Новые способы опосредованного ферментами конъюгирования полипептидов с использованием сортазы

Изобретение относится к области биотехнологии. Предложен способ получения продукта ферментативного конъюгирования двух полипептидов. Осуществляют инкубирование первого полипептида, содержащего аминокислотную последовательность LPXTG (где Х может быть любым аминокислотным остатком), второго полипептида, который имеет на его конце олигоаланиновую аминокислотную последовательность Am (где m равен 3 или 4), и третьего полипептида с сортазной активностью, полученного из сортазы А Staphylococcus aureus. Затем выделяют конъюгат из реакционной смеси. Изобретение обеспечивает подавление обратной реакции или гидролиза образовавшегося продукта. 4 з.п. ф-лы, 4 ил., 1 табл., 5 пр.

 

В данном документе описан улучшенный способ ферментативного конъюгирования двух соединений посредством пептидной связи.

ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИ

Сортаза А (SrtA) представляет собой мембраносвязанный фермент, который ковалентно присоединяет белки к бактериальной клеточной стенке. Специфичным мотивом распознавания на субстрате SrtA является LPXTG, при этом фермент осуществляет расщепление между аминокислотными остатками треонина и глицина. Мотивом распознавания на пептидогликане является пентаглициновый мотив. Было показано, что триглициновый и даже диглициновый мотив на N-конце является достаточным для поддержки реакции SrtA (Clancy, K.W., et al., Peptide science 94 (2010) 385-396). Реакция идет через тиоэфирное промежуточное соединение ацил-фермент, которое распадается посредством атаки аминного нуклеофила из олигоглицина, ковалентно связывая пептидогликан с белковым субстратом и регенерируя SrtA. SrtA можно использовать для ковалентного конъюгирования химически синтезированных пептидов с рекомбинантно экспрессированными белками.

В WO 2010087994 описываются способы лигирования и их применения. Рекомбинантные подходы для IgG-подобных биспецифичных антител описываются Marvin, J.S., et al. (Acta Pharmacol. Sinica 26 (2005) 649-658). Levary, D.A., et al. (PLoS one, 6 (2011) e18342.1-e18342.6) описывают слияние белок-белок, катализируемое сортазой А. В WO 2013/003555 описывается применение сортаз для вставки ручек клик-химии для лигирования белков.

Strijbis, K. et al (Traffic 13 (2012) 780-789) описывают лигирование белков в живых клетках с использованием сортазы. Данные авторы утверждали, что Са2+-зависимая сортаза А S. aureus не является функциональной внутриклеточно, но что Са2+-независимая сортаза А S. pyogenes является функциональной в цитозоле и полости эндоплазматического ретикулума (ЭР) и Saccharomyces cerevisiae, и клеток HEK293T млекопитающих.

Levary, D.A., et al. описывают слияние белок-белок, катализируемое сортазой А (PLOS ONE 6 (2011)). Генетическая модификация антитела против рецептора эпидермального фактора роста до одноцепочечного формата и мечение опосредованным сортазой А лигированием белка описывается Madej, M.P., et al. (Biotechnol. Bioeng. 109 (2012) 1461-1470). Ta, H.T., et al. описывают ферментативное мечение одноцепочечного антитела в качестве универсального подхода для таргетной молекулярной визуализации и хоуминга клеток при сердечно-сосудистых заболеваниях (Cir. Res. 109 (2011) 365-373). Popp, M., et al. описывают инженерию белка на основе образования и разрушения пептидных связей с использованием сортазы (Angew. Chem. Int. Ed. Eng. 50 (2011) 5024-5032). В WO 2010/087994 описываются способы лигирования и их применения. Полученные посредством инженерии белки с высокой аффинностью в отношении хелатов DOTA (1,4,7,10-тетраазациклододекан-1,4,7,10-тетрауксусная кислота) описываются в WO 2010/099536.

Усеченную SrtA, у которой отсутствует N-концевой заякоривающий в мембране мотив, использовали для мечения белка поверхности клетки, ковалентной иммобилизации белка и включения новых функциональных групп в белки. Однако выходы лигирования, опосредованного SrtA, всегда ниже, чем 70% при использовании эквимолярных количеств субстратов, так как реакция является обратимой. Другим недостатком является гидролиз промежуточного соединения реакции, который приводит к продукту LPXT, который не является намеченным продуктом. Это особенно проблематично при длительных периодах инкубации с SrtA. Это, однако, означает то, что даже маленькие количества SrtA, оставшейся в конечном продукте, могут разрушать его с течением времени; это является большой проблемой для биологических препаратов, где стандарты качества являются очень высокими.

Были описаны разные попытки блокировать обратные реакции сортазы. Yamamura, Y., et al. (Chem. Commun. 47 (2011) 4742-4744) описали усиление опосредованного сортазой А лигирования белка посредством индукции структуры бета-шпильки около сайта лигирования посредством введения β-шпильки у сайта распознавания субстрата.

Сортировка пептидов LPXTG архетипической сортазой А, роль неизменных остатков субстрата в модулировании динамики фермента и конформационной сигнатуры образующегося в качестве продукта субстрата были описаны Biswas, T., et al. (Biochem. 53 (2014) 2515-2524).

Li, Y.M., et al. описывают необратимый сайт-специфичный гидразинолиз белков посредством применения сортазы (Angew. Chem. Int. Ed. Engl. 53 (2014) 2198-2202).

В WO 2014/001324 описан способ отбора и получения высокоселективных и мультиспецифичных нацеливающих соединений с заданными свойствами, содержащих по меньшей мере две разные связывающие группировки, и их применения. Marraffini, L.A., et al. (J. Biol. Chem. 279 (2004) 37763-37770) описывают то, что для эффективного катализа сортазой А для заякоривания поверхностных белков на клеточной стенке Staphylococcus aureus требуется консервативный остаток аргинина.

Однако все данные подходы имеют тот недостаток, что они производят или в них используется искусственный мотив или структура, что позднее может приводить к проблемам in vivo, подобным иммуногенности.

КРАТКОЕ ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Обнаружили то, что комбинация олигоаланина в качестве нуклеофила с сортазным мотивом LPXTG приводит к подавленным или даже полностью устраненным обратной реакции или гидролизу продукта реакции, так как LPXTА не принимается в качестве субстрата.

Таким образом, одним аспектом, как описано в данном документе, является способ получения продукта ферментативного конъюгирования двух полипептидов, включающий следующие стадии:

- инкубирование

i) первого полипептида, содержащего (в пределах 20 С-концевых аминокислотных остатков) аминокислотную последовательность LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком),

ii) второго полипептида, который имеет олигоаланиновую Am (m равен 2 (SEQ ID NO: 26) или 3 (SEQ ID NO: 27), или 4 (SEQ ID NO: 28), или 5 (SEQ ID NO: 29)) аминокислотную последовательность на его N-конце,

iii) третьего полипептида с сортазной активностью, который получен из сортазы А Staphylococcus aureus, и

- выделение конъюгата из реакционной смеси и, посредством этого, получение продукта ферментативного конъюгирования двух полипептидов.

Таким образом, одним аспектом, как описано в данном документе, является способ получения продукта ферментативного конъюгирования двух полипептидов, включающий следующие стадии:

- инкубирование

i) первого полипептида, содержащего (в пределах 20 С-концевых аминокислотных остатков) аминокислотную последовательность LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком),

ii) второго полипептида, который содержит i) аланинильное соединение на его N-конце или ii) олигоаланин Am (m равен 2 (SEQ ID NO: 26) или 3 (SEQ ID NO: 27), или 4 (SEQ ID NO: 28), или 5 (SEQ ID NO: 29)), или iii) аминокислотный остаток цистеина, с последующими одним-тремя аминокислотными остатками аланина на его N-конце,

iii) третьего полипептида с сортазной активностью, который получен из сортазы А Staphylococcus aureus, и

- выделение конъюгата из реакционной смеси и, посредством этого, получение продукта ферментативного конъюгирования двух полипептидов.

В одном воплощении первый полипептид содержит на его С-конце аминокислотную последовательность LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком).

В одном предпочтительном воплощении первый полипептид содержит на его С-конце аминокислотную последовательность LPЕTG (SEQ ID NO: 30).

В одном воплощении второй полипептид имеет на его N-конце олигоаланин SEQ ID NO: 26 или SEQ ID NO: 27.

В одном воплощении первый полипептид и второй полипептид независимо друг от друга выбраны из вариабельного домена антитела, фрагмента Fab тяжелой цепи антитела, области Fc антитела, метки, пептида, содержащих аминокислотную последовательность LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком), линкера и группировки несортазного мотива.

В одном воплощении третий полипептид имеет аминокислотную последовательность SEQ ID NO: 21.

Одним аспектом, как описано в данном документе, является применение аминокислотной последовательности сортазного мотива LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком) в комбинации с пептидом, содержащим на его N-конце олигоаланиновую Am (m равен 2 (SEQ ID NO: 26) или 3 (SEQ ID NO: 27), или 4 (SEQ ID NO: 28), или 5 (SEQ ID NO: 29)) аминокислотную последовательность для увеличения выхода катализируемой сортазой реакции конъюгирования между сортазной аминокислотной последовательностью и пептидом, содержащим олигоаланин.

