки, которые экспрессируют CAR, должны также экспрессировать miR-17-92. Однако было установлено, что эффективность трансдукции «сдвоенного» вектора ниже, чем при использовании подхода на основе двух векторов, по-видимому, поскольку титр лентивируса уменьшается по мере увеличения размера вставки. Как обсуждалось здесь в другом месте, лентивирусная трансдукция гена 3C10-CAR и электропорации miR-17-92 в комбинации могут представлять собой подходящую стратегию.

В настоящем исследовании было также установлено, что от 40% до 60% CD3+ CAR-Т-клеток были CD4+, и что CD4+ CAR-Т-клетки эффективно лизировали клетки U87-EGFRvIII EGFRvIII-специфическим образом. Сообщалось, что Перфорин+ CD4+ Т-клетки опосредуют цитотоксические активности через путь с участием перфорина/гранзима В, но не через путь с участием Fas/FasL (Porakishvili et al., 2004, Haematologica 89: 435-443). Поэтому полагают, что CD4+ CAR-T-клетки в данном исследовании экспрессировали перфорин и гранзим для опосредования отмечаемых литических активностей в отношении клеток U87-EGFRvIII.

В заключение, данное исследование дает прочную основу для оценки включающей miR-17-92 терапии с использованием CAR.

Пример 3: Последовательности CAR

Мышиное моноклональное антитело (мАт) 3C10 было первоначально получено путем иммунизации мышей 14-аминокислотным пептидом (PEP3), включающим EGFRvIII-специфический стык, и продемонстрировало очень специфическое распознавание EGFRvIII без какого-либо обнаруживаемого связывания с EGFR дикого типа (Okamoto et al, British J. Cancer 1996, 73: 1366-1372). Впоследствии был получен одноцепочечный вариабельный фрагмент (scFv) мАт 3C10, и была получен кДНК для scFv 3C10. Хотя авидность и/или антиген-специфичность исходных мАт может часто теряется в формах scFv, scFv 3C10 сохранил свою избирательную реактивность с EGFRvIII-специфическим эпитопом (Nakayashiki et al., Jpn. J.Cancer Res. 2000, 91: 1035-1043).

EGFRvIII-специфический CAR был создан путем клонирования 3C10scFv (мыши) с CD28, 4-1ВВ и CD3 дзета в лентивирусную плазмиду pELNS в качестве остова (с промотором EF1). Другой EGFRvIII-специфический CAR был создан путем клонирования 3C10scFv в лентивирусный остов pELNS с шарнирной областью CD8/CD8TM/4-1ВВ/CD3 дзета, экспрессией которого управляет промотор EFLA.

3C10scFv-CD28BBzeta CAR (аминокислотная последовательность) (SEQ ID NO: 1)

MALPVTALLLPLALLLHAARPGSEIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGRIDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRGGVYWGPGTTLTVSSGGGGSGGGGSGGGGSHMDVVMTQSPLTLSVAIGQSASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIKASTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

3C10scFv-BBz CAR (аминокислотная последовательность) (SEQ ID NO: 2)

MALPVTALLLPLALLLHAARPGSEIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGRIDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRGGVYWGPGTTLTVSSGGGGSGGGGSGGGGSHMDVVMTQSPLTLSVAIGQSASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIKASTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

3C10scFv-CD28BBzeta CAR (последовательность нуклеиновой кислоты) (SEQ ID NO: 18)

atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccgggatccgagattcagctgcagcaatctggggcagaacttgtgaagccaggggcctcagtcaagctgtcctgcacaggttctggcttcaacattgaagactactatattcactgggtgaagcagaggactgaacagggcctggaatggattggaaggattgatcctgagaatgatgaaactaaatatggcccaatattccagggcagggccactataacagcagacacatcctccaacacagtctacctgcaactcagcagcctgacatctgaggacactgccgtctattactgtgcctttcgcggtggagtctactgggggccaggaaccactctcacagtctcctcaggaggtggtggttccggtggtggtggttccggaggtggtggttcacatatggatgttgtgatgacccagtctccactcactctatcggttgccattggacaatcagcctccatctcttgcaagtcaagtcagagcctcttagatagtgatggaaagacatatttgaattggttgttacagaggccaggccagtctccaaagcgcctaatctctctggtgtctaaactggactctggagtccctgacaggttcactggcagtggatcagggacagatttcacactgagaatcagcagagtggaggctgaggatttgggaatttattattgctggcaaggtacacattttcctgggacgttcggtggagggaccaagctggagataaaagctagcaccacgacgccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagcccctgtccctgcgcccagaggcgtgccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcctgtgatttttgggtgctggtggtggttggtggagtcctggcttgctatagcttgctagtaacagtggcctttattattttctgggtgaggagtaagaggagcaggctcctgcacagtgactacatgaacatgactccccgccgccccgggcccacccgcaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctccaaacggggcagaaagaaactcctgtatatattcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaagaagaaggaggatgtgaactgagagtgaagttcagcaggagcgcagacgcccccgcgtacaagcagggccagaaccagctctataacgagctcaatctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccctcgc

3C10scFv-BBz CAR (последовательность нуклеиновой кислоты) (SEQ ID NO: 19)

Atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccgggatccgagattcagctgcagcaatctggggcagaacttgtgaagccaggggcctcagtcaagctgtcctgcacaggttctggcttcaacattgaagactactatattcactgggtgaagcagaggactgaacagggcctggaatggattggaaggattgatcctgagaatgatgaaactaaatatggcccaatattccagggcagggccactataacagcagacacatcctccaacacagtctacctgcaactcagcagcctgacatctgaggacactgccgtctattactgtgcctttcgcggtggagtctactgggggccaggaaccactctcacagtctcctcaggaggtggtggttccggtggtggtggttccggaggtggtggttcacatatggatgttgtgatgacccagtctccactcactctatcggttgccattggacaatcagcctccatctcttgcaagtcaagtcagagcctcttagatagtgatggaaagacatatttgaattggttgttacagaggccaggccagtctccaaagcgcctaatctctctggtgtctaaactggactctggagtccctgacaggttcactggcagtggatcagggacagatttcacactgagaatcagcagagtggaggctgaggatttgggaatttattattgctggcaaggtacacattttcctgggacgttcggtggagggaccaagctggagataaaagctagcaccacgacgccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagcccctgtccctgcgcccagaggcgtgccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcctgtgatatctacatctgggcgcccttggccgggacttgtggggtccttctcctgtcactggttatcaccctttactgcaaacggggcagaaagaaactcctgtatatattcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaagaagaaggaggatgtgaactgagagtgaagttcagcaggagcgcagacgcccccgcgtacaagcagggccagaaccagctctataacgagctcaatctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccctcgc

ScFv-фрагмент, названный «139», является антителом человека против EGFRvIII (Morgan et al. 2012 Hum Gene Ther 23 (10): 1043-53). EGFRvIII-специфический CAR, включающий scFv 139, был создан с помощью первоначального синтеза scFv 139. Последовательность scFv 139 клонировали с лидерной последовательностью, шарнирной областью CD8, трансмембранным доменом (ТМ) и желаемыми доменами сигнализации. Например, последовательность scFv 139 клонировали с доменами сигнализации для 4-1ВВ и CD3 дзета. Конструкцию CAR (139scFv-BBZ) экспрессировали с вектора pELNS в случае продукции лентивируса.

139scFv-BBz CAR (аминокислотная последовательность) (SEQ ID NO: 3)

MALPVTALLLPLALLLHAARPGSDIQMTQSPSSLSASVGDRVTITCRASQGIRNNLAWYQQKPGKAPKRLIYAASNLQSGVPSRFTGSGSGTEFTLIVSSLQPEDFATYYCLQHHSYPLTSGGGTKVEIKRTGSTSGSGKPGSGEGSEVQVLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGSSGWSEYWGQGTLVTVSSASTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

139scFv-BBz CAR (последовательность нуклеиновой кислоты) (SEQ ID NO: 20)

Atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccgggatccgacatccagatgacccagagccctagcagcctgagcgccagcgtgggcgacagagtgaccatcacctgtcgggccagccagggcatcagaaacaacctggcctggtatcagcagaagcccggcaaggcccccaagagactgatctacgctgccagcaatctgcagagcggcgtgcccagcagattcaccggaagcggctccggcaccgagttcaccctgatcgtgtccagcctgcagcccgaggacttcgccacctactactgcctgcagcaccacagctaccctctgaccagcggcggaggcaccaaggtggagatcaagcggaccggcagcaccagcggcagcggcaagcctggcagcggcgagggaagcgaggtccaggtgctggaatctggcggcggactggtgcagcctggcggcagcctgagactgagctgtgccgccagcggcttcaccttcagcagctacgccatgtcttgggtccggcaggctcctggaaagggcctggaatgggtgtccgccatcagcggctctggcggctccaccaactacgccgacagcgtgaagggccggttcaccatcagccgggacaacagcaagaacaccctgtatctgcagatgaacagcctgagagccgaggacaccgccgtgtactactgtgccggcagcagcgggtggagcgagtactggggccagggcacactggtcacagtgtctagcgctagcaccacgacgccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagcccctgtccctgcgcccagaggcgtgccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcctgtgatatctacatctgggcgcccttggccgggacttgtggggtccttctcctgtcactggttatcaccctttactgcaaacggggcagaaagaaactcctgtatatattcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaagaagaaggaggatgtgaactgagagtgaagttcagcaggagcgcagacgcccccgcgtacaagcagggccagaaccagctctataacgagctcaatctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccctcgct

КОМПОНЕНТЫ CAR

Последовательности нуклеиновых кислот:

• Нуклеотидная последовательность (мыши) scFv 3C10; (SEQ ID NO: 4)

GAGATTCAGCTGCAGCAATCTGGGGCAGAACTTGTGAAGCCAGGGGCCTCAGTCAAGCTGTCCTGCACAGGTTCTGGCTTCAACATTGAAGACTACTATATTCACTGGGTGAAGCAGAGGACTGAACAGGGCCTGGAATGGATTGGAAGGATTGATCCTGAGAATGATGAAACTAAATATGGCCCAATATTCCAGGGCAGGGCCACTATAACAGCAGACACATCCTCCAACACAGTCTACCTGCAACTCAGCAGCCTGACATCTGAGGACACTGCCGTCTATTACTGTGCCTTTCGCGGTGGAGTCTACTGGGGGCCAGGAACCACTCTCACAGTCTCCTCAGGAGGTGGTGGTTCCGGTGGTGGTGGTTCCGGAGGTGGTGGTTCACATATGGATGTTGTGATGACCCAGTCTCCACTCACTCTATCGGTTGCCATTGGACAATCAGCCTCCATCTCTTGCAAGTCAAGTCAGAGCCTCTTAGATAGTGATGGAAAGACATATTTGAATTGGTTGTTACAGAGGCCAGGCCAGTCTCCAAAGCGCCTAATCTCTCTGGTGTCTAAACTGGACTCTGGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGGACAGATTTCACACTGAGAATCAGCAGAGTGGAGGCTGAGGATTTGGGAATTTATTATTGCTGGCAAGGTACACATTTTCCTGGGACGTTCGGTGGAGGGACCAAGCTGGAGATAAAA

• Нуклеотидная последовательность (гуманизированная) scFv 139; (SEQ ID NO: 5)

GACATCCAGATGACCCAGAGCCCTAGCAGCCTGAGCGCCAGCGTGGGCGACAGAGTGACCATCACCTGTCGGGCCAGCCAGGGCATCAGAAACAACCTGGCCTGGTATCAGCAGAAGCCCGGCAAGGCCCCCAAGAGACTGATCTACGCTGCCAGCAATCTGCAGAGCGGCGTGCCCAGCAGATTCACCGGAAGCGGCTCCGGCACCGAGTTCACCCTGATCGTGTCCAGCCTGCAGCCCGAGGACTTCGCCACCTACTACTGCCTGCAGCACCACAGCTACCCTCTGACCAGCGGCGGAGGCACCAAGGTGGAGATCAAGCGGACCGGCAGCACCAGCGGCAGCGGCAAGCCTGGCAGCGGCGAGGGAAGCGAGGTCCAGGTGCTGGAATCTGGCGGCGGACTGGTGCAGCCTGGCGGCAGCCTGAGACTGAGCTGTGCCGCCAGCGGCTTCACCTTCAGCAGCTACGCCATGTCTTGGGTCCGGCAGGCTCCTGGAAAGGGCCTGGAATGGGTGTCCGCCATCAGCGGCTCTGGCGGCTCCACCAACTACGCCGACAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACAACAGCAAGAACACCCTGTATCTGCAGATGAACAGCCTGAGAGCCGAGGACACCGCCGTGTACTACTGTGCCGGCAGCAGCGGGTGGAGCGAGTACTGGGGCCAGGGCACACTGGTCACAGTGTCTAGC

• Лидерная последовательность (последовательность нуклеиновой кислоты); (SEQ ID NO: 6)

ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCG

• Шарнирная область (последовательность нуклеиновой кислоты); (SEQ ID NO: 7)

ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT

• Трансмембранный домен (последовательность нуклеиновой кислоты); (SEQ ID NO: 8)

ATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGC

• Внутриклеточный домен 4-1ВВ (последовательность нуклеиновой кислоты); (SEQ ID NO: 9)

AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG

• CD3 дзета (последовательность нуклеиновой кислоты); (SEQ ID NO: 10)

AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC

• CD3 дзета (последовательность нуклеиновой кислоты; эталонная последовательность в NCBI - NM_000734.3); (SEQ ID NO: 100)

AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC

АМИНОКИСЛОТНЫЕ ПОСЛЕДОВАТЕЛЬНОСТИ:

• Аминокислотная последовательность (мыши) scFv 3C10; (SEQ ID NO: 11)

EIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGRIDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRGGVYWGPGTTLTVSSGGGGSGGGGSGGGGSHMDVVMTQSPLTLSVAIGQSASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIK

• Аминокислотная последовательность (человека) scFv 139; (SEQ ID NO: 12)

DIQMTQSPSSLSASVGDRVTITCRASQGIRNNLAWYQQKPGKAPKRLIYAASNLQSGVPSRFTGSGSGTEFTLIVSSLQPEDFATYYCLQHHSYPLTSGGGTKVEIKRTGSTSGSGKPGSGEGSEVQVLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGSSGWSEYWGQGTLVTVSS

• Лидерная последовательность (аминокислотная последовательность) (SEQ ID NO: 13)

MALPVTALLLPLALLLHAARP

• Шарнирная область (аминокислотная последовательность) (SEQ ID NO: 14)

TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

• Трансмембранный домен (аминокислотная последовательность) (SEQ ID NO: 15)

IYIWAPLAGTCGVLLLSLVITLYC

• Внутриклеточный домен 4-1ВВ (аминокислотная последовательность) (SEQ ID NO: 16)

KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

• CD3 дзета-домен (аминокислотная последовательность) (SEQ ID NO: 17)

RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

• CD3 дзета-домен (аминокислотная последовательность; эталонная последовательность в NCBI - NM_000734.3) (SEQ ID NO: 99)

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 11, предоставлена как SEQ ID NO: 4. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 12, предоставлена как SEQ ID NO: 5. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 13, предоставлена как SEQ ID NO: 6. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 14, предоставлена как SEQ ID NO: 7. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 15, предоставлена как SEQ ID NO: 8. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 16, предоставлена как SEQ ID NO: 9. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 17, предоставлена как SEQ ID NO: 10. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 1, предоставлена как SEQ ID NO: 18. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 2, предоставлена как SEQ ID NO: 19. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 3, предоставлена как SEQ ID NO: 20. Нуклеотидная последовательность, кодирующая полипептид SEQ ID NO: 99, предоставлена как SEQ ID NO: 100.

Пример 4: Прогнозные указания CDR для EGFRvIIICAR

Прогнозные указания CDR для EGFRvIII-специфического CAR в соответствии с Kabat являются следующими:

• VH:

EIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGRIDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRGGVYWGPGTTLTVSS; (SEQ ID NO: 21);

где CDR1 представляет собой DYYIH (SEQ ID NO: 22), CDR2 представляет собой RIDPENDETKYGPIFQG (SEQ ID NO: 23), и CDR3 представляет собой RGGVY (SEQ ID NO: 24).

• VL:

DVVMTQSPLTLSVAIGQSASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIK; (SEQ ID NO: 25);

где CDR1 представляет собой KSSQSLLDSDGKTYLN (SEQ ID NO: 26), CDR2 представляет собой LVSKLDS (SEQ ID NO: 27), и CDR3 представляет собой WQGTHFPGT (SEQ ID NO: 28).

Прогнозные указания CDR для EGFRvIII-специфического CAR в соответствии с Chothia являются следующими:

• VH:

EIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGRIDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRGGVYWGPGTTLTVSS; (SEQ ID NO: 29);

где CDR1 представляет собой GFNIEDY (SEQ ID NO: 30), CDR2 представляет собой DPENDE (SEQ ID NO: 31), и CDR3 представляет собой RGGVY (SEQ ID NO: 32).

• VL:

DVVMTQSPLTLSVAIGQSASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTGSGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIK; (SEQ ID NO: 33);

где CDR1 представляет собой SQSLLDSDGKTY (SEQ ID NO: 34), CDR2 представляет собой LVS (SEQ ID NO: 35), и CDR3 представляет собой GTHFPG (SEQ ID NO: 36).

Пример 5: Гуманизация мышиного антитела против EGFRvIII

Гуманизация мышиного антитела против EGFRvIII желательна для клинических условий, в которых специфические для мыши остатки могут индуцировать реакцию против мышиного антигена у людей (НАМА) - у пациентов, получающих лечение Т-клетками, трансдуцированными мышиной CAR-конструкцией. Последовательности VH и VL происходящего из гибридомы антитела против EGFRvIII мыши были извлечены из опубликованной литературы (Morgan et al. (2012) Human Gene Therapy, 23: 1043-1953, выше). Гуманизация была достигнута путем пересадки CDR-участков из антитела против EGFRvIII мыши в акцепторные каркасные области зародышевой линии человека VH1_1-f или VH5_5a а также VK2_A17 или VK4_B3 (баз данных vBASE). Помимо CDR-участков, несколько остатков каркасных областей, т.е. VK2 #36, #49, VK4 #2, #36, #46, #49, VH1 #2, #24, #76, #94 и VH5 #2, #24, #73, #76, #94, которые, как полагают, поддерживают структурную целостность CDR-участков, были сохранены из мышиной последовательности. Кроме того, человеческие J-элементы JH6 и JK4 были использованы для тяжелой и легкой цепи, соответственно. Полученные в результате аминокислотные последовательности гуманизированного антитела были обозначены VK2_A17/Hz1 и VK4_B3/Hz1 для легких цепей и VH1_1-f/Hz1, VH5_5-a/Hz1 для тяжелых цепей, показанных на фиг. 9. Нумерация остатков подчиняется Kabat (Kabat E.A. et al., 1991, выше). Для определения CDR были использованы как Kabat, так и Chothia и др., 1987 (выше). Остатки каркасных областей, сохраненные из мышиного антитела против EGFRvIII, показаны жирным шрифтом/курсивом в рамочке, остатки CDR подчеркнуты.

На основе последовательностей гуманизированных легкой и тяжелой цепей, продемонстрированных на фиг. 9, в общей сложности 8 комбинаций каркасных областей были использованы для создания растворимых scFv для дальнейшей валидации. Порядок, в котором VH- и VL-домены появляются в scFv, изменялся (т.е. ориентация VL-VH или VH-VL), и четыре копии субъединицы «G4S» (SEQ ID NO: 37), которая включает последовательность GGGGS (SEQ ID NO: 37), использовали для соединения каркасных областей. На фиг. 9 представлены CDR в последовательностях VH и VL, рассчитанные в соответствии с Kabat и др. и Chothia и др. (выше).

Клонирование:

Были получены последовательности ДНК, кодирующие мышиные и гуманизированные VL- и VH-домены, и кодоны конструкций были оптимизированы для экспрессии в клетках Homo sapiens.

Последовательности, кодирующие VL- и VH-домены, субклонировали в экспрессионные векторы, подходящие для секреции в клетках млекопитающих. Элементы экспрессионного вектора включают промотор (промотор-энхансер цитомегаловируса (CMV)), сигнальную последовательность для облегчения секреции, сигнал полиаденилирования и терминатор транскрипции (гена бычьего гормона роста (BGH)), элемент, делающий возможной репликацию эписомы и репликацию в прокариотах (например, начало репликации SV40 и ColE1 или другие известные в данной области техники) и элементы, которые делают возможным отбор (ген устойчивости к ампициллину и маркер зеоцин).

Пример 6: Характеристики гуманизированных растворимых scFv-фрагментов антитела против EGFRvIII

Были получены растворимые scFv-фрагменты, описанные выше, используя стандартные методы молекулярной биологии. Эти растворимые scFv были использованы в исследованиях описания свойств для изучения стабильности, экспрессии на клеточной поверхности и связывающих свойств scFv.

Экспрессия и очистка scFv

Для трансфекции каждой конструкции scFv приблизительно 3е8 клеток 293F трансфицировали 100 мкг плазмиды, используя PEI в качестве реагента для трансфекции в соотношении 3:1 (PEI:ДНК). Клетки выращивали в 100 мл среды ΕΧΡi293 Expression Media (Invitrogen) в шейкерной колбе при 37°С, 125 оборотов в минуту, 8% CО2. Культуру собирали через шесть дней и использовали для очистки белка.

Клетки 293F собирали путем осаждения при 3500×g в течение 20 минут. Супернатант собирали и фильтровали через фильтрующее устройство VacuCap90 PF Filter Unit (w/0,8/0,2 мкм Super Membrane, PALL). Приблизительно 400 мкл агарозных сфер Ni-NTA (Qiagen) добавляли к супернатанту. Смесь вращали и инкубировали в течение 4 ч при 4°С. Ее загружали в колонку для очистки и промывали промывочным буфером с 20 мМ гистидина. Белок элюировали, используя 500 мкл буфера для элюции с 300 мМ гистидина. Образцы подвергали диализу против буфера PBS в течение ночи при 4°С. Образцы белка подвергали количественному анализу, используя спектрофотометр NanoDrop 2000, микроячейка.

ЕС50 при определяемом с помощью FACS связывании очищенных scFv с клетками, экспрессирующими или EGFR человека дикого типа, или EGFRvIII

Были проведены следующие эксперименты, чтобы показать, что все гуманизированные варианты scFv против EGFRvIII характеризуются сравнимым связыванием с EGFRvIII, но не связыванием с EGFR дикого типа.

Суспензию клеток HEK293F транзиторно трансфицировали или hEGFR дикого типа, или hEGFRvIII и собирали через 2 дня после трансфекции. Приблизительно 5e5 клеток/на лунку переносили в 96-луночный планшет BD Falcon. Клетки центрифугировали при 900 оборотов в минуту (в центрифуге Sorval Legend XT) в течение 3 минут. Супернатант удаляли. Образцы белка scFv против EGFRvIII разводили в DPBS с 5% FBS. Образцы добавляли в лунки, перемешивали и инкубировали в течение 1 часа. Клетки промывали дважды в DPBS с 5% FBS. Клетки инкубировали с анти-поли(His) PE (R&D) в течение 1 часа, дважды промывали перед анализом FACS (LSRII от BD Biosciences).

Было определено, что ЕС50 scFv мыши (m3C10) для hEGFRvIII составляет ~5 нМ, как показано на фиг. 10. Все гуманизированные варианты scFv против EGFRvIII показали значения ЕС50 в диапазоне ЕС50 от однозначного числа до небольшого двухзначного числа нМ (5-50 нМ). Кроме того, не отмечалось заметное связывание конструкций 2173 и 2174 с экспрессирующими EGFR дикого типа клеточными линиями, что означает улучшенный профиль безопасности по сравнению с мышиным 3C10, как показано на фиг. 11. На основании этих исследований, клон 2173 был отобран для дальнейшей клинической характеристики, как показано в примере 8.

Пример 7: Конструкции гуманизированных EGFRvIII-специфических CAR

ScFv, используемые в конечных конструкциях CAR, были получены из гуманизированных каркасных последовательностей, описанных в примере 1. Порядок, в котором VH- и VL-домены появляются в scFv, изменялся (т.е. ориентация VL-VH или VH-VL). Линкер (G4S)4 (SEQ ID NO: 37) использовали для соединения вариабельных доменов для создания scFv, представленных в таблице 1.

Таблица 1
Конструкции гуманизированных scFv против EGFRvIII с показом ориентации VH и VL и длины линкера (Таблица раскрывает «G4S» как SEQ ID NO: 37)
ID конструкции Длина (аминокислот) комментарий
108358 277 VH1-VK4, 4G4S
108359 277 VK4-VH1, 4G4S
108360 277 VH5-VK2, 4G4S
108361 277 VK2-VH5, 4G4S
107276 277 VH1-VK2, 4G4S

111046 278 VH5-VK4, 4G4S
111048 278 VK4-VH5, 4G4S
107277 277 VK2-VH1, 4G4S
107275
mEGFRvIII 3C10
274 VH-VL, 3G4S+HM
EGFRvIII 139 269 VL-VH

Последовательности гуманизированных scFv-фрагментов, представлены ниже в таблице 2 (SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 50, SEQ ID NO: 56, SEQ ID NO: 62, SEQ ID NO: 68, SEQ ID NO: 74 и SEQ ID NO: 80). Эти scFv-фрагменты были использованы с дополнительными последовательностями, SEQ ID NO: 13-17, для образования полных конструкций CAR с SEQ ID NO: SEQ ID NO: 43, SEQ ID NO: 49, SEQ ID NO: 55, SEQ ID NO: 61, SEQ ID NO: 67, SEQ ID NO: 73, SEQ ID NO: 79 и SEQ ID NO: 85.

Все эти клоны содержали изменение остатка Q/K в домене сигнализации костимулирующего домена, происходящего из CD3 дзета цепи.

Таблица 2
Конструкции гуманизированных EGFRvIII-специфических CAR
Название SEQ ID NO: Последовательность
CAR 1
scFv-домен CAR1 38 eiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveik
scFv-домен CAR1
нуклеотиды
39 gaaatccagctggtccaatcgggagctgaggtcaagaagccgggagccaccgtcaagatctcatgcaaggggtcgggattcaacatcgaggactactacattcactgggtgcagcaagctccgggaaaaggcctggaatggatgggcagaatcgacccagaaaacgacgaaactaagtacggaccgattttccaaggaagagtgactatcaccgccgatacttcaaccaataccgtctacatggaactgagctcgctccggtccgaagatactgcagtgtattactgtgcctttcgcggaggggtgtactggggccaaggaactactg

tcactgtctcgtcaggaggcggagggtcgggaggaggcgggagcggaggcggtggctcgggtggcggaggaagcgacgtggtgatgacccagtccccggactccctcgccgtgagcctcggagagagggcgactatcaattgcaagtcgtcccagtcacttctggattccgatggtaaaacgtacctcaactggctgcagcaaaagccagggcagccacccaaacggttgatctcccttgtgtccaaactggatagcggagtgcctgaccgcttctcgggttccggtagcgggaccgacttcaccctgacgatcagctcactgcaggcggaggacgtggcagtgtactactgctggcagggaacccacttccctggcacctttggaggtggcaccaaggtggagatcaag
Растворимый scFv CAR1 - нуклеотиды 40 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgaaatccagctggtccaatcgggagctgaggtcaagaagccgggagccaccgtcaagatctcatgcaaggggtcgggattcaacatcgaggactactacattcactgggtgcagcaagctccgggaaaaggcctggaatggatgggcagaatcgacccagaaaacgacgaaactaagtacggaccgattttccaaggaagagtgactatcaccgccgatacttcaaccaataccgtctacatggaactgagctcgctccggtccgaagatactgcagtgtattactgtgcctttcgcggaggggtgtactggggccaaggaactactgtcactgtctcgtcaggaggcggagggtcgggaggaggcgggagcggaggcggtggctcgggtggcggaggaagcgacgtggtgatgacccagtccccggactccctcgccgtgagcctcggagagagggcgactatcaattgcaagtcgtcccagtcacttctggattccgatggtaaaacgtacctcaactggctgcagcaaaagccagggcagccacccaaacggttgatctcccttgtgtccaaactggatagcggagtgcctgaccgcttctcgggttccggtagcgggaccgacttcaccctgacgatcagctcactgcaggcggaggacgtggcagtgtactactgctggcagggaacccacttccctggcacctttggaggtggcaccaaggtggagatcaagggatcgcaccaccatcaccatcatcatcac
Растворимый scFv CAR1 - аминокислоты 41 Malpvtalllplalllhaarpeiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqspd

slavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikgshhhhhhhh
CAR1 - полная конструкция - нуклеотиды лентивирус 42 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgagatccagctggtgcagtcgggagctgaagtcaaaaagcctggcgcaaccgtcaagatctcgtgcaaaggatcagggttcaacatcgaggactactacatccattgggtgcaacaggcacccggaaaaggcctggagtggatggggaggattgacccagaaaatgacgaaaccaagtacggaccgatcttccaaggacgggtgaccatcacggctgacacttccactaacaccgtctacatggaactctcgagccttcgctcggaagataccgcggtgtactactgcgcctttagaggtggagtctactggggacaagggactaccgtcaccgtgtcgtcaggtggcggaggatcaggcggaggcggctccggtggaggaggaagcggaggaggtggctccgacgtggtgatgacgcagtcaccggactccttggcggtgagcctgggtgaacgcgccactatcaactgcaagagctcccagagcttgctggactccgatggaaagacttatctcaattggctgcaacagaagcctggccagccgccaaagagactcatctcactggtgagcaagctggatagcggagtgccagatcggttttcgggatcgggctcaggcaccgacttcaccctgactatttcctccctccaagccgaggatgtggccgtctactactgttggcaggggactcacttcccggggaccttcggtggaggcactaaggtggagatcaaaaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtaca

acgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR1 - полная конструкция - аминокислоты 43 malpvtalllplalllhaarpeiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveiktttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR 2
scFv-домен CAR2 44 dvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvss
scFv-домен CAR2 - нуклеотиды 45 gatgtcgtgatgacccagtccccagactccctcgcagtgtccttgggagaacgggccaccatcaactgcaaatcgagccagtcactgctggactcagacggaaagacctacctcaactggctgcagcagaagcctggccagccaccgaagcgcctgatctccctggtgtccaagctggactcgggcgtcccggacaggtttagcggtagcggctcgggaaccgacttcactctgaccattagctcgctccaagctgaagatgtggcggtctactactgctggcaggggacccacttccccgggacctttggcggaggaactaaagtcgaaatcaaaggaggaggcggatcaggtggaggaggcagcggaggaggagggagcggcggtggcggctccgaaattcaacttgtgcaatccggtgccgaggtgaagaaacctggtgccactgtcaagatctcgtgtaagggatcgggattcaatatcgaggactac

tacatccactgggtgcaacaggcgccaggaaagggattggagtggatgggtcgcatcgacccggaaaacgatgagactaagtacggaccgatcttccaaggccgggtcacgatcactgcggatacctccactaataccgtgtatatggagctctcgtcactgagaagcgaagatacggccgtgtactactgcgcattcagaggaggtgtgtactggggccagggaactactgtgaccgtgtcgtcg
Растворимый scFv CAR2 - нуклеотиды 46 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgatgtcgtgatgacccagtccccagactccctcgcagtgtccttgggagaacgggccaccatcaactgcaaatcgagccagtcactgctggactcagacggaaagacctacctcaactggctgcagcagaagcctggccagccaccgaagcgcctgatctccctggtgtccaagctggactcgggcgtcccggacaggtttagcggtagcggctcgggaaccgacttcactctgaccattagctcgctccaagctgaagatgtggcggtctactactgctggcaggggacccacttccccgggacctttggcggaggaactaaagtcgaaatcaaaggaggaggcggatcaggtggaggaggcagcggaggaggagggagcggcggtggcggctccgaaattcaacttgtgcaatccggtgccgaggtgaagaaacctggtgccactgtcaagatctcgtgtaagggatcgggattcaatatcgaggactactacatccactgggtgcaacaggcgccaggaaagggattggagtggatgggtcgcatcgacccggaaaacgatgagactaagtacggaccgatcttccaaggccgggtcacgatcactgcggatacctccactaataccgtgtatatggagctctcgtcactgagaagcgaagatacggccgtgtactactgcgcattcagaggaggtgtgtactggggccagggaactactgtgaccgtgtcgtcggggtcacatcaccaccatcatcatcaccac
Растворимый scFv CAR2 - аминокислоты 47 malpvtalllplalllhaarpdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssgshhhhhhhh
CAR2 - 48 atggccctccctgtcaccgccctgctgcttccgctggctct