Одним аспектом, как описано в данном документе, является применение аминокислотной последовательности сортазного мотива LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком) в комбинации с пептидом, содержащим на его N-конце олигоаланиновую Am (m равен 2 (SEQ ID NO: 26) или 3 (SEQ ID NO: 27), или 4 (SEQ ID NO: 28), или 5 (SEQ ID NO: 29)) аминокислотную последовательность для уменьшения образования побочного продукта в катализируемой сортазой реакции конъюгирования между сортазной аминокислотной последовательностью и пептидом, содержащим олигоаланин.

Одним аспектом, как описано в данном документе, является применение аминокислотной последовательности сортазного мотива LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком) в комбинации с пептидом, содержащим на его N-конце олигоаланиновую Am (m равен 2 (SEQ ID NO: 26) или 3 (SEQ ID NO: 27), или 4 (SEQ ID NO: 28), или 5 (SEQ ID NO: 29) аминокислотную последовательность для сдвига равновесия катализируемой сортазой реакции конъюгирования между сортазной аминокислотной последовательностью и пептидом, содержащим олигоаланин, в сторону продукта.

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

I. ОПРЕДЕЛЕНИЯ

В настоящем описании и формуле изобретения нумерацией аминокислотных остатков в области Fc тяжелой цепи иммуноглобулина является нумерация индекса EU (Европейский Союз) по Kabat (Kabat, E.A., et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991), NIH Publication 91-3242, прямо включенная в данный документ посредством ссылки).

Термин «аланинильное соединение» обозначает соединение, которое содержит аминокислотный остаток аланина со свободной альфа-аминогруппой, например, в виде NH2 или NH3+, и карбоксильной группой в положении 1, которая находится в пептидной связи с другой группировкой, при этом данная группировка может представлять собой любую группировку, содержащую аминогруппу, такую как выделенный остаток аминокислоты, пептид, полипептид, белок, маленькую молекулу, краситель или (химический или пептидный) линкер.

Термин «содержащий» при использовании в данном документе прямо включает термин «состоящий из».

Термин «изменение» обозначает мутацию, присоединение или делецию одного или более чем одного аминокислотного остатка в родительской аминокислотной последовательности, например, антитела или слитого полипептида, содержащего по меньшей мере часть области Fc, связывающуюся с FcRn, для получения варианта антитела или слитого полипептида.

Термин «мутация аминокислоты» обозначает модификацию в аминокислотной последовательности родительской аминокислотной последовательности. Типичные модификации включают замены, вставки и/или делеции аминокислот. В одном воплощении мутация аминокислоты представляет собой замену. Термин «мутации аминокислот в положении» обозначает замену или делецию определенного остатка или вставку по меньшей мере одного аминокислотного остатка рядом с определенным остатком. Термин «вставка рядом с определенным остатком» обозначает вставку в пределах одного или двух остатков от него. Вставка может быть N-концевой или С-концевой по отношению к определенному остатку.

Термин «замена аминокислоты» обозначает замену по меньшей мере одного аминокислотного остатка в заданной родительской аминокислотной последовательности другим «заменяющим» аминокислотным остатком. Заменяющий остаток или остатки может представлять собой «встречающийся в природе аминокислотный остаток» (например, кодируемый генетическим кодом) и выбранный из группы, состоящей из: аланина (Ala); аргинина (Arg); аспарагина (Asn); аспарагиновой кислоты (Asp); цистеина (Cys); глутамина (Gln); глутаминовой кислоты (Glu); глицина (Gly); гистидина (His); изолейцина (Ile); лейцина (Leu); лизина (Lys); метионина (Met); фенилаланина (Phe); пролина (Pro); серина (Ser); треонина (Thr); триптофана (Trp); тирозина (Tyr) и валина (Val). В одном воплощении заменящий остаток не является цистеином. Замена одним или более чем одним аминокислотным остатком, не встречающимся в природе, в данном документе также охватывается определением замены аминокислоты. Термин «аминокислотный остаток, не встречающийся в природе» обозначает остаток, отличный от тех встречающихся в природе аминокислотных остатков, перечисленных выше, который способен к ковалентному связыванию со смежным(ми) аминокислотным(ми) остатком(ками) в полипептидной цепи. Примеры аминокислотных остатков, не встречающихся в природе, включают норлейцин, орнитин, норвалин, гомосерин, aib (аминоизомасляная кислота) и другие аналоги аминокислотных остатков, такие как остатки, описанные в Ellman, et al., Meth. Enzym. 202 (1991) 301-336. Для получения таких аминокислотных остатков, не встречающихся в природе, можно использовать методики Noren, et al. (Science 244 (1989) 182) и/или Ellman, et al. (выше). Вкратце, данные методики включают химическое активирование супрессорной тРНК аминокислотным остатком, не встречающимся в природе, с последующей транскрипцией in vitro и трансляцией РНК. Аминокислоты, не встречающиеся в природе, также можно включать в пептиды посредством химического пептидного синтеза и последующего слияния данных пептидов с рекомбинантно продуцированными полипептидами, такими как антитела или фрагменты антител.

Термин «вставка аминокислоты» обозначает включение по меньшей мере одного дополнительного аминокислотного остатка в заданную родительскую аминокислотную последовательность. В то время как вставка обычно будет состоять из вставки одного или двух аминокислотных остатков, в настоящей заявке рассматриваются большие «пептидные вставки», например, вставка от примерно трех до примерно пяти или даже вплоть до примерно десяти аминокислотных остатков. Вставленный(ные) остаток(тки) может(гут) быть встречающимся(щимися) в природе или не встречающимся(щимися) в природе, как определено выше.

Термин «делеция аминокислоты» обозначает удаление по меньшей мере одного аминокислотного остатка в заданном положении в аминокислотной последовательности.

В пределах данной заявки всякий раз, когда упоминается изменение аминокислоты, оно представляет собой преднамеренное изменение аминокислоты, а не случайную модификацию аминокислоты.

Термин «метка» обозначает последовательность из аминокислотных остатков, соединенных друг с другом посредством пептидных связей, которая имеет свойства специфичного связывания. В одном воплощении метка представляет собой аффинную метку или метку для очистки. В одном воплощении метка выбрана из Arg метки, His метки, метки Flag, метки 3' Flag, метки Strep, метки Nano, метки SBP, метки c-myc, метки S, кальмодулинсвязывающего пептида, целлюлозосвязывающего домена, хитинсвязывающего домена, метки GST (глутатион-S-трансфераза) или метки MBP (мальтозосвязывающий белок). В одном воплощении метка выбрана из SEQ ID NO: 01 (RRRRR), или SEQ ID NO: 02 (RRRRRR), или SEQ ID NO: 03 (HHHHHH), или SEQ ID NO: 04 (KDHLIHNVHKEFHAHAHNK), или SEQ ID NO: 05 (DYKDDDDK), или SEQ ID NO: 06 (DYKDHDGDYKDHDIDYKDDDDK), или SEQ ID NO: 07 (AWRHPQFGG), или SEQ ID NO: 08 (WSHPQFEK), или SEQ ID NO: 09 (MDVEAWLGAR), или SEQ ID NO: 10 (MDVEAWLGARVPLVET), или SEQ ID NO: 11 (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP), или SEQ ID NO: 12 (EQKLISEEDL), или SEQ ID NO: 13 (KETAAAKFERQHMDS), или SEQ ID NO: 14 (KRRWKKNFIAVSAANRF KKISSSGAL), или SEQ ID NO: 15 (целлюлозосвязывающий домен), или SEQ ID NO: 16 (целлюлозосвязывающий домен), или SEQ ID NO: 17 (TNPGVSAWQVNTA YTAGQLVTYNGKTYKCLQPHTSLAGWEP SNVPALWQLQ), или SEQ ID NO: 18 (метка GST), или SEQ ID NO: 19 (метка MBP).

Фраза «эффективное количество» агента, например, фармацевтической композиции, относится к эффективному количеству при дозировках и в течение периодов времени, необходимых для достижения желательного терапевтического или профилактического результата.

Термин «индивид» или «субъект» обозначает млекопитающего. Млекопитающие включают домашних животных (например, коровы, овцы, кошки, собаки и лошади), приматов (например, человек и приматы, не являющиеся человеком, такие как обезьяны), кроликов и грызунов (например, мыши, крысы и хомяки), но не ограничиваются ими. В некоторых воплощениях индивид или субъект представляет собой человека.

Термин «фармацевтическая композиция» относится к препарату, который находится в такой форме, чтобы обеспечивать эффективную биологическую активность содержащегося в нем активного ингредиента, и который не содержит дополнительных компонентов, которые являются неприемлемо токсичными для субъекта, которому вводилась бы данная композиция.

Термин «фармацевтически приемлемый носитель» относится к ингредиенту в фармацевтической композиции, отличному от активного ингредиента, который является нетоксичным для субъекта. Фармацевтически приемлемый носитель включает буфер, эксципиент, стабилизатор или консервант, но не ограничивается ими.

Термин «положение» обозначает место аминокислотного остатка в аминокислотной последовательности полипептида. Положения могут быть пронумерованы последовательно или согласно установленному формату, например, индексу EU по Kabat для нумерации антител.