полная конструкция - нуклеотиды tctgctccacgccgctcggcccgacgtggtcatgactcaaagcccagattccttggctgtctcccttggagaaagagcaacgatcaattgcaaaagctcgcagtccctgttggactccgatggaaaaacctacctcaactggctgcagcagaagccgggacaaccaccaaagcggctgatttccctcgtgtccaagctggacagcggcgtgccggatcgcttctcgggcagcggctcgggaaccgattttactctcactatttcgtcactgcaagcggaggacgtggcggtgtattactgctggcagggcactcacttcccgggtacttttggtggaggtaccaaagtcgaaatcaagggtggaggcgggagcggaggaggcgggtcgggaggaggaggatcgggtggcggaggctcagaaatccagctggtgcagtcaggtgccgaagtgaagaagcctggggccacggtgaagatctcgtgcaaggggagcggattcaacatcgaggattactacatccattgggtgcaacaggcccctggcaaagggctggaatggatgggaaggatcgaccccgagaatgacgagactaagtacggcccgatcttccaaggacgggtgaccatcactgcagacacttcaaccaacaccgtctacatggaactctcctcgctgcgctccgaggacaccgccgtgtactactgtgctttcagaggaggagtctactggggacagggaacgaccgtgaccgtcagctcaaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg

CAR2 - полная конструкция - аминокислоты 49 malpvtalllplalllhaarpdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvsstttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR 3
scFv-домен CAR3 50 eiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveik
scFv-домен CAR3 - нуклеотиды 51 gagattcagctggtccaaagcggcgcagaagtgaaaaagccaggggaatcgttgcgcatcagctgtaaaggttccggcttcaacatcgaggactattacatccattgggtgcggcagatgccaggaaaggggctggaatggatgggacggattgacccggagaacgacgaaaccaagtacggaccgatctttcaaggacacgtgactatctccgccgacaccagcatcaatacggtgtacctccaatggtcctcactcaaggcctcggataccgcgatgtactactgcgcgttcagaggaggcgtctactggggacaagggactactgtgactgtctcatcaggaggtggaggaagcggaggaggtggctcgggcggaggtggatcgggaggaggagggtccgatgtggtgatgacccagtccccactgtcgctcccggtgaccctcggacagcctgctagcatctcgtgcaaatcctcgcaatccctgctggactcggacggaaaaacgtacctcaattggctgcagcagcgccctggccagagcccgagaaggcttatctcgctggtgtcaaagctggatagcggtgtgcccgaccggttcagcggctcagggtcaggaaccgatttcaccttgaagatctcccgcgtggaagc

cgaagatgtcggagtctactactgctggcagggtactcacttcccggggacctttggtggcggcactaaggtcgagattaag
Растворимый scFv CAR3 - нуклеотиды 52 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgagattcagctggtccaaagcggcgcagaagtgaaaaagccaggggaatcgttgcgcatcagctgtaaaggttccggcttcaacatcgaggactattacatccattgggtgcggcagatgccaggaaaggggctggaatggatgggacggattgacccggagaacgacgaaaccaagtacggaccgatctttcaaggacacgtgactatctccgccgacaccagcatcaatacggtgtacctccaatggtcctcactcaaggcctcggataccgcgatgtactactgcgcgttcagaggaggcgtctactggggacaagggactactgtgactgtctcatcaggaggtggaggaagcggaggaggtggctcgggcggaggtggatcgggaggaggagggtccgatgtggtgatgacccagtccccactgtcgctcccggtgaccctcggacagcctgctagcatctcgtgcaaatcctcgcaatccctgctggactcggacggaaaaacgtacctcaattggctgcagcagcgccctggccagagcccgagaaggcttatctcgctggtgtcaaagctggatagcggtgtgcccgaccggttcagcggctcagggtcaggaaccgatttcaccttgaagatctcccgcgtggaagccgaagatgtcggagtctactactgctggcagggtactcacttcccggggacctttggtggcggcactaaggtcgagattaagggctcacaccatcatcaccatcaccaccac
Растворимый scFv CAR3 - аминокислоты 53 malpvtalllplalllhaarpeiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikgshhhhhhhh
CAR3 - полная конструкция - нуклеотиды 54 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgaaatccagctggtgcaaagcggagccgaggtgaagaagcccggagaatccctgcgcatctcgtgtaagggttccggctttaacatcgaggattactacatccactgggtgagacagatgccgggcaaaggtctggaatgga

tgggccgcatcgacccggagaacgacgaaaccaaatacggaccaatcttccaaggacatgtgactatttccgcggatacctccatcaacactgtctacttgcagtggagctcgctcaaggcgtcggataccgccatgtactactgcgcattcagaggaggtgtgtactggggccagggcactacggtcaccgtgtcctcgggaggtggagggtcaggaggcggaggctcgggcggtggaggatcaggcggaggaggaagcgatgtggtcatgactcaatccccactgtcactgcctgtcactctggggcaaccggcttccatctcatgcaagtcaagccaatcgctgctcgactccgacggaaaaacctacctcaattggcttcagcagcgcccaggccagtcgcctcggaggctgatctcactcgtgtcgaagcttgactccggggtgccggatcggtttagcggaagcggatcggggaccgacttcacgttgaagattagccgggtggaagccgaggacgtgggagtctattactgctggcaggggacccacttcccggggactttcggaggaggcaccaaagtcgagattaagaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR3 - полная конструкция - аминокислоты 55 malpvtalllplalllhaarpeiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqspl

slpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveiktttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR 4
scFv-домен CAR4 56 dvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvss
scFv-домен CAR4 - нуклеотиды 57 gacgtcgtcatgacccagagcccgctgtcactgcctgtgaccctgggccagccggcgtccattagctgcaaatcctcgcaatccctgctcgactcagacggaaaaacgtacttgaactggctccaacagcgccctgggcaatccccaaggcggcttatctcactcgtcagcaagctcgatagcggtgtcccagacagattttcgggctcgggatcgggcactgatttcactctgaagatctcgcgggtggaagccgaggatgtgggagtgtactattgctggcagggcactcacttccccgggacgtttggcggaggaactaaggtcgagatcaaaggaggaggtggatcaggcggaggtgggagcggaggaggaggaagcggtggtggaggttccgaaatccagctggtgcaatcaggagccgaggtgaagaagccgggagaatccctgcgcatctcgtgcaagggctcgggcttcaacatcgaggattactacatccactgggtgcggcagatgccgggaaaggggttggaatggatgggacgcattgacccggaaaatgatgaaaccaaatacgggccaatcttccaaggccacgtgaccattagcgctgacacttccatcaacaccgtgtaccttcagtggtcctcactgaaggcgtcggacactgccatgtactactgtgcattcagaggaggggtctactggggacagggcaccaccgtgaccgtgagctcc
Растворимый scFv CAR4 - нуклеотиды 58 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgacgtcgtcatgacccaga

gcccgctgtcactgcctgtgaccctgggccagccggcgtccattagctgcaaatcctcgcaatccctgctcgactcagacggaaaaacgtacttgaactggctccaacagcgccctgggcaatccccaaggcggcttatctcactcgtcagcaagctcgatagcggtgtcccagacagattttcgggctcgggatcgggcactgatttcactctgaagatctcgcgggtggaagccgaggatgtgggagtgtactattgctggcagggcactcacttccccgggacgtttggcggaggaactaaggtcgagatcaaaggaggaggtggatcaggcggaggtgggagcggaggaggaggaagcggtggtggaggttccgaaatccagctggtgcaatcaggagccgaggtgaagaagccgggagaatccctgcgcatctcgtgcaagggctcgggcttcaacatcgaggattactacatccactgggtgcggcagatgccgggaaaggggttggaatggatgggacgcattgacccggaaaatgatgaaaccaaatacgggccaatcttccaaggccacgtgaccattagcgctgacacttccatcaacaccgtgtaccttcagtggtcctcactgaaggcgtcggacactgccatgtactactgtgcattcagaggaggggtctactggggacagggcaccaccgtgaccgtgagctccggctcgcatcaccatcatcaccaccatcac
Растворимый scFv CAR4 - аминокислоты 59 malpvtalllplalllhaarpdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssgshhhhhhhh
CAR4 - полная конструкция - нуклеотиды 60 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgacgtcgtcatgacccaatcccctctctccctgccggtcaccctgggtcagccggcgtcgatctcatgcaaaagctcacagtccctgctggattcggacggaaaaacctacttgaactggctccaacagaggccgggtcagtcccctcgcagactgatctcgctggtgagcaagctcgactcgggtgtgccggatcggttctccgggtcaggatcgggcaccgactttacgctcaagatttcgagagtggaggccgaggatgtgggagtgtactattgctggcagggcacgcatttccccgggacc

tttggaggcgggactaaggtggaaatcaagggaggtggcggatcaggcggaggaggcagcggcggaggtggatcaggaggcggagggtcagagatccagctggtccaaagcggagcagaggtgaagaagccaggcgagtcccttcgcatttcgtgcaaagggagcggcttcaacattgaagattactacatccactgggtgcggcaaatgccaggaaagggtctggaatggatgggacggatcgacccagaaaatgatgaaactaagtacggaccgatcttccaaggacacgtcactatctccgcggacacttcgatcaacaccgtgtacctccagtggagcagcttgaaagcctccgacaccgctatgtactactgtgccttccgcggaggagtctactggggacaggggactactgtgaccgtgtcgtccaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR4 - полная конструкция - аминокислоты 61 malpvtalllplalllhaarpdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvsstttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlll

slvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR 5
scFv-домен CAR5 62 eiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveik
scFv-домен CAR5 - нуклеотиды 63 gaaatccagctcgtgcagagcggagccgaggtcaagaaaccgggtgctaccgtgaagatttcatgcaagggatcgggcttcaacatcgaggattactacatccactgggtgcagcaggcaccaggaaaaggacttgaatggatgggccggatcgacccggaaaatgacgagactaagtacggccctatcttccaaggacgggtgacgatcaccgcagacactagcaccaacaccgtctatatggaactctcgtccctgaggtccgaagatactgccgtgtactactgtgcgtttcgcggaggtgtgtactggggacagggtaccaccgtcaccgtgtcatcgggcggtggaggctccggtggaggagggtcaggaggcggtggaagcggaggaggcggcagcgacgtggtcatgactcaatcgccgctgtcgctgcccgtcactctgggacaacccgcgtccatcagctgcaaatcctcgcagtcactgcttgactccgatggaaagacctacctcaactggctgcagcaacgcccaggccaatccccaagacgcctgatctcgttggtgtcaaagctggactcaggggtgccggaccggttctccgggagcgggtcgggcacggatttcactctcaagatctccagagtggaagccgaggatgtgggagtctactactgctggcagggaacccatttccctggaacttttggcggaggaactaaggtcgagattaaa
Растворимый scFv CAR5 - нуклеотиды 64 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgaaatccagctcgtgcagagcggagccgaggtcaagaaaccgggtgctaccgtgaagatttcatgcaagggatcgggcttcaacatcgaggattactacatccactgggtgcagcaggcaccaggaaaaggacttgaatggatgggccggatcgacccggaaaatgacgagactaagtacggc

cctatcttccaaggacgggtgacgatcaccgcagacactagcaccaacaccgtctatatggaactctcgtccctgaggtccgaagatactgccgtgtactactgtgcgtttcgcggaggtgtgtactggggacagggtaccaccgtcaccgtgtcatcgggcggtggaggctccggtggaggagggtcaggaggcggtggaagcggaggaggcggcagcgacgtggtcatgactcaatcgccgctgtcgctgcccgtcactctgggacaacccgcgtccatcagctgcaaatcctcgcagtcactgcttgactccgatggaaagacctacctcaactggctgcagcaacgcccaggccaatccccaagacgcctgatctcgttggtgtcaaagctggactcaggggtgccggaccggttctccgggagcgggtcgggcacggatttcactctcaagatctccagagtggaagccgaggatgtgggagtctactactgctggcagggaacccatttccctggaacttttggcggaggaactaaggtcgagattaaagggagccaccatcatcatcaccaccaccac
Растворимый scFv CAR5 - аминокислоты 65 malpvtalllplalllhaarpeiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikgshhhhhhhh
CAR5 - полная конструкция - нуклеотиды 66 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgaaatccagctcgtgcagagcggagccgaggtcaagaaaccgggtgctaccgtgaagatttcatgcaagggatcgggcttcaacatcgaggattactacatccactgggtgcagcaggcaccaggaaaaggacttgaatggatgggccggatcgacccggaaaatgacgagactaagtacggccctatcttccaaggacgggtgacgatcaccgcagacactagcaccaacaccgtctatatggaactctcgtccctgaggtccgaagatactgccgtgtactactgtgcgtttcgcggaggtgtgtactggggacagggtaccaccgtcaccgtgtcatcgggcggtggaggctccggtggaggagggtcaggaggcggtggaagcggaggaggcggcagcgacgtggtcatgactcaatcgccgctgtcgctgcccgtcactctgggacaacccgcgtccatcagctg

caaatcctcgcagtcactgcttgactccgatggaaagacctacctcaactggctgcagcaacgcccaggccaatccccaagacgcctgatctcgttggtgtcaaagctggactcaggggtgccggaccggttctccgggagcgggtcgggcacggatttcactctcaagatctccagagtggaagccgaggatgtgggagtctactactgctggcagggaacccatttccctggaacttttggcggaggaactaaggtcgagattaaaaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR5 - полная конструкция - аминокислоты 67 malpvtalllplalllhaarpeiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveiktttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr

CAR 6
scFv-домен CAR6 68 eiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveik
scFv-домен CAR6 - нуклеотиды 69 gaaatccagctggtgcagtcaggcgccgaggtcaagaagccgggagagtcgctgagaatctcgtgcaagggctcggggttcaacatcgaggactactacattcactgggtcaggcagatgccgggaaagggactggaatggatgggccggatcgacccagaaaatgacgaaaccaaatacgggccgatttttcaaggccacgtgactatcagcgcagacacgagcatcaacactgtctacctccagtggtcctcgcttaaggccagcgataccgctatgtactactgcgcattcagaggcggggtgtactggggacaaggaaccactgtgaccgtgagcagcggaggtggcggctcgggaggaggtgggagcggaggaggaggttccggcggtggaggatcagatgtcgtgatgacccagtccccggactccctcgctgtctcactgggcgagcgcgcgaccatcaactgcaaatcgagccagtcgctgttggactccgatggaaagacttatctgaattggctgcaacagaaaccaggacaacctcccaagcggctcatctcgcttgtgtcaaaactcgattcgggagtgccagaccgcttctcggggtccgggagcggaactgactttactttgaccatttcctcactgcaagcggaggatgtggccgtgtattactgttggcagggcacgcatttccctggaaccttcggtggcggaactaaggtggaaatcaag
Растворимый scFv CAR6 - нуклеотиды 70 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgaaatccagctggtgcagtcaggcgccgaggtcaagaagccgggagagtcgctgagaatctcgtgcaagggctcggggttcaacatcgaggactactacattcactgggtcaggcagatgccgggaaagggactggaatggatgggccggatcgacccagaaaatgacgaaaccaaatacgggccgatttttcaaggccacgtgactatcagcgcagacacgagcatcaacactgtctacctccagtggtcctcgcttaaggccagcgataccgctatgtactactgcgcattcagaggcggggtgtactggggacaaggaaccactgtgaccgtgagcagcggagg

tggcggctcgggaggaggtgggagcggaggaggaggttccggcggtggaggatcagatgtcgtgatgacccagtccccggactccctcgctgtctcactgggcgagcgcgcgaccatcaactgcaaatcgagccagtcgctgttggactccgatggaaagacttatctgaattggctgcaacagaaaccaggacaacctcccaagcggctcatctcgcttgtgtcaaaactcgattcgggagtgccagaccgcttctcggggtccgggagcggaactgactttactttgaccatttcctcactgcaagcggaggatgtggccgtgtattactgttggcagggcacgcatttccctggaaccttcggtggcggaactaaggtggaaatcaagggatcacaccaccatcatcaccatcaccaccat
Растворимый scFv CAR6 - аминокислоты 71 malpvtalllplalllhaarpeiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikgshhhhhhhhh
CAR6 - полная конструкция - нуклеотиды 72 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgagattcagctcgtgcaatcgggagcggaagtcaagaagccaggagagtccttgcggatctcatgcaagggtagcggctttaacatcgaggattactacatccactgggtgaggcagatgccggggaagggactcgaatggatgggacggatcgacccagaaaacgacgaaactaagtacggtccgatcttccaaggccatgtgactattagcgccgatacttcaatcaataccgtgtatctgcaatggtcctcattgaaagcctcagataccgcgatgtactactgtgctttcagaggaggggtctactggggacagggaactaccgtgactgtctcgtccggcggaggcgggtcaggaggtggcggcagcggaggaggagggtccggcggaggtgggtccgacgtcgtgatgacccagagccctgacagcctggcagtgagcctgggcgaaagagctaccattaactgcaaatcgtcgcagagcctgctggactcggacggaaaaacgtacctcaattggctgcagcaaaagcctggccagccaccgaagcgccttatctcactggtgtcgaagctggattcgggagtgcccgatcgcttctccggctcgggatcgggtactgacttcaccc

tcactatctcctcgcttcaagcagaggacgtggccgtctactactgctggcagggaacccactttccgggaaccttcggcggagggacgaaagtggagatcaagaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR6 - полная конструкция - аминокислоты 73 malpvtalllplalllhaarpeiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssggggsggggsggggsggggsdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveiktttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR 7
scFv-домен CAR7 74 dvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikggggsggggsg

gggsggggseiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvss
scFv-домен CAR7 - нуклеотиды 75 gacgtggtgatgacccaatcgccagattccctggcagtgtccctgggcgaacgcgccactattaactgcaaatcgtcacagtccttgcttgattccgacggaaagacctacctcaattggctccagcagaagccaggacaaccgccaaagagactgatctccctggtgtcaaagctggactcgggagtgcctgatcggttctcgggtagcgggagcggcaccgacttcactctgaccatctcgtcactccaggctgaggacgtggccgtgtattactgttggcagggtactcactttccgggcactttcggaggcggcaccaaggtggagattaaaggaggaggcggaagcggaggtggaggatcgggaggtggtgggagcggcggaggagggagcgagatccagctcgtccaatcgggagcggaagtgaagaagcccggagagtcacttagaatctcatgcaaggggtcgggcttcaacatcgaggattactacatccattgggtccgccagatgcctggtaaaggactggaatggatggggaggattgacccggaaaacgacgaaactaagtacggaccgatctttcaagggcacgtgactatctccgctgatacctcaatcaatactgtctacctccagtggtcctcgctgaaagcaagcgacaccgcgatgtactactgcgccttccggggaggagtgtactggggccaaggcaccacggtcacggtcagctcc
Растворимый scFv CAR7 - нуклеотиды 76 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgacgtggtgatgacccaatcgccagattccctggcagtgtccctgggcgaacgcgccactattaactgcaaatcgtcacagtccttgcttgattccgacggaaagacctacctcaattggctccagcagaagccaggacaaccgccaaagagactgatctccctggtgtcaaagctggactcgggagtgcctgatcggttctcgggtagcgggagcggcaccgacttcactctgaccatctcgtcactccaggctgaggacgtggccgtgtattactgttggcagggtactcactttccgggcactttcggaggcggcaccaaggtggagattaaaggaggaggcggaagcggaggtggaggatcgggaggtggtgggagcggcggaggagggagcgagatccagctcgtccaatcgggagcggaagtgaagaagcccggagagtcacttagaatctcatgcaaggggtcgggcttcaacatcgaggattactacatccattgggtccgcc

agatgcctggtaaaggactggaatggatggggaggattgacccggaaaacgacgaaactaagtacggaccgatctttcaagggcacgtgactatctccgctgatacctcaatcaatactgtctacctccagtggtcctcgctgaaagcaagcgacaccgcgatgtactactgcgccttccggggaggagtgtactggggccaaggcaccacggtcacggtcagctccggctcccatcaccaccaccatcaccatcatcac
Растворимый scFv CAR7 - аминокислоты 77 malpvtalllplalllhaarpdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvssgshhhhhhhhh
CAR7 - полная конструкция - нуклеотиды 78 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgacgtggtgatgactcagtcgcctgactcgctggctgtgtcccttggagagcgggccactatcaattgcaagtcatcccagtcgctgctggattccgacgggaaaacctacctcaattggctgcagcaaaaaccgggacagcctccaaagcggctcatcagcctggtgtccaagttggacagcggcgtgccagaccgcttctccggttcgggaagcggtactgatttcacgctgaccatctcatccctccaagcggaggatgtggcagtctactactgttggcagggcacgcattttccgggcacttttggaggagggaccaaggtcgaaatcaagggaggaggtggctcgggcggaggaggctcgggaggaggaggatcaggaggcggtggaagcgagattcaactggtccagagcggcgcagaagtcaagaagccgggtgaatcgctcagaatctcgtgcaaaggatcgggattcaacatcgaggactactacattcactgggtcagacaaatgccgggcaaagggctggaatggatggggaggatcgaccccgaaaacgatgaaaccaagtacggaccaatcttccaagggcacgtgaccatttcggcggacacctcaatcaacactgtgtacctccagtggagctcacttaaggccagcgataccgccatgtactattgcgctttccgcggaggggtgtactggggacagggcactactgtgaccgtgtcatccaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctg

tccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR7 - полная конструкция - аминокислоты 79 malpvtalllplalllhaarpdvvmtqspdslavslgeratinckssqslldsdgktylnwlqqkpgqppkrlislvskldsgvpdrfsgsgsgtdftltisslqaedvavyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgeslrisckgsgfniedyyihwvrqmpgkglewmgridpendetkygpifqghvtisadtsintvylqwsslkasdtamyycafrggvywgqgttvtvsstttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR 8
scFv-домен CAR8 80 dvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvss
scFv-домен 81 gatgtggtcatgacgcagtcaccactgtccctccccgtgac

CAR8 - нуклеотиды ccttggacagccagcgtcgattagctgcaagtcatcccaatccctgctcgattcggatggaaagacctatctcaactggctgcagcaaagacccggtcagagccctaggagactcatctcgttggtgtcaaagctggacagcggagtgccggaccggttttccggttcgggatcggggacggacttcactctgaagatttcacgggtggaagctgaggatgtgggagtgtactactgctggcagggaacccatttccctggcacttttggcggaggaactaaggtcgaaatcaagggaggaggtggctcgggaggaggcggatcgggcggaggcgggagcggcggaggagggtccgaaatccaacttgtccagtcaggagccgaagtgaagaaaccgggagccaccgtcaaaatcagctgtaagggatcgggattcaatatcgaggactactacatccactgggtgcagcaagctccgggcaaaggactggagtggatggggcgcatcgacccagagaacgacgaaaccaaatacggcccgatcttccaagggcgggtgaccatcaccgcggacacctcaactaacactgtgtacatggagctgagctccctgcgctccgaagatactgcagtctactactgcgccttccgcggtggtgtgtactggggacagggcaccactgtgactgtcagctcg
Растворимый scFv CAR8 - нуклеотиды 82 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgatgtggtcatgacgcagtcaccactgtccctccccgtgacccttggacagccagcgtcgattagctgcaagtcatcccaatccctgctcgattcggatggaaagacctatctcaactggctgcagcaaagacccggtcagagccctaggagactcatctcgttggtgtcaaagctggacagcggagtgccggaccggttttccggttcgggatcggggacggacttcactctgaagatttcacgggtggaagctgaggatgtgggagtgtactactgctggcagggaacccatttccctggcacttttggcggaggaactaaggtcgaaatcaagggaggaggtggctcgggaggaggcggatcgggcggaggcgggagcggcggaggagggtccgaaatccaacttgtccagtcaggagccgaagtgaagaaaccgggagccaccgtcaaaatcagctgtaagggatcgggattcaatatcgaggactactacatccactgggtgcagcaagctccgggcaaaggactggagtggatggggcgcatcgacccagagaacgacgaaaccaaatacggcccgatcttccaagggcgggtgaccatcaccgcggacacctcaactaacactgtgtacatggagctgagctccctgcgctccgaagatactgcagtc

tactactgcgccttccgcggtggtgtgtactggggacagggcaccactgtgactgtcagctcggggtcccaccatcatcaccaccaccatcac
Растворимый scFv CAR8 - аминокислоты 83 malpvtalllplalllhaarpdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvssgshhhhhhhh
CAR8 - полная конструкция - нуклеотиды 84 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgatgtggtcatgacgcagtcaccactgtccctccccgtgacccttggacagccagcgtcgattagctgcaagtcatcccaatccctgctcgattcggatggaaagacctatctcaactggctgcagcaaagacccggtcagagccctaggagactcatctcgttggtgtcaaagctggacagcggagtgccggaccggttttccggttcgggatcggggacggacttcactctgaagatttcacgggtggaagctgaggatgtgggagtgtactactgctggcagggaacccatttccctggcacttttggcggaggaactaaggtcgaaatcaagggaggaggtggctcgggaggaggcggatcgggcggaggcgggagcggcggaggagggtccgaaatccaacttgtccagtcaggagccgaagtgaagaaaccgggagccaccgtcaaaatcagctgtaagggatcgggattcaatatcgaggactactacatccactgggtgcagcaagctccgggcaaaggactggagtggatggggcgcatcgacccagagaacgacgaaaccaaatacggcccgatcttccaagggcgggtgaccatcaccgcggacacctcaactaacactgtgtacatggagctgagctccctgcgctccgaagatactgcagtctactactgcgccttccgcggtggtgtgtactggggacagggcaccactgtgactgtcagctcgaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaa

gctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR8 - полная конструкция - аминокислоты 85 malpvtalllplalllhaarpdvvmtqsplslpvtlgqpasisckssqslldsdgktylnwlqqrpgqsprrlislvskldsgvpdrfsgsgsgtdftlkisrveaedvgvyycwqgthfpgtfgggtkveikggggsggggsggggsggggseiqlvqsgaevkkpgatvkisckgsgfniedyyihwvqqapgkglewmgridpendetkygpifqgrvtitadtstntvymelsslrsedtavyycafrggvywgqgttvtvsstttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR 9 клон 3C10 против EGFRvIII мыши
scFv-домен CAR9 86 eiqlqqsgaelvkpgasvklsctgsgfniedyyihwvkqrteqglewigridpendetkygpifqgratitadtssntvylqlssltsedtavyycafrggvywgpgttltvssggggsggggsggggshmdvvmtqspltlsvaigqsasisckssqslldsdgktylnwllqrpgqspkrlislvskldsgvpdrftgsgsgtdftlrisrveaedlgiyycwqgthfpgtfgggtkleik
scFv-домен CAR9 - нуклеотиды 98 gagatccagctccaacagagcggagccgaactggtcaaaccgggagcgtcggtgaagttgtcatgcactggatcgggcttcaacatcgaggattactacatccactgggtcaagcaacgcaccgagcaggggctggaatggatcggacggatcgaccccgaaaacgatgaaaccaagtacgggcctatcttccaaggacgggcca

ccattacggctgacacgtcaagcaataccgtctacctccagctttccagcctgacctccgaggacactgccgtgtactactgcgccttcagaggaggcgtgtactggggaccaggaaccactttgaccgtgtccagcggaggcggtggatcaggaggaggaggctcaggcggtggcggctcgcacatggacgtggtcatgactcagtccccgctgaccctgtcggtggcaattggacagagcgcatccatctcgtgcaagagctcacagtcgctgctggattccgacggaaagacttatctgaactggctgctccaaagaccagggcaatcaccgaaacgccttatctccctggtgtcgaaactcgactcgggtgtgccggatcggtttaccggtagcgggtccggcacggacttcactctccgcatttcgagggtggaagcggaggatctcgggatctactactgttggcagggaacccacttccctgggacttttggaggcggaactaagctggaaatcaag
Растворимый scFv CAR9 - нуклеотиды 87 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgagatccagctccaacagagcggagccgaactggtcaaaccgggagcgtcggtgaagttgtcatgcactggatcgggcttcaacatcgaggattactacatccactgggtcaagcaacgcaccgagcaggggctggaatggatcggacggatcgaccccgaaaacgatgaaaccaagtacgggcctatcttccaaggacgggccaccattacggctgacacgtcaagcaataccgtctacctccagctttccagcctgacctccgaggacactgccgtgtactactgcgccttcagaggaggcgtgtactggggaccaggaaccactttgaccgtgtccagcggaggcggtggatcaggaggaggaggctcaggcggtggcggctcgcacatggacgtggtcatgactcagtccccgctgaccctgtcggtggcaattggacagagcgcatccatctcgtgcaagagctcacagtcgctgctggattccgacggaaagacttatctgaactggctgctccaaagaccagggcaatcaccgaaacgccttatctccctggtgtcgaaactcgactcgggtgtgccggatcggtttaccggtagcgggtccggcacggacttcactctccgcatttcgagggtggaagcggaggatctcgggatctactactgttggcagggaacccacttccctgggacttttggaggcggaactaagctggaaatcaagggtagccatcaccatcaccaccaccatcat
Растворимый 88 malpvtalllplalllhaarpeiqlqqsgaelvkpgasvkl

scFv CAR9 - аминокислоты sctgsgfniedyyihwvkqrteqglewigridpendetkygpifqgratitadtssntvylqlssltsedtavyycafrggvywgpgttltvssggggsggggsggggshmdvvmtqspltlsvaigqsasisckssqslldsdgktylnwllqrpgqspkrlislvskldsgvpdrftgsgsgtdftlrisrveaedlgiyycwqgthfpgtfgggtkleikgshhhhhhhh
CAR9 - полная конструкция - нуклеотиды 89 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgagatccagctccaacagagcggagccgaactggtcaaaccgggagcgtcggtgaagttgtcatgcactggatcgggcttcaacatcgaggattactacatccactgggtcaagcaacgcaccgagcaggggctggaatggatcggacggatcgaccccgaaaacgatgaaaccaagtacgggcctatcttccaaggacgggccaccattacggctgacacgtcaagcaataccgtctacctccagctttccagcctgacctccgaggacactgccgtgtactactgcgccttcagaggaggcgtgtactggggaccaggaaccactttgaccgtgtccagcggaggcggtggatcaggaggaggaggctcaggcggtggcggctcgcacatggacgtggtcatgactcagtccccgctgaccctgtcggtggcaattggacagagcgcatccatctcgtgcaagagctcacagtcgctgctggattccgacggaaagacttatctgaactggctgctccaaagaccagggcaatcaccgaaacgccttatctccctggtgtcgaaactcgactcgggtgtgccggatcggtttaccggtagcgggtccggcacggacttcactctccgcatttcgagggtggaagcggaggatctcgggatctactactgttggcagggaacccacttccctgggacttttggaggcggaactaagctggaaatcaagaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctaca

acgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggactcagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR9 - полная конструкция - аминокислоты 90 malpvtalllplalllhaarpeiqlqqsgaelvkpgasvklsctgsgfniedyyihwvkqrteqglewigridpendetkygpifqgratitadtssntvylqlssltsedtavyycafrggvywgpgttltvssggggsggggsggggshmdvvmtqspltlsvaigqsasisckssqslldsdgktylnwllqrpgqspkrlislvskldsgvpdrftgsgsgtdftlrisrveaedlgiyycwqgthfpgtfgggtkleiktttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr
CAR10 клон 139 против EGFRvIII
scFv-домен CAR10 91 diqmtqspsslsasvgdrvtitcrasqgirnnlawyqqkpgkapkrliyaasnlqsgvpsrftgsgsgteftlivsslqpedfatyyclqhhsypltsgggtkveikrtgstsgsgkpgsgegsevqvlesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstnyadsvkgrftisrdnskntlylqmnslraedtavyycagssgwseywgqgtlvtvss
scFv-домен CAR10 - нуклеотиды 92 gatatccaaatgactcagagcccttcatccctgagcgccagcgtcggagacagggtgaccatcacgtgccgggcatcccaaggcattagaaataacttggcgtggtatcagcaaaaaccaggaaaggccccgaagcgcctgatctacgcggcctccaaccttcagtcaggagtgccctcgcgcttcaccgggagcggtagcggaactgagtttacccttatcgtgtcgtccctgcagccagaggacttcgcgacctactactgcctccagcatcactcgtacccgttgacttcgggaggcggaaccaaggtcgaaatcaaacgcactggctcgacgtcagggtccggtaaaccgggatcgggagaagga

tcggaagtccaagtgctggagagcggaggcggactcgtgcaacctggcgggtcgctgcggctcagctgtgccgcgtcgggttttactttcagctcgtacgctatgtcatgggtgcggcaggctccgggaaaggggctggaatgggtgtccgctatttccggctcgggtggaagcaccaattacgccgactccgtgaagggacgcttcaccatctcacgggataactccaagaatactctgtacctccagatgaactcgctgagagccgaggacaccgcagtgtactactgcgcagggtcaagcggctggtccgaatactggggacagggcaccctcgtcactgtcagctcc
Растворимый scFv CAR10 - нуклеотиды 93 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgatatccaaatgactcagagcccttcatccctgagcgccagcgtcggagacagggtgaccatcacgtgccgggcatcccaaggcattagaaataacttggcgtggtatcagcaaaaaccaggaaaggccccgaagcgcctgatctacgcggcctccaaccttcagtcaggagtgccctcgcgcttcaccgggagcggtagcggaactgagtttacccttatcgtgtcgtccctgcagccagaggacttcgcgacctactactgcctccagcatcactcgtacccgttgacttcgggaggcggaaccaaggtcgaaatcaaacgcactggctcgacgtcagggtccggtaaaccgggatcgggagaaggatcggaagtccaagtgctggagagcggaggcggactcgtgcaacctggcgggtcgctgcggctcagctgtgccgcgtcgggttttactttcagctcgtacgctatgtcatgggtgcggcaggctccgggaaaggggctggaatgggtgtccgctatttccggctcgggtggaagcaccaattacgccgactccgtgaagggacgcttcaccatctcacgggataactccaagaatactctgtacctccagatgaactcgctgagagccgaggacaccgcagtgtactactgcgcagggtcaagcggctggtccgaatactggggacagggcaccctcgtcactgtcagctcccatcaccatcaccaccaccatcac
Растворимый scFv CAR10 - аминокислоты 94 malpvtalllplalllhaarpdiqmtqspsslsasvgdrvtitcrasqgirnnlawyqqkpgkapkrliyaasnlqsgvpsrftgsgsgteftlivsslqpedfatyyclqhhsypltsgggtkveikrtgstsgsgkpgsgegsevqvlesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstnyadsvkgrftisrdnskntlylqmnslraedtavyycagssg

wseywgqgtlvtvsshhhhhhhh
CAR10 - полная конструкция - нуклеотиды 95 atggccctccctgtcaccgccctgctgcttccgctggctcttctgctccacgccgctcggcccgatatccaaatgactcagagcccttcatccctgagcgccagcgtcggagacagggtgaccatcacgtgccgggcatcccaaggcattagaaataacttggcgtggtatcagcaaaaaccaggaaaggccccgaagcgcctgatctacgcggcctccaaccttcagtcaggagtgccctcgcgcttcaccgggagcggtagcggaactgagtttacccttatcgtgtcgtccctgcagccagaggacttcgcgacctactactgcctccagcatcactcgtacccgttgacttcgggaggcggaaccaaggtcgaaatcaaacgcactggctcgacgtcagggtccggtaaaccgggatcgggagaaggatcggaagtccaagtgctggagagcggaggcggactcgtgcaacctggcgggtcgctgcggctcagctgtgccgcgtcgggttttactttcagctcgtacgctatgtcatgggtgcggcaggctccgggaaaggggctggaatgggtgtccgctatttccggctcgggtggaagcaccaattacgccgactccgtgaagggacgcttcaccatctcacgggataactccaagaatactctgtacctccagatgaactcgctgagagccgaggacaccgcagtgtactactgcgcagggtcaagcggctggtccgaatactggggacagggcaccctcgtcactgtcagctccaccactaccccagcaccgaggccacccaccccggctcctaccatcgcctcccagcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggccgtgcatacccggggtcttgacttcgcctgcgatatctacatttgggcccctctggctggtacttgcggggtcctgctgctttcactcgtgatcactctttactgtaagcgcggtcggaagaagctgctgtacatctttaagcaacccttcatgaggcctgtgcagactactcaagaggaggacggctgttcatgccggttcccagaggaggaggaaggcggctgcgaactgcgcgtgaaattcagccgcagcgcagatgctccagcctacaagcaggggcagaaccagctctacaacgaactcaatcttggtcggagagaggagtacgacgtgctggacaagcggagaggacgggacccagaaatgggcgggaagccgcgcagaaagaatccccaagagggcctgtacaacgagctccaaaaggataagatggcagaagcctatagcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacggactgtaccagggact

cagcaccgccaccaaggacacctatgacgctcttcacatgcaggccctgccgcctcgg
CAR10 - полная конструкция - аминокислоты 96 malpvtalllplalllhaarpdiqmtqspsslsasvgdrvtitcrasqgirnnlawyqqkpgkapkrliyaasnlqsgvpsrftgsgsgteftlivsslqpedfatyyclqhhsypltsgggtkveikrtgstsgsgkpgsgegsevqvlesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstnyadsvkgrftisrdnskntlylqmnslraedtavyycagssgwseywgqgtlvtvsstttpaprpptpaptiasqplslrpeacrpaaggavhtrgldfacdiyiwaplagtcgvlllslvitlyckrgrkkllyifkqpfmrpvqttqeedgcscrfpeeeeggcelrvkfsrsadapaykqgqnqlynelnlgrreeydvldkrrgrdpemggkprrknpqeglynelqkdkmaeayseigmkgerrrgkghdglyqglstatkdtydalhmqalppr

ScFv-фрагменты CAR затем клонировали в лентивирусные векторы для создания конструкции полноразмерной CAR в одной рамке считывания, и используя промотор EF1 альфа для экспрессии (SEQ ID NO: 97).

Промотор EF1 альфа

GTGAGGCTCCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACAGTCCCCGAGAAGTTGGGGGGAGGGGTCGGCAATTGAACCGGTGCCTAGAGAAGGTGGCGCGGGGTAAACTGGGAAAGTGATGTCGTGTACTGGCTCCGCCTTTTTCCCGAGGGTGGGGGAGAACCGTATATAAGTGCAGTAGTCGCCGTGAACGTTCTTTTTCGCAACGGGTTTGCCGCCAGAACACAGGTAAGTGCCGTGTGTGGTTCCCGCGGGCCTGGCCTCTTTACGGGTTATGGCCCTTGCGTGCCTTGAATTACTTCCACCTGGCTGCAGTACGTGATTCTTGATCCCGAGCTTCGGGTTGGAAGTGGGTGGGAGAGTTCGAGGCCTTGCGCTTAAGGAGCCCCTTCGCCTCGTGCTTGAGTTGAGGCCTGGCCTGGGCGCTGGGGCCGCCGCGTGCGAATCTGGTGGCACCTTCGCGCCTGTCTCGCTGCTTTCGATAAGTCTCTAGCCATTTAAAATTTTTGATGACCTGCTGCGACGCTTTTTTTCTGGCAAGATAGTCTTGTAAATGCGGGCCAAGATCTGCACACTGGTATTTCGGTTTTTGGGGCCGCGGGCGGCGACGGGGCCCGTGCGTCCCAGCGCACATGTTCGGCGAGGCGGGGCCTGCGAGCGCGGCCACCGAGAATCGGACGGGGGTAGTCTCAAGCTGGCCGGCCTGCTCTGGTGCCTGGCCTCGCGCCGCCGTGTATCGCCCCGCCCTGGGCGGCAAGGCTGGCCCGGTCGGCACCAGTTGCGTGAGCGGAAAGATGGCCGCTTCCCGGCCCTGCTGCAGGGAGCTCAAAATGGAGGACGCGGCGCTCGGGAGAGCGGGCGGGTGAGTCACCCACACAAAGGAAAAGGGCCTTTCCGTCCTCAGCCGTCGCTTCATGTGACTCCACGGAGTACCGGGCGCCGTCCAGGCACCTCGATTAGTTCTCGAGCTTTTGGAGTACGTCGTCTTTAGGTTGGGGGGAGGGGTTTTATGCGATGGAGTTTCCCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGTAATTCTCCTTGGAATTTGCCCTTTTTGAGTTTGGATCTTGGTTCATTCTCAAGCCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGA (SEQ ID NO: 97)

Экспрессия на поверхности CAR9, CAR10 и выбранные конструкции гуманизированных EGFRvIII-специфических CAR и окрашивание, определяемое с помощью FACS

Следующие эксперименты показали, что, по-видимому, существует различие в аффинности к EGFRvIII, на основе in vitro исследований связывания в случае как клеток Jurkat, так и первичных Т-клеток.

В клетки Jurkat E6 электропорировали или вектор для CAR9, или вектор для CAR10, используя набор Amaxa Cell Line Nucleofector Kit V (Lonza, Colgne AG, Германия) и программу X-001. Через день после трансфекции 0,5×106 клеток в 0,2 мл буфера FACS (DPBS буфера, содержащего 5% FBS) помещали в каждую лунку 96-луночного планшета V-образной формы (Greiner Bio-One, Германия) и инкубировали в течение 10 минут при комнатной температуре. Затем клетки центрифугировали и ресуспендировали в 0,2 мл буфера FACS с различными концентрациями EGFRvIII-Fc или EGFRwt-Fc и инкубировали при 4°С в течение 30 минут. Затем клетки промывали буфером FACS три раза и инкубировали с 0,2 мл буфера FACS с 2 мкл конъюгированного с PE Fc против IgG человека (Jackson ImmunoResearch Laboratories, West Grove, PA) в течение 30 минут при 4°С в темноте. После промывания 0,2 мл буфера FACS три раза клетки анализировали в устройстве LSRII (BD Biosciences, San Jose, CA), используя программное обеспечение FACSDiva (BD Biosciences, San Jose, CA). Иммунофлуоресцентное окрашивание было проанализировано как относительная логарифмическая флуоресценции живых клеток, и определяли процент PE-позитивных клеток.

Как показано на фиг. 12, связывание CAR9, экспрессируемого в клетках Jurkat, со слитым белком EGFRvIII-Fc приблизительно в 1000 раз сильнее, чем с EGFR-Fc дикого типа. Кроме того, CART-клеточная структура, экспрессирующая CAR10, проявляет значительно меньшее (в ~40 раз) связывание с EGFRvIII, чем с CAR9. Это говорит о том, что, хотя мышиный CAR9 связывается с EGFRvIII, он по-прежнему сохраняет некоторое связывания с EGFR дикого типа. Кроме того, это убедительно свидетельствует о том, что CAR9 имеет более высокую аффинность к EGFRvIII, чем конструкция CAR10.

Дальнейшие эксперименты на первичных Т-клетках дали схожие результаты. Вкратце, первичные CD3+ Т-клетки человека стимулировали, используя покрытые антителом против CD3/CD28 сферы, в течение 24 часов, а затем трансдуцировали лентивирусными векторами, кодирующими или CAR9, CAR10, CAR6, или контрольный CAR, с множественностью заражения (MOI) 3:1. В эксперимент была также включена популяция контроль-трансдуцированных Т-клеток. Эти клетки размножали в течение приблизительно 8-9 дней в культуре, пока они не начали переходить в состояние покоя. В этот момент времени 0,5×106 клеток помещали в каждую 96-луночного планшета V-образной формы. Клетки промывали один раз PBS и окрашивали реагентом, позволяющим отличить живые клетки от мертвых, (1:1000 в PBS), в течение 30 мин на льду. Затем клетки дважды промывали буфером FACS буфера и инкубировали с 1 мкг/мл биотинилированного белка EGFRvIII или EGFR дикого типа в течение 30 мин на льду. Затем клетки промывали два раза и инкубировали с 0,2 мл буфера FACS с использованием 1:1000 разведения стрептавидина-РЕ в течение 15 мин на льду. После двукратной промывки буфером FACS клетки анализировали в LSRII. Иммунофлуоресцентное окрашивание было проанализировано как относительная логарифмическая флуоресценция живых клеток, и процент PE-позитивных клеток определяли в сочетании с геометрическим средним позитивной популяции.

Как показано на фиг. 13, CAR9 и CAR6 демонстрируют среднее геометрическое (21K для CAR9, 27К для CAR6) для связывания с EGFRvIII, превышающее в 10 раз таковое для CAR10 (лишь 2K), когда насыщающие количества белка EGFRvIII используются для детектирования, даже если все конструкции трансдуцированы эквивалентно (~50% эффективность трансдукции для всех). Аналогичным образом, специфичность в отношении белка EGFR дикого типа приблизительно в 10 раз меньше, что отображает логарифмический сдвиг в меньшую сторону для окрашивания белком EGFR дикого типа. Это обеспечивает дополнительную поддержку данных, полученных с использованием клеток Jurkat, представленных выше, которые указывают на то, что CAR9 и CAR6 обладают большей аффинностью к белку EGFRvIII, чем CAR10, при экспрессии в первичных Т-клетках, и предполагает, что они будут более эффективными в клинике.

Функциональный анализ панели конструкций гуманизированных CAR был проведен, как описано в примере 8.

Пример 8: Анализ конструкций гуманизированных EGFRvIII-специфических CAR в Т-клетках

Для оценки возможности нацеливания на EGFRvIII с помощью CAR- технологии, гуманизированные scFv-фрагменты против EGFRvIII были клонированы в лентивирусный вектор для экспрессии CAR с использованием CD3 дзета-цепи и костимулирующей молекулы 4-1ВВ в двух различных конфигурациях. Оптимальная конструкция выбирается на основе количества и качества эффекторной Т-клеточной реакции EGFRvIII-CAR-трансдуцированных Т-клеток в ответ на мишени EGFRvIII+ и EGFR дикого типа. Эффекторные Т-клеточные реакции включают, но без ограничения, размножение, пролиферацию, удвоение клеток, продукцию цитокинов и уничтожение клеток-мишеней или цитолитическую активность (дегрануляцию).

Материалы и методы

Создание линии клеток-репортеров Jurkat для первоначальной характеристики функции CAR

В качестве альтернативы трансдукции и активации первичных T-клеток, линия клеток-репортеров Jurkat-NFAT может использоваться для оценки функциональной активности конструкций CAR. Линию Т-клеток Jurkat (E6-1) трансфицировали репортерной конструкцией NFAT-люцифераза, и стабильная, клональная клеточная линия (JNL) была отобрана для дальнейшей характеристики на основе сильной индукции репортера NFAT после стимуляции РМА и иономицином. Клетки JNL трансдуцировали лентивирусными векторами с MOI 5:1 и затем размножали в течение 5-7 дней. Перед использованием в анализе определяли процент трансдуцированных клеток (экспрессирующих EGFRvIII-специфический CAR с представлением на клеточной поверхности) и относительную интенсивность флуоресценции этой экспрессии в них с помощью анализа с использованием проточной цитометрии в LSRII. Исходя из гистограмм, относительные уровни экспрессии CAR могут быть проверены путем сравнения процента трансдуцированных клеток с их относительной интенсивностью флуоресценции.

Оценка Т-клеточной активации экспрессирующих EGFRvIII-специфический гуманизированный CAR клеток JNL

Для оценки активации Т-клеток в линии клеток-репортеров JNL, клетки JNL или CAR-трансдуцированные клетки JNL высевают в количестве 50000 клеток на лунку в 96-луночный черный планшет с прозрачным дном. Клетки-мишени (родительские клетки ВНК или клетки ВНК, созданные для экспрессии или EGFRvIIII, или EGFR дикого типа) добавляют в лунки с получением соотношений эффектор:мишень (Е:Т)=1:2, 1:1, 1:0,3, 1:0,1, 1:0,03, 1:01 и 1:0,003. РМА и иономицин используются в качестве положительного контроля для активации. Клетки подвергают инкубации при 37°С в течение 16-24 часов. В конце инкубации равный объем реагента для анализы люциферазы Bright-Glo добавляют в каждую лунку. Планшет инкубируют при комнатной температуре в течение 10 минут, а затем люминесценцию измеряют с помощью люминометра.