Термин «лечение» (и его грамматические вариации, такие как «лечить» или «осуществление лечения») в том виде, как он используется в данном документе, относится к клиническому вмешательству в попытке изменить естественный ход заболевания индивида, которого лечат, и оно может осуществляться либо для профилактики, либо по ходу клинической патологии. Желательные эффекты лечения включают предупреждение появления или рецидива заболевания, облегчение симптомов, уменьшение любых прямых или опосредованных патологических последствий заболевания, предупреждение метастазов, уменьшение скорости прогрессирования заболевания, уменьшение интенсивности или временное облегчение болезненного состояния и ремиссия или улучшенный прогноз, но не ограничиваются ими. В некоторых воплощениях антитела по изобретению используются для задержки развития заболевания или для замедления прогрессирования заболевания.

II. ФЕРМЕНТАТИВНОЕ КОНЪЮГИРОВАНИЕ С ИСПОЛЬЗОВАНИЕМ СОРТАЗЫ А

Ковалентный конъюгат, содержащий два соединения, не ассоциированных ковалентно in vivo, может быть получен in vitro с использованием фермента сортазы, особенно сортазы А.

Сортаза А (SrtA) представляет собой мембраносвязанный фермент, который ковалентно присоединяет белки к бактериальной клеточной стенке. Специфичным мотивом распознавания на субстрате SrtA является LPXTG, при этом фермент осуществляет расщепление между остатками треонина и глицина. Мотивом распознавания на пептидогликане является пентаглициновый мотив. Было показано, что триглициновый и даже диглициновый мотив на N-конце является достаточным для поддержки реакции SrtA (Clancy, K.W., et al., Peptide science 94 (2010) 385-396). Реакция идет через тиоэфирное промежуточное соединение ацил-фермент, которое распадается посредством атаки аминного нуклеофила из олигоглицина, ковалентно связывая пептидогликан с белковым субстратом и регенерируя SrtA. SrtA можно использовать для ковалентного конъюгирования химически синтезированных пептидов с рекомбинантно экспрессируемыми белками.

Многие грамположительные бактерии используют сортазу для ковалентного заякоривания целого ряда поверхностных белков, включая факторы вирулентности, на их клеточной стенке (пептидогликане). Сортазы представляют собой мембраноассоциированные ферменты. Сортаза А Staphylococcus aureus дикого типа (SrtA) представляет собой полипептид из 206 аминокислот с N-концевой пронизывающей мембрану областью. На первой стадии сортаза А распознает субстратные белки, которые содержат мотив аминокислотной последовательности LPXTG (SEQ ID NO: 20), и расщепляет амидную связь между Thr и Gly посредством Cys активного сайта. Данная реакция расщепления пептида приводит к тиоэфирному промежуточному соединению сортаза А-субстрат. На второй стадии тиоэфирное промежуточное соединение ацил-фермент распадается посредством нуклеофильной атаки аминогруппы олигоглицина, содержащегося во втором субстратном полипептиде (соответствующего пентаглициновому элементу пептидогликана в S. aureus), приводя к ковалентно связанному белку клеточной стенки и регенерации сортазы А. В отсутствие олигоглициновых нуклеофилов промежуточное соединение ацил-фермент может гидролизоваться молекулой воды.

Опосредованное сортазой лигирование/конъюгирование начало применяться для целого ряда целей белковой инженерии и биоконъюгирования. Данная методика обеспечивает введение природных и синтетических функциональных групп в меченные LPXTG рекомбинантные или химически синтезированные полипептиды. Примеры включают ковалентное присоединение дериватизированных олигоглицином полимеров (например, PEG (полиэтиленгликоль)), флуорофоров, витаминов (например, биотин и фолат), липидов, углеводов, нуклеиновых кислот, синтетических пептидов и белков (например, GFP (зеленый флуоресцентный белок)) (см., например, Tsukiji, S. and Nagamune, T., ChemBioChem 10 (2009) 787-798; Popp, M.W.L. and Ploegh, H.L., Angew. Chem. Int. Ed. Engl. 50 (2011) 5024-5032).

Для ферментативного конъюгирования может быть использована растворимая усеченная сортаза А, не имеющая пронизывающей мембрану области (SrtA; аминокислотные остатки 60-206 SrtA Staphylococcus aureus) (SEQ ID NO: 21; см. также Ton-That, H., et al., Proc. Natl. Acad. Sci. USA 96 (1999) 12424-12429; Ilangovan, H., et al., Proc. Natl. Acad. Sci. USA 98 (2001) 6056-6061).

III. СПОСОБЫ ГЕННОЙ ИНЖЕНЕРИИ

Любой полипептидный домен (например, одноцепочечный антигенсвязывающий полипептид, такой как scFv, scFab или дарпин, или многоцепочечный антигенсвязывающий полипептид, такой как dsFv или Fab), содержащий олигоаланиновый мотив на его N-конце (AA (SEQ ID NO: 26), AAA (SEQ ID NO: 27), AAAA (SEQ ID NO: 28), AAAAA (SEQ ID NO: 29)), может быть экспрессирован и очищен из супернатанта эукариотических клеток (например, клеток HEK293 (клетки эмбриональной почки человека 293) или клеток СНО (клетки яичника китайского хомяка)). Не важно, является ли полипептид выделенным полипетидом или содержащимся в мультимерной или гетеромерной структурной единице.

Подходящие клетки-хозяева для клонирования или экспрессии/секреции векторов, кодирующих полипептиды, включают прокариотические или эукариотические клетки, описанные в данном документе. Например, полипептиды могут быть продуцированы в бактериях, в частности, когда гликозилирование не требуется (см., например, US 5648237, US 5789199 и US 5840523, Charlton, Methods in Molecular Biology 248 (2003) 245-254 (B.K.C. Lo, (ed.), Humana Press, Totowa, NJ), описывающие экспрессию фрагментов антител в E. coli). После экспрессии полипептид можно выделять из пасты бактериальных клеток в растворимой фракции или можно выделять из нерастворимой фракции так называемые тельца включения, которые можно солюбилизировать и повторно сворачивать до биоактивных форм. Затем полипептид можно дополнительно очищать.

Помимо прокариот, эукариотические микробы, такие как нитчатые грибки или дрожжи, являются подходящими хозяевами клонирования или экспрессии для векторов, кодирущих полипептиды, включая штаммы грибков и дрожжей, пути гликозилирования которых были «гуманизированы», приводя к продукции полипептида с частично или полностью человеческой картиной гликозилирования (см., например, Gerngross, Nat. Biotech. 22 (2004) 1409-1414 и Li, et al., Nat. Biotech. 24 (2006) 210-215).

Подходящие клетки-хозяева для экспрессии гликозилированных полипептидов также получают из многоклеточных организмов (беспозвоночных и позвоночных). Примеры клеток беспозвоночных включают клетки растений и насекомых. Были идентифицированы многочисленные штаммы бакуловирусов, которые могут быть использованы в сочетании с клетками насекомых, в частности, для трансфекции клеток Spodoptera frugiperda.

Культуры клеток растений также можно использовать в качестве хозяев (см., например, US 5959177, US 6040498, US 6420548, US 7125978 и US 6417429 (описывающие технологию PLANTIBODIES™ для продуцирования антител в трансгенных растениях)).

В качестве хозяев также можно использовать клетки позвоночных. Например, могут быть полезными линии клеток млекопитающих, которые адаптированы для роста в суспензии. Другими примерами полезных линий клеток-хозяев млекопитащих являются линия клеток COS-7 (клетка CV1 почки обезьяны, трансформированная SV40; линия клеток НЕК293 (эмбриональная почка человека); линия клеток ВНК (почки новорожденного хомяка); линия клеток Сертоли мыши ТМ4 (клетки ТМ4, как описано, например, в Mather, Biol. Reprod. 23 (1980) 243-251); линия клеток CV1 (клетка почки обезьяны); линия клеток VERO-76 (клетки почки африканской зеленой мартышки); линия клеток HELA (клетка карциномы шейки матки человека); линия клеток MDCK (клетка почки собаки); линия клеток BRL-3A (клетка печени серой крысы); линия клеток W138 (клетка легкого человека); линия клеток HepG2 (клетка печени человека); линия клеток MMT 060562 (клетка опухоли молочной железы мыши); линия клеток TRI (например, описанная в Mather, et al., Annals N.Y. Acad. Sci. 383 (1982) 44-68); линия клеток MRC5 и линия клеток FS4. Другие полезные линии клеток-хозяев млекопитающих включают линию клеток СНО, включая линии клеток СНО, негативные в отношении DHFR (дигидрофолатредуктаза) (см., например, Urlaub, et al., Proc. Natl. Acad. Sci. USA 77 (1980) 4216), и линии клеток миеломы, такие как линия клеток Y0, NS0 и Sp2/0. Относительно обзора определенных линий клеток-хозяев млекопитающих, подходящих для продукции полипептидов, см., например, Yazaki, and Wu, Methods in Molecular Biology, Antibody Engineering 248 (2004) 255-268 (B.K.C. Lo, (ed.), Humana Press, Totowa, NJ).

IV. СПОСОБ, ОПИСАННЫЙ В ДАННОМ ДОКУМЕНТЕ

Реакции конъюгирования полипептидов, опосредованные сортазой, обычно имеют недостаток в том, что равновесие реакции не находится на стороне продукта. Таким образом, полезным является либо сдвиг равновесия, либо удаление продукта. В Таблице, приведенной ниже, показана относительная активность сортазы (Staphylococcus aureus) с разными субстратами.

Таблица

Сортазный мотив
LPXTG LPXTA
нуклеофил
(в избытке)
олигоглицин 100 % 0 %
олигоаланин 5 % 0 %

Таким образом, обнаружили, что комбинация олигоаланина в качестве нуклеофила с сортазным мотивом LPTXTG приводит к подавлению или даже к полному устранению обратной реакции или гидролиза реакционного продукта, так как LPXTA не принимается в качестве субстрата (см. Фиг. 1, 3 и 4).

Это было проиллюстрировано примерами с использованием двух фрагментов области Fc антитела в реакции лигирования, опосредованной сортазой. Один фрагмент области Fc содержит С-концевой сортазный мотив LPETG, тогда как другой фрагмент области Fc содержит N-концевой олигоаланин (ААА, SEQ ID NO: 27) в качестве нуклеофила. Образцы реакционной смеси анализировали через 16 часов и 40 часов (см. Фиг. 2). Можно видеть, что желательный продукт лигирования (димер области Fc, приблизительно 60 кДа) образуется через 16 часов. Даже после времени инкубации 40 ч не происходило гидролиза образовавшегося продукта, несмотря на высокую концентрацию сортазы (отношение фермент:субстрат 1:10).

В случае LPETG и олигоглицина (GGG, SEQ ID NO: 23) наблюдали распад образовавшегося сортазного продукта.

При использовании данной комбинации реактивов

i) обратная реакция, распознающая аминокислотную последовательность LPXTG в пределах конъюгата продукта в качестве субстрата и/или

ii) образование тупикового, образующегося в результате гидролиза фрагмента полипептида (полипептид с без расщепленной последовательностью распознавания LPXTG, генерированный через расщепление промежуточного соединения сортазы А со связанным посредством тиоацила структурным элементом водой, вместо нуклеофила области Fc),

которые обычно происходят при увеличенном времени реакции, могут быть уменьшены или даже устранены.

Группировка несортазного мотива

Аминокислотная последовательность сортазного мотива LPXTG может быть конъюгирована, если она непосредственно не содержится в одной из данных молекул, с терапевтическим агентом (лекарственным средством), цитотоксическим агентом (например, токсином, таким как доксорубицин или коклюшный токсин), флуорофорами, такими как флуоресцентный краситель, подобный флуоресцеину или родамину, хелатирующим агентом для визуализации или радиотерапевтическим металлом, пептидильной или непептидильной меткой, меткой или агентом, модифицирующим клиренс, таким как разные изомеры полиэтиленглиоля, пептидом, который связывается с третьим компонентом, или другим углеводным или липофильным агентом. Конъюгирование может осуществляться либо непосредственно, либо через промежуточный линкер.

а) Терапевтические группировки

Лекарственной группировкой может быть любое соединение, группировка или группа, которая имеет терапевтический эффект, как, например, антитело, цитотоксическое или цитостатическое соединение.

Известен целый ряд терапевтических антител, направленных против молекул поверхности клетки и их лигандов, как, например, ритуксан/MabThera/ритуксимаб, 2Н7/окрелизумаб, зевалин/ибризумомаб, арзерра/офатумумаб (CD20), HLL2/эпратузумаб, инотузомаб (CD22), зенапакс/даклизумаб, симулект/базиликсимаб (CD25), герцептин/трастузумаб, пертузумаб (Her2/ERBB2), милотарг/гемтузумаб (CD33), раптива/эфализумаб (Cd11a), эрбитукс/цетуксимаб (EGFR, рецептор эпидермального фактора роста), IMC-1121B (рецептор VEGF 2 (фактор роста эндотелия сосудов 2)), тисабри/натализумаб (α4-субъединица α4β1 и α4β7 интегринов), РеоПро/абциксимаб (gpIIb-gpIIa и ανβ3-интегрин), ортоклон OKT3/муромонаб-CD3 (CD3), бенлиста/белимумаб (BAFF), толеркс/отеликсимаб (CD3), солирис/экулизумаб (белок комплемента C5), актемра/тоцилизумаб (IL-6R), панорекс/эдреколомаб (EpCAM, молекула адгезии эпителиальной клетки), CEA-CAM5/лабетузумаб (CD66/CEA, карциноэмбриональный антиген), CT-11 (PD-1, ингибирующий рецептор программируемой смерти Т-клеток 1, CD-d279), H224G11 (рецептор c-Met), SAR3419 (CD19), IMC-A12/циксутумумаб (IGF-1R, рецептор инсулиноподобного фактора роста 1), MEDI-575 (PDGF-R - рецептор фактора роста тромбоцитов), CP-675, 206/тремелимумаб (антиген 4 цитотоксических Т-лимфоцитов), RO5323441 (плацентарный фактор роста или PGF), HGS1012/мапатумумаб (TRAIL-R1), SGN-70 (CD70), ведотин(SGN-35)/брентуксимаб (CD30) и ARH460-16-2 (CD44).

Конъюгаты, полученные способом, описанным в данном документе, можно использовать в получении лекарственных средств для лечения, например, онкологического заболевания, сердечно-сосудистого заболевания, инфекционного заболевания, воспалительного заболевания, аутоиммунного заболевания, метаболического (например, эндокринного) заболевания или неврологического (например, нейродегенеративного) заболевания. Типичными неограничивающими примерами данных заболеваний являются болезнь Альцгеймера, неходжкинские лимфомы, В-клеточные острые и хронические лимфоидные лейкозы, лимфома Беркитта, лимфома Ходжкина, волосатоклеточный лейкоз, острые и хронические миелоидные лейкозы, Т-клеточные лимфомы и лейкозы, множественная миелома, глиома, макроглобулинемия Вальденстрёма, карциномы (такие как карциномы полости рта, желудочно-кишечного тракта, толстой кишки, желудка, дыхательного тракта, легкого, молочной железы, яичника, простаты, матки, эндометрия, шейки матки, мочевого пузыря, поджелудочной железы, кости, печени, желчного пузыря, почки, кожи и яичек), меланомы, саркомы, глиомы и раковые заболевания кожи, острая идиопатическая тромбоцитопеническая пурпура, хроническая идиопатическая тромбоцитопеническая пурпура, дерматомиозит, болезни Сиденгама, тяжелая миастения, системная красная волчанка, волчаночный нефрит, ревматическая лихорадка, полигландулярные синдромы, пузырчатка, сахарный диабет, пурпура Хеноха-Шонляйна, постстрептококковый нефрит, узелковая эритема, болезнь отсутствия пульса, болезнь Эдисона, ревматоидный артрит, рассеянный склероз, саркоидоз, язвенный колит, полиморфная эритема, первичная нефропатия IgA-типа, узелковый полиартериит, анкилозирующий спондилоартрит, синдром Гудпасчера, облитерирующий тромбангиит, синдром Шегрена, билиарный первичный цирроз печени, аутоиммунный тиреоидит, тиротоксикоз, склеродермия, хронический активный гепатит, полимиозит/дерматомиозит, полихондрит, обыкновенная пузырчатка, гранулематоз Вегенера, мембранная нефропатия, боковой амиотрофический склероз, сухотка спинного мозга, узелковый периартериит/полимиалгия, пернициозная анемия, быстро прогрессирующий гломерулонефрит, псориаз или фиброзирующий альвеолит.

Известен целый ряд маркеров поверхности клетки и их лигандов. Например, сообщали о том, что раковые клетки экспрессируют по меньшей мере один из следующих маркеров поверхности клетки и/или лигандов, включая следующие: карбоангидраза IX, альфа-фетопротеин, альфа-актинин-4, А3 (специфичный в отношении антитела А33 антиген), ART-4, B7, Ba-733, BAGE, BrE3-антиген, CA125, CAMEL, CAP-1, CASP-8/m, CCCL19, CCCL21, CD1, CD1a, CD2, CD3, CD4, CDS, CD8, CD1-1A, CD14, CD15, CD16, CD18, CD19, CD20, CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD45, CD46, CD54, CD55, CD59, CD64, CD66a-e, CD67, CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133, CD138, CD147, CD154, CDC27, CDK-4/m, CDKN2A, CXCR4, CXCR7, CXCL12, HIF-l-альфа, специфичный для толстой кишки антиген p (CSAp), CEA (CEACAM5), CEACAM6, c-met, DAM, EGFR, EGFRγIII, EGP-1, EGP-2, ELF2-M, Ep-CAM, Flt-1, Flt-3, рецептор фолиевой кислоты, антиген G250, GAGE, GROB, HLA-DR, HM1.24, человеческий хорионгонадотропин (HCG) и его субъединицы, HER2/neu, HMGB-1, фактор, индуцируемый гипоксией (HIF-1), HSP70-2M, HST-2 или la, IGF-1R, IFN-гамма (интерферон-гамма), IFN-альфа, IFN-бета, IL-2 (интерлейкин-2), IL-4R (рецептор интерлейкина-4), IL-6R, IL-13R, IL-15R, IL-17R, IL-18R, IL-6, IL-8, IL-12, IL-15, IL-17, IL-18, IL- 25, инсулиноподобный фактор роста-1 (IGF-1), KC4-антиген, KS-1-антиген, KS1-4, Le-Y, LDR/FUT, фактор, ингибирующий миграцию макрофагов (MIF), MAGE, MAGE-3, MART-1, MART-2, NY-ESO-1, TRAG-3, mCRP, MCP-1, MIP-1A, MIP-1B, MIF, MUC1, MUC2, MUC3, MUC4, MUC5, MUM-1/2, MUM-3, NCA66, NCA95, NCA90, муцин рака поджелудочной железы, плацентарный фактор роста, p53, PLAGL2, кислая фосфатаза простаты, PSA, PRAME, PSMA, P1GF, ILGF, ILGF-1R, IL-6, IL-25, RS5, RANTES, T101, SAGE, S100, сурвивин, сурвивин-2B, TAC, TAG-72, тенасцин, рецепторы TRAIL, TNF-альфа (фактор некроза опухоли-альфа), Tn-антиген, антигены Томсона-Фриденрайха, антигены некроза опухоли, VEGFR (рецептор фактора роста эндотелия сосудов), ED-B фибронектин, WT-1, 17-1A-антиген, факторы комплемента C3, C3a, C3b, C5a, C5, маркер ангиогенеза, bcl-2, bcl-6, Kras, cMET, онкогенный маркер и онкогенный продукт (см., например, Sensi, et al., Clin. Cancer Res. 12 (2006) 5023-5032; Parmiani, et al, J. Immunol. 178 (2007) 1975-1979; Novellino, et al., Cancer Immunol. Immunother. 54 (2005) 187-207), но не ограничиваясь ими.