Создание перенаправленных, экспрессирующих EGFRvIII-специфический гуманизированный CAR Т-клеток

Лентивирусные векторы для переноса гуманизированного EGFRvIII-специфического CAR используются для получения геномного материала, который упаковывается в псевдотипированные лентивирусные частицы VSVg. ДНК лентивирусного вектора для переноса смешивают с тремя компонентами для упаковки VSVg, gag/pol и rev в сочетании с реагентом липофектамином для трансфекции их вместе в Т-клетки 293. Через 24 и 48 ч среду собирают, фильтруют и концентрируют с помощью ультрацентрифугирования или хроматографии. Полученный в результате вирусный препарат хранят при -80°С. Количество трансдуцирующих единиц определяют титрованием на SupT1-клетках.

Перенаправленные, экспрессирующие EGFRvIII-специфический CAR Т-клетки получают путем активации свежих Т-клеток при введении в контакт с CD3×28 сферами в течение 24 часов, с последующим добавлением соответствующего количества трансдуцирующих единиц для получения желаемого процента трансдуцированных Т-клеток. Этим модифицированным Т-клеткам позволяют размножаться, пока они не станут покоящимися и не уменьшаться в размере (~300 фл), после чего их подвергают криоконсервации для последующего анализа. Количества и размеры клеток определяют, используя Coulter multisizer III. Перед криоконсервацией определяют процент трансдуцированных клеток (экспрессирующих EGFRvIII-специфический CAR с представлением на клеточной поверхности) и относительную интенсивность флуоресценции этой экспрессии в них с помощью анализа с использованием проточной цитометрии в LSRII. Исходя из гистограмм, относительные уровни экспрессии CAR могут быть исследованы путем сравнения процента трансдуцированных клеток с их относительной интенсивностью флуоресценции.

Оценка цитолитической активности, способностей к пролиферации и секреции цитокинов перенаправленных на EGFRvIII, экспрессирующих гуманизированный CAR Т-клеток.

Для оценки функциональных способностей экспрессирующих гуманизированный EGFRvIII-специфический CAR Т-клеток к уничтожению, пролиферации и секреции цитокинов, клетки оттаивали и оставляли для восстановления в течение ночи. Помимо гуманизированных конструкций, мышиный CAR9 использовали с целью сравнения, в то время как SS1-BBz использовали в качестве экспрессируемого CAR без нацеливания для определения фонового CAR/T-клеточного эффекта. Для этого анализа цитотоксичности на основе проточной цитометрии, клетки-мишени окрашивали CSFE для количественного анализа их присутствия. Клетки-мишени также окрашивали на предмет выявления экспрессии EGFRvIII для подтверждения схожих уровней антигенов-мишеней. Цитолитические активности EGFRvIII-CAR-Т-клеток определяли при титровании соотношений эффектор:клетка-мишень = 10:1, 3:1, 1:1, 0,3:1 и 0: 1, где эффекторы были определены как Т-клетки, экспрессирующие CAR на основе антитела против EGFRvIII. Анализы начинали путем смешивания соответствующего количества Т-клеток с постоянным количеством клеток-мишеней. Через 4 или 16 ч общий объем каждой смеси удаляли, и каждую лунку промывали. Т-клетки окрашивали на CD3, и все клетки окрашивали маркером, позволяющим отличить живые клетки от мертвых, 7AAD. После последней промывки осажденные клетки ресуспендировали в определенном объеме с заданным числом сфер для подсчета. Данные по окрашиванию клеток собирали с помощью проточной цитометрии в LSRII и анализировали с использованием программного обеспечения FlowJo, используя сферы для количественного анализа результатов.

Для измерения клеточной пролиферации и продукции цитокинов Т-клеток(ами) с гуманизированным CAR, специфическим в отношении EGFRvIII, клетки размораживали и предоставляли возможность восстановиться в течение ночи. Помимо гуманизированного CAR, специфического в отношении EGFRvIII, мышиный CAR9 использовали с целью сравнения, в то время как SS1-BBz использовали в качестве экспрессируемого CAR без нацеливания для определения фонового CAR/T-клеточного эффекта. Т-клетки были направлены на U87, линию клеток глиобластомы, порожденной астроцитомой, экспрессирующей или не экспрессирующей EGFRvIII. Кроме того, CD3×28 сферы использовали для оценки возможности Т-клеток отвечать на второй ряд иммунологических эндогенных сигналов. Для анализа пролиферации Т-клетки окрашивали CSFE. Пролиферация представляла собой разведение красящего вещества CSFE, отражающее разделение родительских меток теперь на две дочерние клетки. В ходе анализа были проверены лишь соотношения эффектор:мишень = 1:1 и 1:0, где эффекторы были определены как все Т-клеток (CD4 и 8), приведенные к представлению химерного рецептора к EGFRvIII в одинаковых процентах. Анализ проводили в двух повторах и через 24 часа после смешивания клеток. Супернатант удаляли для определения продукции цитокинов. Через 5 дней Т-клетки окрашивали на предмет выявления живых/мертвых клеток, используя Live/Dead Violet (Invitrogen), затем окрашивали на экспрессию CAR и фенотипировали как или CD4, или CD8 клетки. После последней промывки осажденные клетки ресуспендировали в определенном объеме с заданным числом сфер для подсчета BD. Данные по окрашиванию клеток собирали с помощью проточной цитометрии в LSRII и анализировали с использованием программного обеспечения FlowJo, используя сферы для количественного анализа результатов. Общее количество клеток определяли по количеству подсчитанных клеток относительно определенного количества сфер, умноженному на долю сфер, еще не подсчитанных.

Результаты

Анализ с использованием клеток-репортеров Jurkat для проверки способности экспрессирующих гуманизированный EGFRvIII-специфический CAR Т-клеток распознавать экспрессирующие EGFRvIII клетки-мишени.

Способность CART-клеточных структур к индукции активации после связи с мишенью определяли с использованием линии клеток-репортеров JNL. Линия клеток JNL была создана с использованием репортерной конструкции NFAT-люцифераза, которая индуцируется после связи с CAR. Клетки JNL трансдуцировали различными CAR-EGFRvIII-конструкциями (CAR9, CAR3, CAR6, CAR8 и CAR10). Эффективность трансдукции оценивали с помощью проточной цитометрии, и она, как было установлено, составляет приблизительно 45-52% для всех конструкций. Клетки JNL-CAR-EGFRvIII затем стимулировали с использованием семи различных соотношений Е:Т, используя три различных линии клеток-мишеней (родительские клетки ВНК, ВНК-EGFRvIII или ВНК-EGFR WT). Родительские клетки JNL и клетки JNL, экспрессирующие контрольный CAR, были включены в качестве дополнительных контролей. Результаты, представленные на фиг. 14, показывают, что значительная мишень-индуцированная активация может произойти уже при соотношениях 1:0,01 в случае всех проверенных конструкций, и CAR6 и CAR10 вызывают наибольшую активацию при более высоких соотношениях E:T. Никакой значительной активации не отмечалось в случае экспрессирующих EGFR дикого типа клеток или с помощью экспрессирующих контрольный CAR клеток JNL. Эти данные демонстрируют специфичность CAR-конструкций в отношении мишени EGFRvIII и отсутствие перекрестной реактивности с мишенью в виде EGFR дикого типа.

Трансдукция первичных T-клеток человека конструкциями гуманизированных EGFRvIII-специфических CAR и их размножение

CD3+ Т-клетки были получены из продуктов афереза или цельной крови от здоровых доноров. Как описано выше, Т-клетки стимулировали покрытыми антителом против CD3×CD28 сферами в течение 24 часов, а затем трансдуцировали, используя сконцентрированные супернатанты, содержащие лентивирусы, с множественность заражения = 3. Клетки размножали в культуре в течение 8-10 дней.

Представленности на клеточной поверхности гуманизированных EGFRvIII-специфических CAR являются сопоставимыми, и их уровни экспрессии очень схожи с таковыми мышиного CAR9. Наложение гистограмм, на которых представлен характер окрашивания на представленность на поверхности клеток - трандуцированных каждым из гуманизированных EGFRvIII-специфических CAR Т-клеток и средняя интенсивность флуоресценции (MFI), рассчитанная, исходя из этих профилей, хорошо коррелирует с процентом трансдуцированных клеток.

Анализ пролиферации для проверки способности экспрессирующих EGFRvIII клеток-мишеней к стимуляции экспрессирующих гуманизированный, EGFRvIII-специфический CAR Т-клеток.

Способность экспрессирующих EGFRvIII-специфический CAR Т-клеток к пролиферации в ответ на связь с мишенью оценивали в анализе на пролиферацию. Субпопуляции были подсчитаны с помощью проточной цитометрии. Донорские Т-клетки трансдуцировали или гуманизированными CAR, мышиным CAR9, или SS1 (мишенью которого является мезотелин). CAR смешивали в соотношении 1:1 или 1:0 с клетками-мишенями и сокультивировали в течение 5 дней. На фиг. 15 продемонстрирована способность ND407 EGFRvIII-CAR-Т-клеток к пролиферации антигенспецифическим образом. Столбик с пунктирной линией указывает на количество посеянных Т-клеток, и сравнительно, увеличение количества Т-клеток не было обнаружено при связи с U87, в то время как связь с U87-EGFRvIII индуцировала пролиферацию, которая была специфической в отношении популяции экспрессирующих EGFRvIII-специфический CAR Т-клеток. Относительный ответ на ND407 указывал на то, что CAR6 и CAR8 являются более функциональными, чем CAR9 или CAR3. Результат, полученный с использованием покрытых Ат против CD3×28 сфер, указывает на то, что их стимуляция не была достаточной, чтобы стимулировать пролиферацию во второй цикле активации, аналогично отсутствию стимуляции вообще.

ND407 Т-клетки были использованы для скрининга различных huEGFRvIII-специфических CAR на их способность к размножению преимущественно CAR+ Т-клеток. На фиг. 16 показано, что CAR5 и CAR6 последовательно обладают самой большой способностью к размножению CAR+ Т-клеток у каждого донора. Увеличение CAR+ Т-клеток является результатом успешной связи с мишенью, пролиферации и пережития индуцированной активацией гибели клеток из-за распознавания антигена.

Анализ уничтожения для проверки способности экспрессирующих гуманизированный EGFRvIII-специфический CAR Т-клеток к уничтожению экспрессирующих EGFRvIII клеток-мишеней

Способность экспрессирующих EGFRvIII-специфический CAR Т-клеток к уничтожению мишеней проверяли в анализе высвобождения хрома. Была создана линия клеток глиобластомы человек, U-87MG, которая экспрессирует или рецептор EGFR дикого типа, или мутант EGFRvIII. Эти созданные линии клеток служили в качестве мишеней в случае анализа уничтожения. Три эффекторные CAR-Т-клетки использовали для определения специфичности уничтожения клеток-мишеней: 1) Т-клетки человека, трансдуцированные для экспрессии 3C10 мыши (CAR9), 2) Т-клетки человека, трансдуцированные для экспрессии гуманизированного варианта 3C10 мыши, названного CAR6, и 3) Т-клетки человека, трансдуцированные CAR, специфическим для мезотелина, SS1. Все эффекторные клетки были приведены к представлению 30% CAR+ трансдукции. Клетки-мишени метили хромом-51 и промывали непосредственно перед сокультивированием. Эффекторы и мишени смешивали вместе в указанных соотношениях (Е:Т) и допускали инкубацию в течение 4 часов.

Результаты, представленные на фиг. 17(А), показывает, что CAR-Т-клетки, смешанные с клетками U-87, экспрессирующими рецептор EGFR дикого типа, продемонстрировали отсутствие уничтожения клеток выше фона до Е:Т=50: 1. Однако результаты, представленные на фиг. 17(В), показывают, что в отличие от этого экспрессирующие EGFRvIII-специфический CAR Т-клетки, CAR9 или CAR6, смешанные с клетками U-87, экспрессирующими EGFRvIII, продемонстрировали специфическое уничтожение при соотношениях Е:Т от 6,25:1 до 50: 1. Не наблюдалось значительное уничтожение, когда экспрессирующие специфический для мезотелина CAR Т-клетки использовали в качестве эффекторов. Эти данные показывают специфическое в отношении мишени уничтожение клеток-мишеней, экспрессирующих EGFRvIII, Т-клетками, экспрессирующими CAR9 и CAR6, но отсутствие уничтожения клеток, экспрессирующих EGFR дикого типа, или экспрессирующей неспецифический CAR T-клеткой, SSI.

Анализ цитокинов для проверки способности экспрессирующих гуманизированный EGFRvIII-специфический CAR T-клеток к содействию противоопухолевому ответу и демонстрации специфичности

Способность экспрессирующих EGFRvIII-специфический CAR T-клеток к индукции цитокина в ответ на связь с мишенью оценивали в анализе сокультивирования. CAR-Т-клетки сокультивировали с экспрессирующими мишень клетками в течение 18-24 ч при различных соотношениях мишень:эффектор (0,3:1, 1:1, 3:1 и 10:1). Клетки-мишени включали клетки U87, экспрессирующие эндогенный белок EGFR дикого типа (U87), клетки U87, сверхэкспрессирующие EGFRvIII (U87-VIII), родительские клетки ВНК (клетки почки детеныша хомяка), клетки ВНК, сверхэкспрессирующие белок человека EGFR дикого типа (ВНК wt), или клетки ВНК, сверхэкспрессирующие белок человека EGFRvIII (ВНК-VIII). Спустя 18-24 часов супернатанты удаляли из культур, и цитокины анализировали, используя Cytometric Bead Assay (CBA). Результаты ясно показали, что 1) CAR6 и CAR9 Т-клетки индуцировали схожие уровни IFNγ в ответ на EGFRvIII-экспрессирующие клетки, и 2) что ни та, ни другая популяция CAR-Т-клеток не индуцировала IFNγ в ответ на экспрессирующие EGFR дикого типа клетки. Важно отметить, что эти данные вместе с данными, касающимися уничтожения и пролиферации, указывают на то, что CAR6 и CAR9 демонстрируют функциональную специфичность в отношении EGFRvIII и обладают способностью к содействию противоопухолевому иммунному ответу.

Пример 9: Экспрессирующие CAR на основе гуманизированного антитела против EGFRvIII Т-клетки уменьшают массу опухоли у мышей

Было установлено, что экспрессирующие CAR на основе гуманизированного антитела против EGFRvIII Т-клетки уменьшают массу опухоли in vivo у мышей. Например, трансдуцированные лентивирусным вектором, кодирующим #2173 (CAR6) - химерный антигенспецифический рецептор (CAR) на основе гуманизированного антитела против EGFRvIII, Т-лимфоциты человека доставляли внутривенно ксеногенным, с ослабленным иммунитетом NOD/SCID/common-gamma chain-/- мышам, получившим установившиеся опухоли глиомы U87vIII in vivo. В случае контрольных мышей с установившимися к дню 5 подкожными боковыми опухолями U87vIII, получающих подобранные в соответствии с донором Т-клетки, трансдуцированные не CAR, опухоли росли быстро, и в соответствии с прямым измерением подкожной опухоли, используя циркуль (максимальная ширина × максимальную длина), и в соответствии с эмиссией фотонов, измеряемой с помощью Spectrum в in vivo системе визуализации (IVIS). В случае подвергнутых лечению мышей, получающих даже небольшое количество (0,5-1×106) CAR6-трансдуцированных клеток, рост опухоли был заметно сниженным у мышей в зависимости от дозы.

В этом примере 1×106 клеток глиомы U87vIII человека, экспрессирующих EGFRvIII, GFP+Luc+ промывали и вводили подкожно в 100 мкл физиологического раствора в бока 30 мышей с ослабленным иммунитетом NSG (N=10/группа). Т-клетки человека стимулировали, используя покрытые антителом против CD3/28 сферы, и трансдуцировали с использованием лентивирусного вектора гуманизированным scFv #2173 против EGFRvIII CAR (CAR6). После трансдукции, ex vivo размножения и удаление сфер, CAR-трансдуцированные Т-клетки (~50% CAR+ в соответствии с проточной цитометрией) промывали и вводили в 100 мкл физиологического раствора в хвостовую вену через 5 дней после имплантации опухоли. Рост опухоли оценивали путем измерения с помощью циркуля (вверху слева) и люциферин-индуцированной эмиссии фотонов (справа вверху). Измерения начинали через 7 дней после переноса Т-клеток и через 12 дней после инъекции опухоли. SEM (сканирующая электронная микроскопия) представлена на фиг. 18 (N=10 мышей/группу). Выживание каждой группы наносили на график - кривые Каплана Мейера на фиг. 18 (ниже). Все мыши, получающие контрольные Т-клетки, умерли к дню 26, при этом выживаемость для группы, получающей 0,5×106 и 1,0×106 CAR6 Т-клеток, составляла 30% и 90%, соответственно, на дату - экспериментальный день 30.

ЭКВИВАЛЕНТЫ

Описания каждого и любого патента, заявки на патент и публикации, приведенного(ой) здесь, таким образом включены сюда посредством ссылки в их полном объеме. Хотя это изобретение было описано со ссылкой на конкретные аспекты, очевидно, что другие аспекты и вариации этого изобретения могут быть разработаны квалифицированными в данной области техники специалистами без отступа от фактического существа и объема настоящего изобретения. Прилагаемая формула изобретения, как предполагается, включает все такие варианты осуществления и эквивалентные вариации.

1. Выделенная молекула нуклеиновой кислоты, кодирующая химерный антигенспецифический рецептор (CAR), где указанный CAR включает связывающий домен против EGFRvIII, трансмембранный домен и внутриклеточный домен сигнализации, включающий домен первичной сигнализации, костимулирующий домен или домен первичной сигнализации и костимулирующий домен, и

где указанный связывающий домен против EGFRvIII включает аминокислотную последовательность, имеющую не более 30 аминокислотных модификаций вариабельной области легкой цепи и вариабельной области тяжелой цепи SEQ ID NO: 68, и где вариабельная область легкой цепи содержит:

(a) определяющий комплементарность участок 1 легкой цепи (CDR1 LC), содержащий последовательность SEQ ID NO: 26;

(b) определяющий комплементарность участок 2 легкой цепи (CDR2 LC), содержащий последовательность SEQ ID NO: 27; и

(c) определяющий комплементарность участок 3 легкой цепи (CDR3 LC), содержащий последовательность SEQ ID NO: 28;

и вариабельная область тяжелой цепи содержит:

(a) определяющий комплементарность участок 1 тяжелой цепи (CDR1 НС), содержащий последовательность SEQ ID NO: 22;

(b) определяющий комплементарность участок 2 тяжелой цепи (CDR2 НС), содержащий последовательность SEQ ID NO: 23; и

(c) определяющий комплементарность участок 3 тяжелой цепи (CDR3 НС), содержащий последовательность SEQ ID NO: 24,

где указанные аминокислотные модификации: (i) находятся в каркасной области указанного связывающего домена против EGFRvIII, и (ii) представляют собой точечные мутации.

2. Выделенная молекула нуклеиновой кислоты по п.1, где кодируемый связывающий домен против EGFRvIII содержит:

(a) вариабельную область легкой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области легкой цепи SEQ ID NO:68; и

(b) вариабельную область тяжелой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области тяжелой цепи SEQ ID NO:68.

3. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, где кодируемый связывающий домен против EGFRvIII представляет собой scFv.

4. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности SEQ ID NO:68.

5. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность с 95-99%-идентичностью аминокислотной последовательности SEQ ID NO:68.

6. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность SEQ ID NO:68.

7. Выделенная молекула нуклеиновой кислоты по любому из пп.1-3, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность SEQ ID NO:50.

8. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, где последовательность нуклеиновой кислоты, кодирующая связывающий домен против EGFRvIII, включает последовательность SEQ ID NO: 51 или SEQ ID NO: 69 или последовательность, идентичную ей на 95-99%.

9. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность SEQ ID NO:69 или последовательность, идентичную ей на 95-99%.

10. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, причем кодируемый CAR включает трансмембранный домен, который включает трансмембранный домен белка, выбираемого из группы, состоящей из альфа-, бета- или дзета-цепи T-клеточного рецептора, CD28, CD3 эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154.

11. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, причем кодируемый трансмембранный домен включает последовательность SEQ ID NO: 15.

12. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, причем кодируемый трансмембранный домен включает аминокислотную последовательность, имеющую по крайней мере одну, два или три модификации, но не более 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 15, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 15.

13. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, причем последовательность нуклеиновой кислоты, кодирующая трансмембранный домен, включает последовательность SEQ ID NO: 8 или последовательность, идентичную ей на 95-99%.

14. Выделенная молекула нуклеиновой кислоты по любому из предыдущих пунктов, причем кодируемый связывающий домен антитела против EGFRvIII соединен с трансмембранным доменом с помощью шарнирной области.

15. Выделенная молекула нуклеиновой кислоты по п.14, причем кодируемая шарнирная область включает SEQ ID NO: 14 или последовательность, идентичную ей на 95-99%.

16. Выделенная молекула нуклеиновой кислоты по п.14, причем последовательность нуклеиновой кислоты, кодирующая шарнирную область, включает последовательность SEQ ID NO: 7 или последовательность, идентичную ей на 95-99%.

17. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7, где указанный внутриклеточный домен сигнализации включает последовательность, кодирующую костимулирующий домен.

18. Выделенная молекула нуклеиновой кислоты по п.17, причем кодируемый костимулирующий домен включает функциональный домен сигнализации белка, выбираемого из группы, состоящей из OX40, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11а/CD18), ICOS (CD278) и 4-1ВВ (CD137).

19. Выделенная молекула нуклеиновой кислоты по п.17, причем кодируемый костимулирующий домен включает последовательность SEQ ID NO: 16.

20. Выделенная молекула нуклеиновой кислоты по п.17, причем кодируемый костимулирующий домен включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации (например, замены), но не более 20, 10 или 5 модификаций (например, замены) аминокислотной последовательности SEQ ID NO: 16, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16.

21. Выделенная молекула нуклеиновой кислоты по п.17, причем последовательность нуклеиновой кислоты, кодирующая костимулирующий домен, включает последовательность SEQ ID NO: 9 или последовательность, идентичную ей на 95-99%.

22. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7, где указанный CAR включает последовательность, кодирующую внутриклеточный домен сигнализации.

23. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7 и 22, причем кодируемый внутриклеточный домен сигнализации включает функциональный домен сигнализации 4-1BB и/или функциональный домен сигнализации CD3 дзета.

24. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7 и 22, 23, причем кодируемый внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 и/или последовательность SEQ ID NO: 17 или SEQ ID NO: 99.

25. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7 и 22-24, причем внутриклеточный домен сигнализации включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации, но не более 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 16 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99.

26. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7 и 22-25, причем кодируемый внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 и последовательность SEQ ID NO: 17 или SEQ ID NO: 99, причем последовательности, включающие внутриклеточный домен сигнализации, экспрессируются в одной и той же рамке и в виде одной полипептидной цепи.

27. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7, причем последовательность нуклеиновой кислоты, кодирующая внутриклеточный домен сигнализации, включает последовательность SEQ ID NO: 9 или последовательность, идентичную ей на 95-99%, и/или последовательность SEQ ID NO: 10 или SEQ ID NO: 100, или последовательность, идентичную ей на 95-99%.

28. Выделенная молекула нуклеиновой кислоты по любому из пп.1-7, дополнительно включающая лидерную последовательность.

29. Выделенная молекула нуклеиновой кислоты по п.28, причем лидерная последовательность включает SEQ ID NO: 13.

30. Молекула полипептида, кодируемая молекулой нуклеиновой кислоты по любому из пп.1-7 и 9-29.

31. Молекула полипептида по п.30, включающая последовательность SEQ ID NO: 55 или SEQ ID NO: 73 или последовательность, идентичную ей на 95-99%.

32. Молекула полипептида по п.31, включающая последовательность SEQ ID NO: 73 или последовательность, идентичную ей на 95-99%.

33. Молекула полипептида по п.31, включающая последовательность SEQ ID NO: 55 или последовательность, идентичную ей на 95-99%.

34. Молекула химерного антигенспецифического рецептора (CAR), включающая связывающий домен против EGFRvIII, трансмембранный домен и внутриклеточный домен сигнализации, где указанный связывающий домен против EGFRvIII включает аминокислотную последовательность, имеющую не более 30 аминокислотных модификаций вариабельной области легкой цепи и вариабельной области тяжелой цепи SEQ ID NO: 68, и где вариабельная область легкой цепи содержит:

(a) определяющий комплементарность участок 1 легкой цепи (CDR1 LC), содержащий последовательность SEQ ID NO: 26;

(b) определяющий комплементарность участок 2 легкой цепи (CDR2 LC), содержащий последовательность SEQ ID NO: 27; и

(c) определяющий комплементарность участок 3 легкой цепи (CDR3 LC), содержащий последовательность SEQ ID NO: 28;

и вариабельная область тяжелой цепи содержит:

(a) определяющий комплементарность участок 1 тяжелой цепи (CDR1 НС), содержащий последовательность SEQ ID NO: 22;

(b) определяющий комплементарность участок 2 тяжелой цепи (CDR2 НС), содержащий последовательность SEQ ID NO: 23; и

(c) определяющий комплементарность участок 3 тяжелой цепи (CDR3 НС), содержащий последовательность SEQ ID NO: 24,

где указанные аминокислотные модификации: (i) находятся в каркасной области указанного связывающего домена против EGFRvIII, и (ii) представляют собой точечные мутации.

35. Молекула CAR по п.34, причем внутриклеточный домен сигнализации включает костимулирующий домен и/или домен первичной сигнализации.

36. Молекула CAR по п.34 или 35, причем связывающий домен антитела против EGFRvIII включает антитело или фрагмент антитела, котрое(ый) включает связывающий домен антитела против EGFRvIII.

37. Молекула CAR по любому из пп.34-36, причем связывающий домен против EGFRvIII включает:

(a) вариабельную область легкой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области легкой цепи SEQ ID NO:68; и

(b) вариабельную область тяжелой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области тяжелой цепи SEQ ID NO:68.

38. Молекула CAR по любому из пп.34-37, где связывающий домен против EGFRvIII представляет собой scFv.

39. Молекула CAR по любому из пп.34-38, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности SEQ ID NO:68.

40. Молекула CAR по любому из пп.34-38, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность с 95-99%-идентичностью аминокислотной последовательности SEQ ID NO:68.

41. Молекула CAR по любому из пп.34-38, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность SEQ ID NO:68.

42. Молекула CAR по любому из пп.34-38, где кодируемый связывающий домен против EGFRvIII содержит аминокислотную последовательность SEQ ID NO:50.

43. Молекула CAR по п.34 или 35, дополнительно включающая трансмембранный домен белка, выбираемого из группы, состоящей из альфа, бета или дзета-цепи T-клеточного рецептора, CD28, CD3 эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD-134, CD-137 и CD154.

44. Молекула CAR по п.43, причем трансмембранный домен включает последовательность SEQ ID NO: 15.

45. Выделенная молекула CAR по п.43, причем трансмембранный домен включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации, но не более 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 15, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 15.

46. Молекула CAR по п.34 или 35, причем связывающий домен антитела против EGFRvIII соединен с трансмембранным доменом с помощью шарнирной области.

47. Молекула CAR по п.46, причем кодируемая шарнирная область включает SEQ ID NO: 14 или последовательность, идентичную ей на 95-99%.

48. Молекула CAR по п.34 или 35, где указанный внутриклеточный домен сигнализации включает последовательность, кодирующую костимулирующий домен.

49. Молекула CAR по п.48, причем костимулирующий домен включает функциональный домен сигнализации белка, выбираемого из группы, состоящей из OX40, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11а/CD18), ICOS (CD278) и 4-1ВВ (CD137).

50. Молекула CAR по п.48, причем костимулирующий домен включает последовательность SEQ ID NO: 16.

51. Молекула CAR по п.48, причем костимулирующий домен включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации, но не более 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 16, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16.

52. Молекула CAR по п.34 или 35, где указанный внутриклеточный домен сигнализации включается последовательность, кодирующую функциональный домен сигнализации.

53. Молекула CAR по п.52, причем внутриклеточный домен сигнализации включает функциональный домен сигнализации 4-1BB и/или функциональной домен сигнализации CD3 дзета.

54. Молекула CAR по п.52, причем внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 и/или последовательность SEQ ID NO: 17.

55. Молекула CAR по п.52, причем внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 и/или последовательность SEQ ID NO: 99.

56. Молекула CAR по п.52, причем внутриклеточный домен сигнализации включает аминокислотную последовательность, имеющую по крайней мере одну, две или три модификации, но не более 20, 10 или 5 модификаций аминокислотной последовательности SEQ ID NO: 16 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99, или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 16 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 99.

57. Молекула CAR по п.52, причем внутриклеточный домен сигнализации включает последовательность SEQ ID NO: 16 и последовательность SEQ ID NO: 17 или SEQ ID NO: 99, причем последовательности, включающие внутриклеточный домен сигнализации, экспрессируются в одной и той же рамке и в виде одной полипептидной цепи.

58. Молекула CAR по любому из пп.34-57, дополнительно включающая лидерную последовательность.

59. Молекула CAR по п.58, причем лидерная последовательность включает аминокислотную последовательность SEQ ID NO: 13 или последовательность, идентичную на 95-99% аминокислотной последовательности SEQ ID NO: 13.

60. Связывающий домен против EGFRvIII, включающий аминокислотную последовательность, имеющую не более 30 аминокислотных модификаций вариабельной области легкой цепи и вариабельной области тяжелой цепи SEQ ID NO: 68, и где вариабельная область легкой цепи содержит:

(a) определяющий комплементарность участок 1 легкой цепи (CDR1 LC), содержащий последовательность SEQ ID NO: 26;

(b) определяющий комплементарность участок 2 легкой цепи (CDR2 LC), содержащий последовательность SEQ ID NO: 27; и

(c) определяющий комплементарность участок 3 легкой цепи (CDR3 LC), содержащий последовательность SEQ ID NO: 28;

и вариабельная область тяжелой цепи содержит:

(a) определяющий комплементарность участок 1 тяжелой цепи (CDR1 НС), содержащий последовательность SEQ ID NO: 22;

(b) определяющий комплементарность участок 2 тяжелой цепи (CDR2 НС), содержащий последовательность SEQ ID NO: 23; и

(c) определяющий комплементарность участок 3 тяжелой цепи (CDR3 НС), содержащий последовательность SEQ ID NO: 24,

где указанные аминокислотные модификации: (i) находятся в каркасной области указанного связывающего домена против EGFRvIII, и (ii) представляют собой точечные мутации.

61. Связывающий домен против EGFRvIII по п.60, включающий

(a) вариабельную область легкой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области легкой цепи SEQ ID NO:68; и

(b) вариабельную область тяжелой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области тяжелой цепи SEQ ID NO:68.

62. Связывающий домен против EGFRvIII по п.60 или 61, содержащий аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации, но не более чем 30, 20 или 10 модификаций аминокислотной последовательности SEQ ID NO:68.

63. Связывающий домен против EGFRvIII по п.60 или 61, содержащий аминокислотную последовательность с 95-99%-идентичностью аминокислотной последовательности SEQ ID NO:68.

64. Связывающий домен против EGFRvIII по любому из пп.60, 61 и 63, содержащий аминокислотную последовательность SEQ ID NO:68.

65. Связывающий домен против EGFRvIII по п.60, содержащий аминокислотную последовательность SEQ ID NO:50.