Таким образом, антитела, распознающие специфические рецепторы поверхности клетки, включая их лиганды, можно использовать для специфичной и селективной направленной доставки и связывания с рядом/множеством маркеров поверхности клетки, которые ассоциированы с заболеванием. Маркер поверхности клетки представляет собой полипептид, локализованный на поверхности клетки (например, клетки, имеющей отношение к заболеванию), который, например, ассоциирован с событием сигнализации или со связыванием лиганда.

В одном воплощении для лечения рака/опухолей получают мультиспецифичные связывающие молекулы/биспецифичные антитела, которые нацелены на антигены, ассоциированные с опухолью, такие как антигены, описанные в Herberman, "Immunodiagnosis of Cancer", в Fleisher (ed.), "The Clinical Biochemistry of Cancer", страница 347 (American Association of Clinical Chemists (1979)) и в US 4150149; US 4361544 и US 4444744.

Сообщения об антигенах, ассоциированных с опухолью (ТАА), включают Mizukami, et al., (Nature Med. 11 (2005) 992-997); Hatfield, et al., (Curr. Cancer Drug Targets 5 (2005) 229-248); Vallbohmer, et al., (J Clin. Oncol. 23 (2005) 3536-3544) и Ren, et al., (Ann. Surg. 242 (2005) 55-63), причем каждая из них включена в данный документ посредством ссылки в том, что касается идентифицированных ТАА.

Когда заболевание включает лимфому, лейкоз или аутоиммунное расстройство, антигены, являющиеся мишенями, можно выбрать из группы, состоящей из следующих: CD4, CD5, CD8, CD14, CD15, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD37, CD38, CD40, CD40L, CD46, CD54, CD67, CD74, CD79a, CD80, CD126, CD138, CD154, CXCR4, B7, MUC1 или la, HM1.24, HLA-DR, тенасцин, VEGF, P1GF, ED-B фибронектин, онкоген, онкогенный продукт (например, c-met или PLAGL2), CD66a-d, антигены некроза, IL-2, T101, TAG, IL-6, MIF, TRAIL-R1 (DR4) и TRAIL-R2 (DR5).

Известен целый ряд биспецифичных антител, направленных против двух разных мишеней, таких как ВСМА/CD3, разные антигены семейства HER в комбинации (EGFR (рецептор эпидермального фактора роста), HER2, HER3), CD19/CD3, IL17RA/IL7R, IL-6/IL-23, IL-1-бета/IL-8, IL-6 или IL-6R/ IL-21, или IL-21R, причем первая специфичность направлена на гликоэпитоп антигена, выбранный из группы, состоящей из следующих: x-структура Льюиса, b-структура Льюиса и y-структура Льюиса, H-структуры Глобо, KH1, Tn-антиген, TF-антиген и углеводные структуры муцинов, CD44, гликолипиды и гликосфинголипиды, такие как Gg3, Gb3, GD3, GD2, Gb5, Gm1, Gm2, сиалилтетраозилцерамид, и вторая специфичность, направленная на рецепторную тирозинкиназу ErbB, выбранную из группы, состоящей из EGFR, HER2, HER3 и HER4, GD2 в комбинации со вторым антигенсвязывающим сайтом, ассоциирована с иммунологической клеткой, выбранной из группы, состоящей из следующих: Т-лимфоциты, NK (природные киллеры) клетки, В-лимфоциты, дендритные клетки, моноциты, макрофаги, нейтрофилы, мезенхимные стволовые клетки, нервные стволовые клетки, ANG2/VEGF, VEGF/PDGFR-бета, акцептор 2/CD3 фактора роста эндотелия сосудов (VEGF), PSMA/CD3, EPCAM/CD3, комбинации антигена выбраны из группы, состоящей из VEGFR-1, VEGFR-2, VEGFR-3, FLT3, c-FMS/CSF1R, RET, c-Met, EGFR, Her2/neu, HER3, HER4, IGFR, PDGFR, c-KIT, BCR, интегрина, и MMP с водорастворимым лигандом выбраны из группы, состоящей из следующих: VEGF, EGF (эпидермальный фактор роста), PIGF (плацентарный фактор роста), PDGF (фактор роста тромбоцитов), HGF (фактор роста гепатоцитов) и ангиопоэтин, ERBB-3/C-MET, ERBB-2/C-MET, рецептор EGF 1/CD3, EGFR/HER3, PSCA/CD3, C-MET/CD3, ENDOSIALIN/CD3, EPCAM/CD3, IGF-1R/CD3, FAPALPHA/CD3, EGFR/IGF-1R, IL 17A/F, рецептор 1 EGF/CD3 и CD19/CD16.

Группировки токсичных лекарственных средств включают: (i) химиотерапевтические агенты, которые могут функционировать в качестве ингибиторов микротрубочек, ингибиторов митоза, ингибиторов топоизомеразы или интеркаляторов ДНК; (ii) белковые токсины, которые могут функционировать ферментативно; и (iii) радиоизотопы.

Типичные группировки токсичных лекарственных средств включают майтансиноид, ауристатин, доластатин, трихотецен, СС1065, калихеамицин и другие энедииновые антибиотики, таксан, антрациклин и стереоизомеры, изостеры, их аналоги или производные, но не ограничиваются ими.

Белковые токсины включают цепь А дифтерийного токсина, несвязывающиеся активные фрагменты дифтерийного токсина, цепь А экзотоксина (из Pseudomonas aeruginosa), цепь А рицина (Vitetta et al (1987) Science, 238:1098), цепь А абрина, цепь А модекцина, альфа-сарцин, белки Aleurites fordii, диантиновые белки, белки Phytolaca americana (PAPI, PAPII и PAP-5), ингибитор Momordica charantia, курцин, кротин, ингибитор Saponaria officinalis, гелонин, митогеллин, рестриктоцин, феномицин, эномицин и трикотецены (WO 93/21232).

Терапевтические радиоизотопы включают 32P, 33P, 90Y, 125I, 131I, 131In, 153Sm, 186Re, 188Re, 211At, 212B, 212Pb и радиоактивные изотопы Lu.

Радиоизотоп или другие метки можно включать известными способами (Fraker et al (1978) Biochem. Biophys. Res. Commun. 80: 49-57; "Monoclonal Antibodies in Immunoscintigraphy" Chatal, CRC Press 1989). Меченная углеродом-14 1-изотиоцианатобензил-3-метилдиэтилентриаминпентауксусная кислота (MX-DTPA) является примером хелатирующего агента для конъюгирования радиоизотопа с комплексом (WO 94/11026).

б) Метки

Группировка несортазного мотива может быть меткой. Можно использовать любую группировку метки, которая может быть ковалентно присоединена к сортазной аминокислотной последовательности (см., например, Singh et al (2002) Anal. Biochem. 304:147-15; Harlow E. and Lane, D. (1999) Using Antibodies: A Laboratory Manual, Cold Springs Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Lundblad R. L. (1991) Chemical Reagents for Protein Modification, 2nd ed. CRC Press, Boca Raton, Fla.). Метка может функционировать для: (i) предоставления выявляемого сигнала; (ii) взаимодействия со второй меткой для модификации выявляемого сигнала, предоставляемого первой или второй меткой, например, для получения FRET (резонансный перенос энергии флуоресценции); (iii) воздействия на подвижность, например, электрофоретическую подвижность или пронимаемость в клетку, посредством заряда, гидрофобности, формы или других физических параметров, или (iv) предоставления захватывающей группировки, например, для модуляции ионного комплексообразования.

Конъюгаты, содержащие гаптенилированную метку, как описано в данном документе, могут быть полезными в диагностических анализах, например, для выявления экспрессии интересующего антигена в специфических клетках, тканях или сыворотке. Для диагностических применений будет использоваться биспецифичное антитело, в котором первая специфичность связывания связывается с мишенью, и вторая специфичность связывания связывается с гаптенилированной меткой. Гаптен типично будет метиться выявляемой группировкой. Доступны многочисленные метки, которые обычно можно группировать в следующие категории:

(а) Радиоизотопы (радионуклиды), такие как 3H, 11C, 14C, 18F, 32P, 35S, 64Cu, 68Gn, 86Y, 89Zr, 99Tс, 111In, 123I, 124I, 125I, 131I, 133Xe, 177Lu, 211At или 131Bi. Конъюгаты, меченные радиоизотопом, являются полезными в экспериментах по визуализации с нацеливанием на рецептор. Антиген (гаптен) можно метить реактивами-лигандами, которые связываются, хелатируют или иным образом формируют комплекс с радиоизотопным металлом с использованием методик, описанных в Current Protocols in Immunology, (1991) Тома 1 и 2, Coligen et al, Ed. Wiley-Interscience, New York, N.Y., Pubs. Хелатирующие лиганды, которые могут формировать комплекс с ионом металла, включают DOTA, DOTP, DOTMA, DTPA и TETA (Macrocyclics, Dallas, Tex.). Радионуклиды могут быть нацелены через комплексообразование с комплексом, как описано в данном документе (Wu et al, Nature Biotechnology 23(9) (2005) 1137-1146). Визуализация рецептора-мишени с использованием комплексов, меченных радионуклидом, может давать маркер активации пути посредством выявления и количественного измерения постепенного накопления комплексов или соответствующих терапевтических антител в опухолевой ткани (Albert et al (1998) Bioorg. Med. Chem. Lett. 8:1207-1210).

Комплексы металл-хелат подходят в качестве меток для экспериментов по визуализации (US 2010/0111856; US 5342606; US 5428155; US 5316757; US 5480990; US 5462725; US 5428139; US 5385893; US 5739294; US 5750660; US 5834456; Hnatowich et al, J. Immunol. Methods 65 (1983) 147-157; Meares et al, Anal. Biochem. 142 (1984) 68-78; Mirzadeh et al, Bioconjugate Chem. 1 (1990) 59-65; Meares et al, J. Cancer (1990), Suppl. 10:21-26; Izard et al, Bioconjugate Chem. 3 (1992) 346-350; Nikula et al, Nucl. Med. Biol. 22 (1995) 387-90; Camera et al, Nucl. Med. Biol. 20 (1993) 955-62; Kukis et al, J. Nucl. Med. 39 (1998) 2105-2110; Verel et al., J. Nucl. Med. 44 (2003) 1663-1670; Camera et al, J. Nucl. Med. 21 (1994) 640-646; Ruegg et al, Cancer Res. 50 (1990) 4221-4226; Verel et al, J. Nucl. Med. 44 (2003) 1663-1670; Lee et al, Cancer Res. 61 (2001) 4474-4482; Mitchell, et al, J. Nucl. Med. 44 (2003) 1105-1112; Kobayashi et al Bioconjugate Chem. 10 (1999) 103-111; Miederer et al, J. Nucl. Med. 45 (2004) 129-137; DeNardo et al, Clinical Cancer Research 4 (1998) 2483-90; Blend et al, Cancer Biotherapy & Radiopharmaceuticals 18 (2003) 355-363; Nikula et al J. Nucl. Med. 40 (1999) 166-76; Kobayashi et al, J. Nucl. Med. 39 (1998) 829-36; Mardirossian et al, Nucl. Med. Biol. 20 (1993) 65-74; Roselli et al, Cancer Biotherapy & Radiopharmaceuticals, 14 (1999) 209-20).

(б) Флуоресцентные метки, такие как хелаты редкоземельных металлов (хелаты европия), разные типы флуоресцеина, включающие FITC (флуоресцеинизотиоцианат), 5-карбоксифлуоресцеин, 6-карбоксифлуоресцеин; разные типы родамина, включающие TAMRA; дансил; лиссамин; цианины; фикоэритрины; техасский красный и их аналоги. Флуоресцентные метки могут быть конъюгированы с антигеном (гаптеном) с использованием методик, раскрытых, например, выше в Current Protocols in Immunology. Флуоресцентные красители и реактивы на основе флуоресцентной метки включают красители и реактивы, которые имеются в продаже у Invitrogen/Molecular Probes (Eugene, Oregon, США) и Pierce Biotechnology, Inc. (Rockford, Ill.).

Выявляемые метки, такие как флуоресцентные красители и хемилюминисцентные красители (Briggs et al "Synthesis of Functionalised Fluorescent Dyes and Their Coupling to Amines and Amino Acids," J. Chem. Soc., Perkin-Trans. 1 (1997) 1051-1058), дают выявляемый сигнал и обычно являются применимыми для мечения, особенно со следующими свойствами: (i) меченый конъюгат должен давать очень сильный сигнал со слабым фоном таким образом, что могут быть чувствительно выявлены маленькие количества конъюгата как в бесклеточных анализах, так и в анализах на основе клеток; и (ii) меченый конъюгат должен быть фотостабильным так, что флуоресцентный сигнал можно наблюдать, отслеживать и записывать без значимого фотообесцвечивания. Для применений, включающих связывание на поверхности клетки меченых конъюгатов с мембранами или поверхностями клеток, особенно живых клеток, метки должны (iii) иметь хорошую растворимость в воде для достижения эффективной концентрации конъюгата и чувствительности выявления и (iv) быть нетоксичными для живых клеток так, чтобы не нарушать нормальные метаболические процессы клеток или вызывать преждевременную гибель клеток.

(в) Доступны или раскрыты разные фермент-субстратные метки (см., например, US 4275149). Фермент обычно катализирует химическое изменение хромогенного субстрата, которое может быть измерено с использованием разных методик. Например, фермент может катализировать изменение окрашивания субстрата, которое можно измерять спектрофотометрически. В качестве альтернативы, фермент может изменять флуоресценцию или хемилюминисценцию субстрата. Хемилюминисцентный субстрат становится электронно возбужденным посредством химической реакции и может затем испускать свет, который можно измерять (например, с использованием хемилюминометра), или передает энергию флуоресцентному акцептору. Примеры ферментативных меток включают люциферазы (например, люцифераза светляка и бактериальная люцифераза; US 4737456), люциферин, 2,3-дигидрофталазиндионы, малатдегидрогеназу, уреазу, пероксидазу, такую как пероксидаза хрена (HRP), щелочную фосфатазу (АР), 3-галактозидазу, глюкоамилазу, лизоцим, сахаридоксидазы (например, глюкозооксидаза, галактозооксидаза и глюкозо-6-фосфатдегидрогеназа), оксидазы гетероциклических соединений (такие как уриказа и ксантиноксидаза), лактопероксидазу, микропероксидазу и тому подобные. Методики конъюгирования ферментов с полипептидами описаны в O'Sullivan et al "Methods for the Preparation of Enzyme-Antibody Conjugates for use in Enzyme Immunoassay", in Methods in Enzym. (ed. by J. Langone & IT Van Vunakis), Academic Press, New York, 73 (1981) 147-166.

Примеры фермент-субстратных комбинаций (US 4275149; US 4318980) включают, например:

(i) пероксидазу хрена (HRP) с пероксидом водорода в качестве субстрата, где пероксид водорода окисляет предшественник красителя (например, ортофенилендиамин (OPD) или 3,3',5,5'-тетраметилбензидина гидрохлорид (ТМВ));

(ii) щелочную фосфатазу (АР) с пара-нитрофенилфосфатом в качестве хромогенного субстрата; и

(iii) 3-D-галактозидазу (3-D-Gal) с хромогенным субстратом (например, п-нитрофенил-(3-D-галактозидом) или флуорогенным субстратом 4-метилумбеллиферил-(3-D-галактозидом).

Меченый конъюгат, как описано в данном документе, может использоваться в любом известном способе анализа, таком как ELISA, анализы конкурентного связывания, прямые и непрямые сэндвич-анализы и анализы иммунопреципитации (Zola, Monoclonal Antibodies: A Manual of Techniques (1987) pp. 147-158, CRC Press, Inc.).