66. Выделенная молекула нуклеиновой кислоты, кодирующая связывающий домен против EGFRvIII, где указанный кодируемый связывающий домен против EGFRvIII включает аминокислотную последовательность, имеющую не более 30 аминокислотных модификаций вариабельной области легкой цепи и вариабельной области тяжелой цепи SEQ ID NO: 68, и где вариабельная область легкой цепи содержит:

(a) определяющий комплементарность участок 1 легкой цепи (CDR1 LC), содержащий последовательность SEQ ID NO: 26;

(b) определяющий комплементарность участок 2 легкой цепи (CDR2 LC), содержащий последовательность SEQ ID NO: 27; и

(c) определяющий комплементарность участок 3 легкой цепи (CDR3 LC), содержащий последовательность SEQ ID NO: 28;

и вариабельная область тяжелой цепи содержит:

(a) определяющий комплементарность участок 1 тяжелой цепи (CDR1 НС), содержащий последовательность SEQ ID NO: 22;

(b) определяющий комплементарность участок 2 тяжелой цепи (CDR2 НС), содержащий последовательность SEQ ID NO: 23; и

(c) определяющий комплементарность участок 3 тяжелой цепи (CDR3 НС), содержащий последовательность SEQ ID NO: 24,

где указанные аминокислотные модификации: (i) находятся в каркасной области указанного связывающего домена против EGFRvIII, и (ii) представляют собой точечные мутации.

67. Выделенная молекула нуклеиновой кислоты по п.66, где указанный кодируемый связывающий домен против EGFRvIII включает

(a) вариабельную область легкой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области легкой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области легкой цепи SEQ ID NO:68; и

(b) вариабельную область тяжелой цепи, содержащую:

(i) последовательность с не более чем 20 или 10 модификациями аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68;

(ii) последовательность с 95-99%-идентичностью аминокислотной последовательности вариабельной области тяжелой цепи SEQ ID NO:68; или

(iii) аминокислотную последовательность вариабельной области тяжелой цепи SEQ ID NO:68.

68. Экспрессионный вектор, включающий молекулу нуклеиновой кислоты, кодирующую CAR по любому из пп.30-59.

69. Вектор по п.68, причем вектор выбирают из группы, состоящей из ДНК, РНК, плазмиды, лентивирусного вектора, аденовирусного вектора или ретровирусного вектора.

70. Вектор по п.68 или 69, дополнительно включающий промотор.

71. Вектор по п.70, причем промотором является промотор EF-1.

72. Вектор по п.71, причем промотор EF-1 включает последовательность SEQ ID NO: 97.

73. Вектор по п.68 или 69, причем вектором является in vitro транскрибируемый вектор.

74. Вектор по п.68 или 69, причем последовательность нуклеиновой кислоты в векторе дополнительно включает поли(А) хвост.

75. Вектор по п.68 или 69, причем последовательность нуклеиновой кислоты в векторе дополнительно включает 3' UTR.

76. Клетка для экспрессии CAR по любому из пп.30-59, включающая вектор по любому из пп.68-75.

77. Клетка по п.76, причем клетка представляет собой Т-клетку.

78. Клетка по п.77, причем Т-клеткой является CD8+ Т-клетка.

79. Клетка по п.76 или 77, причем клеткой является клетка человека.

80. Способ создания клетки, включающий трансдукцию Т-клетки вектором по любому из пп.68-75.

81. Способ получения популяции созданных с использованием РНК клеток, включающий введение in vitro транскрибированной РНК или синтетической РНК в клетку, причем РНК включает нуклеиновую кислоту, кодирующую молекулу CAR по любому из пп.30-59.

82. Способ обеспечения иммунитета к опухоли у млекопитающего, имеющего заболевание, ассоциированное с экспрессией EGFRvIII, включающий введение млекопитающему эффективного количества популяции Т-клеток, экспрессирующих молекулу CAR по любому из пп.34-59, где указанная популяция Т-клеток содержит CD8+ Т-клетки.

83. Способ лечения млекопитающего, имеющего заболевание, связанное с экспрессией EGFRvIII, включающий введение млекопитающему эффективного количества популяции Т-клеток, экспрессирующих молекулу CAR по любому из пп.30-59, где указанная популяция Т-клеток содержит CD8+ Т-клетки.

84. Способ по п.82 или 83, где Т-клетки представляют собой аутологичные Т-клетки или аллогенные Т-клетки.

85. Способ по любому из пп.82-84, где Т-клетки представляют собой CD8+ Т-клетки.

86. Способ по п.82 или 83, где указанное млекопитающее представляет собой человека.

87. Способ по п.83, причем заболеванием, связанным с EGFRvIII, является глиобластома.

88. Способ по п.83 или 87, причем заболеванием, связанным с EGFRvIII, является рак, выбираемый из группы, состоящей из мультиформной глиобластомы (GBM), анапластической астроцитомы, гигантоклеточной глиобластомы, глиосаркомы, анапластической олигодендроглиомы, анапластической эпендимомы, карциномы сосудистого сплетения, анапластической ганглиоглиомы, пинеобластомы, медуллоэпителиомы, эпендимобластомы, медуллобластомы, супратенториальной примитивной нейроэктодермальной опухоли, атипичной тератоидной/рабдоидной опухоли, рака легкого (например, немелкоклеточного рака легких), рака молочной железы, предстательной железы, яичников, колоректального рака и рака мочевого пузыря и любой их комбинации, и метастазов любого из раков.

89. Способ по любому из пп.83-88, причем клетки, экспрессирующие молекулу CAR, вводят в комбинации с агентом, который увеличивает эффективность клетки, экспрессирующей молекулу CAR.

90. Способ по любому из пп.83-88, причем клетки, экспрессирующие молекулу CAR, вводят в комбинации с агентом, который уменьшает интенсивность одного или более побочных эффектов, связанных с введением клетки, экспрессирующей молекулу CAR.

91. Способ по любому из пп.83-90, причем клетки, экспрессирующие молекулу CAR, вводят в комбинации с агентом, который лечит заболевание, связанное с EGFRvIII.

92. Применение молекулы нуклеиновой кислоты по п.1 в производстве лекарственного средства для терапии с использованием CAR.

93. Применение Т-клетки, содержащей молекулу нуклеиновой кислоты по п.1, в качестве лекарственного средства для терапии с использованием CAR.

94. Применение молекулы полипептида по п.30 в производстве лекарственного средства для терапии с использованием CAR.

95. Применение Т-клетки, содержащей молекулу полипептида по п.30, в качестве лекарственного средства для терапии с использованием CAR.

96. Применение CAR по п.34 в производстве лекарственного средства для терапии с использованием CAR.

97. Применение Т-клетки, содержащей CAR по п.34, в качестве лекарственного средства для терапии с использованием CAR.

98. Применение связывающего домена антитела против EGFRvIII по п.60 в производстве лекарственного средства для терапии с использованием CAR.

99. Применение Т-клетки, содержащей CAR, содержащий связывающий домен антитела против EGFRvIII по п.60, в качестве лекарственного средства для терапии с использованием CAR.

100. Применение вектора по п.68 в производстве лекарственного средства для терапии с использованием CAR.

101. Применение Т-клетки по п.77 в производстве лекарственного средства для терапии с использованием CAR.

102. Применение по любому из пп.92-101, где терапия с использованием CAR представляет собой лечение заболевания, связанного с экспрессией EGFRvIII.

103. Применение Т-клетки по п.77 в качестве лекарственного средства для лечения заболевания, связанного с экспрессией EGFRvIII.



 

Похожие патенты:

Изобретение относится к области биохимии, в частности к молекуле нуклеиновой кислоты для детектирования объекта кукурузы DBN9936 с SEQ ID NO: 1. Также раскрыты набор для детектирования, клетка растения и часть растения, содержащие указанную последовательность; сельскохозяйственная композиция, сельскохозяйственный продукт и сельскохозяйственный товар.

Настоящее изобретение относится к области иммунологии. Предложены выделенное антитело к RGMa и его антигенсвязывающий фрагмент.

Изобретение относится к области биохимии, в частности к генетически модифицированной клетке-хозяину млекопитающего, которая содержит первую нуклеиновую кислоту, кодирующую экзогенную фукозидазу, и вторую нуклеиновую кислоту, кодирующую эндогликозидазу, а также способ ее получения.

Изобретение относится к иммунологии. Предложено неконкурентное в отношении нейрегулина (NRG) аллостерическое антитело против человеческого HER3 и его фрагмент, а также кодирующая нуклеиновая кислота, вектор, клетка-хозяин, фармацевтическая композиция и способ лечения рака.

Изобретение относится к области биотехнологии, конкретно к иммуногенным эпитопам URLC10, и может быть использовано в медицине для лечения пациента, страдающего раком.

Изобретение относится к области биотехнологии. Представлена нуклеиновая кислота, кодирующая химерный рецептор, специфично связывающийся с CD19.

Изобретение относится к области биохимии. Описана группа изобретений, включающая гуманизированное моноклональное антитело или его антиген-связывающий фрагмент, которое связывается со специфичностью с антигеном Томсена-Фриденрайха (TF-Ag), конъюгат, связывающийся с раковыми клетками, которые экспрессируют TF-Ag, способ профилактики или лечения рака у индивидуума, при этом рак содержит раковые клетки, экспрессирующие TF-Ag, фармацевтическая композиция для лечения TF+ видов рака, содержащая вышеуказанное антитело или его антиген-связывающий фрагмент в терапевтически эффективном количестве, клетку-хозяин млекопитающего, предназначенную для экспрессии вышеуказанного антитела или его антиген-связывающего фрагмента.

Изобретение относится к эпитопным пептидам, полученным из CDCA1, со способностью индуцировать цитотоксические T-клетки. Настоящее изобретение дополнительно относится к полинуклеотидам, кодирующим пептиды, антигенпрезентирующим клеткам, презентирующим пептиды, и цитотоксическим T-клеткам, нацеленным на пептиды, а также к способам индуцирования антигенпрезентирующих клеток или ЦТЛ.

Изобретение относится к эпитопным пептидам, полученным из KOC1, со способностью индуцировать цитотоксические T-клетки. Настоящее изобретение дополнительно относится к полинуклеотидам, кодирующим пептиды, антигенпрезентирующим клеткам, презентирующим пептиды, и цитотоксическим T-клеткам, нацеленным на пептиды, а также к способам индуцирования антигенпрезентирующих клеток или ЦТЛ.

Изобретение относится к области биотехнологии и может быть использовано в терапии онкологических заболеваний. Описан универсальный вспомогательный плазмидный экспрессионный лентивирусный вектор для получения высоких титров вирусных частиц, содержащих ген Vpx, включающий в качестве базовых элементов, обеспечивающих функционирование вектора, последовательность вирион-ассоциированного белка Vpx, содержащую С-концевой HIV-1 gag/pol мотив и FLAG последовательность и объединенную с последовательностью гена трансактиваторного белка Rev через специфическую последовательность Т2А, обеспечивающую расщепление слитых белков во время процесса трансляции мРНК трансгена; в качестве регуляторных элементов- RSVпромотор/энхансер [rous sarcoma virus) и NES (nuclear export signal)- сигнал экспорта из ядра в цитоплазму.

Изобретение относится к биотехнологии, а именно к нерегламентирорванному замораживанию клеток-предшественников периферической крови. Способ включает приготовление раствора криоконсерванта, для чего берут раствор Dimethylsulfoxide («Sigma-Aldrich», France) высокой степени очистки (≥99,99%) с ПП 0,200-0,220, в условиях гипотермии добавляют его в раствор для инфузий из натрия хлорида 2,25 г и воды для инъекций до 250 мл в пластиковом контейнере до получения концентрации DMSO 10% и производят смешивание его с концентратом аферезных клеток-предшественников периферической крови в равных пропорциях, замораживание от плюс 17÷ плюс 25°С до минус 80°С в режиме трехступенчатой программы в электрических рефрижераторах с установленной контрольной температурой изотермической холодовой адаптации на каждом этапе замораживания.

Изобретение относится к области биотехнологии. Данный способ витрификации ооцитов млекопитающих может быть успешно применён к сельскохозяйственным животным, в частности для крупного рогатого скота (КРС).

Изобретение относится к медицине, а именно к способу обнаружения циркулирующей опухолевой клетки и/или циркулирующей опухолевой стволовой клетки из биологической циркулирующей жидкости организма.

Изобретение относится к области биотехнологии, а именно к получению популяции человеческих индуцированных плюрипотентных стволовых клеток (hiPSC), поддержанию hiPSC, модификации целевого геномного локуса в hiPSC и композиции для культивирования и поддержания hiPSC.

Изобретение относится к области биотехнологии, а именно к клеточному сфероиду, его получению и оценке эффекта воздействия на функциональную активность меланоцитов.

Изобретение относится к области биотехнологии, а именно к получению одногормональных инсулинположительных клеток. Способ, за исключением способа, в котором клетки поджелудочной железы передней кишки и клетки энтодермы поджелудочной железы получены с использованием человеческих эмбрионов, включает дифференцировку клеток поджелудочной железы передней кишки, экспрессирующих PDX-1 и NKX6.1, в клетки энтодермы поджелудочной железы путем обработки клеток поджелудочной железы передней кишки, экспрессирующих PDX-1 и NKX6.1, ингибитором shh, низкой дозой ретиноевой кислоты и аскорбиновой кислотой.
Изобретение относится к области биотехнологии, а именно к обратимому ингибированию в опухолевых клетках гепатоцеллюлярной карциномы экспрессии гена, кодирующего синтез аполипопротеина В.

Изобретение относится к области биотехнологии. Предложена композиция для активации роста дифференцированных эндотелиальных клеток роговицы, содержащая эффективное количество, по меньшей мере, одного из ламинина 511, и/или ламинина 521, и/или его функционального фрагмента Е8, которые экспрессируются в эндотелиальных клетках роговицы.

Изобретение относится к области биотехнологии, а именно к бессывороточной питательной среде, и включает основной компонентный состав питательной среды Игла MEM, а также дополнительно содержит микроэлементы (соли кадмия, кобальта, цинка, никеля, селена, молибдена) в концентрации 0,00001-4,0 г/л, пируват натрия в концентрации 0,04-4,0 г/л, витамины B12 и Е в концентрации 0,0001-0,1 г/л, олеиновую кислоту в концентрации 0,000005-0,5 г/л, цистеин, глютатион, пролин, аланин, аспарагин, аспарагиновую кислоту в концентрации 0,001-1,5 г/л, (всего 45 компонентов), рекомбинантный инсулин человека в концентрации 0,000025-0,025 г/л, а также увеличена концентрация лейцина, фенилаланина, триптофана, лизина до 0,035-0,072 г/л.

Изобретение относится к области биотехнологии. Изобретение представляет собой способ выявления генома возбудителя бруцеллезной инфекции (Brucella spp.) у сельскохозяйственных животных, включающий выделение ДНК из биологического материала от инфицированных животных сорбционным методом, постановку одноэтапной полимеразной цепной реакции - с одновременным проведением циклов амплификации с детекцией в реальном времени с использованием специфичных для участка генома (Brucella spp.) олигонуклеотидных праймеров, зондов, красителей и контрольных образцов в виде внутреннего и положительного, измерение специфического сигнала и сигнала контроля по каналам соответствующих красителей и интерпретацию результатов, где проводят флуоресцентную детекцию, измеряют по каналу JOE(HEX)/Yellow накопление флуоресцентного сигнала для специфического сигнала тестирования наличия генома возбудителя бруцеллезной инфекции (Brucella spp.), а по каналу FAM/Green - сигнал внутреннего контрольного образца, если кривые накопления флуоресцентного сигнала выходят до 35 цикла, то результат реакции считается положительным, а если кривые не пересекают пороговую линию или пересекают ее после 35 цикла, то результат реакции - отрицательный, а интерпретацию результатов проводят на основании наличия/отсутствия пересечения кривой флуоресценции с пороговой линией, при этом для внутреннего контрольного образца используют суспензию бактериофага Т4 с концентрацией 5×103 копий нуклеотидных последовательностей на 1 мкл, а для положительного контрольного образца используют смесь рекомбинантных плазмидных ДНК, содержащих фрагмент генома ДНК Brucella spp.

Изобретение относится к области биотехнологии, конкретно к способу отбора стабильной продуцирующей антитело под контролем промотора CMV человека с SEQ ID NO: 1 клетки яичника китайского хомячка СНО-К1.

Настоящее изобретение относится к иммунологии. Предложен связывающий домен против EGFRvIII, содержащий его химерный антигенный рецептор, кодирующие нуклеиновые кислоты, вектор, клетка, а также применения указанных изобретений в производстве лекарственного средства, способы создания клетки и получения популяции клеток, способ обеспечения иммунитета, способ лечения. Данное изобретение может найти дальнейшее применение в терапии с использованием адоптивного переноса клеток. 22 н. и 81 з.п. ф-лы, 18 ил., 9 пр., 2 табл.

Наверх