Меченые конъюгаты, как описано в данном документе, являются полезными в качестве биомаркеров для визуализации и зондов при использовании в разных способах и методиках биомедицинской и молекулярной визуализации, таких как: (i) МРТ (магнитно-резонансная томография); (ii) микроКТ (компьютерная томография); (iii) SPECT (однофотонная эмиссионная компьютерная томография); (iv) РЕТ (позитронная эмиссионная томография) Tinianow, J. et al Nuclear Medicine and Biology, 37(3) (2010) 289-297; Chen et al, Bioconjugate Chem. 15 (2004) 41-49; US 2010/0111856; (v) биолюминисценция; (vi) флуоресценция и (vii) ультразвук. Иммуносцинтиграфия представляет собой методику визуализации, в которой конъюгаты, меченные радиоактивными веществами, вводятся пациенту-животному или человеку, и получают изображение сайтов в организме, где локализуется конъюгат (US 6528624). Биомаркеры для визуализации можно объективно измерять и оценивать в качестве индикатора нормальных биологических процессов, патогенных процессов или фармакологических ответов на терапевтическое вмешательство. Биомаркеры могут быть нескольких типов: маркеры типа 0 представляют собой маркеры естественной истории заболевания, и они линейно коррелируют с известными клиническими показателями, например, оценка посредством МРТ синовиального воспаления при ревматоидном артрите; маркеры типа I запечатлевают эффект вмешательства в соответствии с механизмом действия, даже если данный механизм может быть не связанным с ожидаемым клиническим результатом; маркеры типа II функционируют как имитация ожидаемых результатов, когда изменение в или сигнал от биомаркера прогнозирует клиническую пользу для «подтверждения» целевого ответа, как, например, измеренная эрозия кости при ревматоидном артрите, определенная КT. Биомаркеры для визуализации, таким образом, могут давать фармакодинамическую (PD) терапевтическую информацию по: (i) экспрессии белка-мишени, (ii) связыванию терапевтического средства с белком-мишенью, т.е. селективности, и (iii) фармакодинамическим данным - клиренсу и периоду полувыведения. Преимущества биомаркеров для визуализации in vivo по отношению к лабораторным биомаркерам включают: неинвазивную обработку, поддающуюся количественному измерению оценку всего организма, повторное дозирование и оценку, т.е. во многие моменты времени, и потенциально переносимые эффекты от доклинических (на маленьких животных) на клинические (на человеке) результаты. Для некоторых применений биовизуализация подменяет или минимизирует число экспериментов на животных в доклинических исследованиях.

Способы мечения пептидов хорошо известны. См. Haugland (2003) Molecular Probes Handbook of Fluorescent Probes and Research Chemicals, Molecular Probes, Inc.; Brinkley (1992) Bioconjugate Chem. 3:2; Garman, (1997) Non-Radioactive Labeling: A Practical Approach, Academic Press, London; Means (1990) Bioconjugate Chem. 1:2; Glazer et al Chemical Modification of Proteins. Laboratory Techniques in Biochemistry and Molecular Biology (T. S. Work and E. Work, Eds.) American Elsevier Publishing Co., New York; Lundblad, R. L. and Noyes, C. M. (1984) Chemical Reagents for Protein Modification, Vols. I and II, CRC Press, New York; Pfleiderer, G. (1985) "Chemical Modification of Proteins", Modern Methods in Protein Chemistry, H. Tschesche, Ed., Walter DeGruyter, Berlin and New York и Wong (1991) Chemistry of Protein Conjugation and Cross-linking, CRC Press, Boca Raton, Fla.); DeLeon-Rodriguez et al, Chem. Eur. J. 10 (2004) 1149-1155; Lewis et al, Bioconjugate Chem. 12 (2001) 320-324; Li et al, Bioconjugate Chem. 13 (2002) 110-115; Mier et al Bioconjugate Chem. 16 (2005) 240-237.

Линкер

Термин «линкер» обозначает бифункциональную или мультифункциональную группировку, которую можно использовать для конъюгирования (связывания) первой группировки со второй группировкой. Связанные конъюгаты могут быть с удобством получены с использованием линкера, имеющего две реакционноспособные функциональные группы.

В одном воплощении линкер имеет реакционноспособный сайт, который имеет электрофильную группу, которая реагирует с нуклеофильной группой, присутствующей в сортазной аминокислотной последовательности. Полезные электрофильные группы включают другую тиольную, малеимидную и галогенацетамидную группы (см., например, способ конъюгирования на стр. 766 Klussman et al, Bioconjugate Chemistry 15(4) (2004) 765-773), но не ограничиваются ими.

Примеры функциональных групп, реагирующих с тиолом, включают тиол, малеимид, альфа-галогенацетил, активированные сложные эфиры, такие как сложные эфиры сукцинимида, 4-нитрофениловые сложные эфиры, пентафторфениловые сложные эфиры, тетрафторфениловые сложные эфиры, ангидриды, хлорангидриды, сульфонилхлориды, изоцианаты и изотиоцианаты, но не ограничиваются ими.

Линкер может содержать аминокислотные остатки, которые связывают сортазную аминокислотную последовательность с группировкой несортазного мотива. Аминокислотные остатки могут образовать дипептидное, трипептидное, тетрапептидное, пентапептидное, гексапептидное, гептапептидное, октапептидное, нонапептидное, декапептидное, ундекапептидное или додекапептидное звено. Аминокислотные остатки включают аминокислотные остатки, встречающиеся в природе, а также не встречающиеся в природе аминокислотные аналоги, такие как, например, цитруллин или α-аминокислоты, такие как, например, β-аланин, или α-аминокислоты, такие как 4-аминомасляная кислота.

В другом воплощении линкер имеет реакционноспособную функциональную группу, которая имеет нуклеофильную группу, которая реагирует с электрофильной группой, присутствующей в сортазной аминокислотной последовательности. Полезные электрофильные группы включают карбонильные группы альдегидов и кетонов, но не ограничиваются ими. Гетероатом нуклеофильной группы линкера может реагировать с электрофильной группой в сортазной аминокислотной последовательности и образовать ковалентную связь с сортазной аминокислотной последовательностью. Полезные нуклеофильные группы на линкере включают гидразидную, оксимовую, амино, гидразиновую, тиосемикарбазоновую, гидразинкарбоксилатную и арилгидразидную, но не ограничиваются ими. Электрофильная группа на антигене (гаптене) дает удобный сайт для присоединения к линкеру.

Типично линкеры пептидного типа можно получать путем образования пептидной связи между двумя или более чем двумя аминокислотами и/или пептидными фрагментами. Такие пептидные связи можно получать, например, согласно способу синтеза в жидкой фазе (E. Schroder and K. Lubke "The Peptides", volume 1 (1965) 76-136, Academic Press), который хорошо известен в области пептидной химии.

В другом воплощении линкер может быть замещен группами, которые модулируют растворимость или реакционную способность. Например, заряженный заместитель, такой как сульфонат (SO3-) или аммоний, или полимер, такой как ПЭГ, может увеличивать растворимость реактива в воде и облегчать реакцию связывания линкерного реактива с антигеном (гаптеном) или лекарственной группировкой, или облегчать реакцию связывания, в зависимости от используемого пути синтеза.

Конъюгаты, содержащие группировку несортазного мотива, как описано в данном документе, прямо предусматривают комплексы, полученные со следующими линкерными реактивами: BMPEO, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, сульфо-EMCS, сульфо-GMBS, сульфо-KMUS, сульфо-MBS, сульфо-SIAB, сульфо-SMCC, сульфо-SMPB и SVSB (сукцинимидил-(4-винилсульфон)бензоат), и включая бис-малеимидные реактивы: DTME, BMB, BMDB, BMH, BMOE, BM(PEO)3 и BM(PEO)4, которые имеются в продаже у Pierce Biotechnology, Inc., но не ограничиваются ими. Бис-малеимидные реактивы обеспечивают последовательное или одновременное присоединение, например, тиольной группы к тиолсодержащей лекарственной группировке, метке или линкерному промежуточному соединению. Другие функциональные группы, помимо малеимида, которые реагируют, например, с тиольной группой, включают йодацетамид, бромацетамид, винилпиридин, дисульфид, пиридилдисульфид, изоцианат и изотилцианат.

Типичный линкер включает валин-цитруллиновый (val-сit или vc) дипептидный линкерный реактив, имеющий малеимидную ширилку и пара-аминобензилкарбамоильный (РАВ) самораспадающийся спейсер, и phe-lys(Mtr) дипептидный линкерный реактив, имеющий малеимидную ширилку и п-аминобензильный самораспадающийся спейсер.

Тиольные группы цистеина являются нуклеофильными и способными к реакции с образованием ковалентных связей с электрофильными группами на линкерных реактивах и группировке несортазного мотива или сортазной аминокислотной последовательности, включая: (i) активные сложные эфиры, такие как сложные эфиры NHS, сложные эфиры HOBt, галогенформиаты и хлорангидриды; (ii) алкил- и бензилгалогениды, такие как галогенацетамиды; (iii) альдегиды, кетоны, карбоксильные и малеимидные группы; и (iv) дисульфиды, включающие пиридилдисульфиды, образующиеся посредством сульфидного обмена. Нуклеофильные группы на гаптенилированном соединении включают аминогруппу, тиольную, гидроксильную, гидразидную, оксимовую, гидразиновую, тиосемикарбазоновую, гидразинкарбоксилатную и арилгидразидную группы, способные к реакции с образованием ковалентных связей с электрофильными группами на линкерных группировках и линкерных реактивах, но не ограничиваются ими.

ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ

Фиг. 1. Схема сортазной реакции; (1) продукты извлечения, (2) продукты, (3) гидролиз (побочная реакция, приводящая к побочным продуктам).

Фиг. 2. Гель SDS-PAGE (электрофорез в полиакриламидном геле с додецилсульфатом натрия) смеси ферментативной реакции через 16 часов и 40 часов.

Фиг. 3. Динамика максимального выхода, в зависимости от используемых субстратов; квадрат: LPKTG+G, ромб: LPKTG+А.

Фиг. 4. Динамика максимального выхода, в зависимости от используемых субстратов; квадрат: LPKTG+G, ромб: LPKTG+А.

Следующие примеры, графические материалы и последовательности приведены для помощи в понимании настоящего изобретения, истинный объем которого изложен в приложенной формуле изобретения. Понятно, что в изложенных методиках могут быть сделаны модификации без отступления от сущности изобретения.

Хотя вышеизложенное изобретение и было описано в некоторых подробностях посредством иллюстрации и примера для целей ясности понимания, данные описания и примеры не следует истолковывать, как ограничивающие объем изобретения.

ПРИМЕРЫ

Методики генной инженерии

Для манипулирования с ДНК использовали стандартные способы, как описано в Sambrook, J. et al., Molecular cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989. Реактивы для молекулярной биологии использовали согласно инструкциям изготовителей.

Синтез генов и олигонуклеотидов

Желательные сегменты генов получали химическим синтезом в Geneart GmbH (Регенсбург, Германия). Синтезированные фрагменты генов клонировали в плазмиду E. coli для размножения/амплификации. Последовательности ДНК субклонированных фрагментов генов подтверждали секвенированием ДНК. В качестве альтернативы, короткие фрагменты синтетической ДНК собирали посредством отжига химически синтезированных олигонуклеотидов или посредством ПЦР (полимеразная цепная реакция). Соответствующие олигонуклеотиды были получены Metabion GmbH (Планегг-Мартинсрид, Германия).

Описание основной/стандартной экспрессионной плазмиды млекопитающих

Для экспрессии желательного гена/белка (например, полноразмерной тяжелой цепи антитела, полноразмерной легкой цепи антитела или цепи Fc, содержащей олигоглицин на ее N-конце) использовали транскрипционную единицу, содержащую следующие функциональные элементы:

- немедленный ранний энхансер и промотор из человеческого цитомегаловируса (Р-CMV), включая интрон А,

- 5'-нетранслируемая область (5'UTR) тяжелой цепи человеческого иммуноглобулина,

- сигнальная последовательность тяжелой цепи мышиного иммуноглобулина,

- ген/белок, подлежащий экспрессии (например, полноразмерная тяжелая цепь антитела) и

- последовательность полиаденилирования коровьего гормона роста (BGH pA).

Помимо экспрессионной единицы/кассеты, включающей желательный ген, подлежащий экспрессии, базовая/стандартная экспрессионная плазмида млекопитающего содержит:

- репликатор из вектора pUC18, который обеспечивает репликацию данной плазмиды в E. coli, и

- ген бета-лактамазы, который придает E. coli устойчивость к ампициллину.

Определение белка

Концентрацию белка очищенных полипептидов определяли посредством определения оптической плотности (ОП) при 280 нм, используя молярный коэффициент экстинкции, рассчитанный на основе аминокислотной последовательности полипептида.

Пример 1

Получение экспрессионной плазмиды для растворимой сортазы А S. aureus

Ген сортазы кодирует молекулу усеченной на N-конце сортазы А (60-206) (аминокислотная последовательность SEQ ID NO: 21).

Экспрессионная плазмида для временной экспрессии растворимой сортазы в клетках HEK293, помимо экспрессионной кассеты ратвормой сортазы, содержала репликатор из вектора pUC18, который обеспечивает репликацию данной плазмиды в E. coli, и ген бета-лактамазы, который придает устойчивость к ампициллину у E. coli.

Транскрипционная единица растворимой сортазы содержала следующие функциональные элементы:

- немедленный ранний энхансер и промотор из человеческого цитомегаловируса (P-CMV), включая интрон А,

- 5'-нетранслируемая область (5'UTR) тяжелой цепи человеческого иммуноглобулина,

- сигнальная последовательность тяжелой цепи мышиного иммуноглобулина,

- нуклеиновая кислота, кодирующая метку для очистки,

- нуклеиновая кислота, кодирующая усеченную на N-конце сортазу А S. aureus, и

- последовательность полиаденилирования коровьего гормона роста (BGH pA).

Аминокислотная последовательность зрелой растворимой сортазы является следующей:

QAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK (SEQ ID NO: 21).

Метка для очистки имеет аминокислотную последовательность MRGSHHHHHHGS (SEQ ID NO: 31).

Пример 2

Временная экспрессия и аналитическая характеризация

Рекомбинантную продукцию проводили посредством временной трансфекции клеток HEK293 (происходящие из линии клеток человеческой эмбриональной почки 293), культивируемых в среде F17 (Invitrogen Corp.). Для трансфекции использовали трансфекционный реактив «293-Fectin» (Invitrogen). Трансфекцию проводили, как определено в инструкциях изготовителя. Супернатанты культуры клеток отбирали через три-семь (3-7) суток после трансфекции. Супернатанты хранили при пониженной температуре (например, при -80°С).

Общая информация относительно рекомбинантной экспрессии человеческих иммуноглобулинов, например, в клетках HEK293, приводится в: Meissner, P. et al., Biotechnol. Bioeng. 75 (2001) 197-203.

Концентрацию белка определяли посредством измерения оптической плотности (ОП) при 280 нм, используя молярный коэффициент экстинкции, рассчитанный на основе аминокислотной последовательности. Чистоту анализировали посредством SDS-PAGE в присутствии и в отсутствие восстанавливающего агента (5 мМ 1,4-дитиотрейтол) и окрашивания кумасси бриллиантовым синим.

Пример 3

Опосредованное сортазой конъюгирование

Реакционную смесь, содержащую 100 мкМ фрагмент области Fc, содержащий С-концевой сортазный мотив LPETG (SEQ ID NO: 30), 100 мкМ фрагмент области Fc, содержащий N-концевой трехаланиновый мотив (SEQ ID NO: 27) и 10 мкМ сортазу А Staphylococcus aureus в 50 мМ Tris, pH 7,5; 150 мМ NaCl, 5 мМ CaCl2, инкубировали при 37°С в течение 40 часов.

В образцах, отобранных через 16 часов и 40 часов, реакцию осанавливали нагреванием до 90°С.

Образцы (32,5 мкл), дополненные 5 мкл восстанавливающего агента (Novex) и 12,5 мкл буфера для образца (Novex), инкубировали в течение 10 мин при 90°С. 20 мкл каждого препарата загружали на 4-12%-ный Bis-Tris градиентный гель (Novex). Гель-электрофорез проводили в 1× буфере MOPS (Novex) при 200 В и 120 мА в течение 35 мин.

Пример 4

Анализ сортазной активности

С использованием способа, описанного ниже, активность опосредованной сортазой ферментативной реакции конъюгирования/связывания можно определять фотометрически посредством слияния глюкозодегидрогеназы в качестве репортерного фермента с сортазным аминокислотным мотивом (LPETG или LPETA) и используя это в качестве первого субстрата. В качестве второго субстрата используется биотинилированный олигоглицин или олигоаланин (нуклеофил). При добавлении сортазы в раствор, содержащий первый и второй субстрат, образуется конъюгат путем опосредованного сортазой конъюгирования первого и второго субстрата, который представляет собой биотинилированный репортерный фермент. Биотинилированный репортерный фермент может быть выделен с использованием магнитных шариков, покрытых стрептавидином. При добавлении субстрата для репортерного фермента продукт может быть выявлен посредством изменения оптической плотности.

Очищенную сортазу смешивали с ее субстратами, т.е. с глюкозодегидрогеназой, содержащей мотив LPETG или LPETA (20 мкМ), и производным биотина, содержащим N-концевые глицины или аланины (330 мкМ) в 50 мМ буфере Tris, рН 7,5, содержащем 200 мМ NaCl. Реакционную смесь инкубировали при 37°С в течение двух часов. Реакцию останавливали добавлением 10-20-кратного избытка ингибирующего буфера (50 мМ Tris, рН 7,5, 200 мМ NaCl, 10 мМ CaCl2, 5 мМ йодацетамид). Реакционную смесь с остановленной реакцией центрифугировали при 5000 g в течение 10 мин. Супернатант (50 мкл) добавляли к 100 мкл 50 мМ буфера Tris (pH 7,5), содержащего 200 мМ NaCl, 10 мМ CaCl2, и добавляли магнитные шарики, покрытые стрептавидном, и инкубировали в течение 30 мин при 30°С при 200 об./мин. Затем магнитные шарики пять раз промывали каждый раз 300 мкл промывочного буфера (50 мМ Tris, pH 7,5, 200 мМ NaCl, 10 мМ CaCl2, 5 мг/мл BSA, 0,1% Triton X-100) в многолуночных планшетах с V-образным дном с использованием магнита и вакуумного насоса. Затем шарики ресуспендировали в 100 мкл цитратного буфера для тестирования, и его 10-80 мкл переносили в новую лунку. В нее добавляли 150 мкл буфера для тестирования (0,2 М цитрат натрия, рН 5,8, 0,3 г/л 4-нитрозоанилина, 1 мМ CaCl2, 30 мМ глюкоза).

Кинетика репортерного фермента измеряется в течение периода времени 5 мин при 620 нм. Активность репортерного фермента является пропорциональной количеству иммобилизованного фермента, которое пропорционально количеству биотинилированного фермента, и оно является пропорциональным активности сортазы.

Пример 5

Проведение анализа образования и деградации продукта посредством анализа активности сортазы

Указанные концентрации Sa-SrtA - глюкозодегидрогеназы, содержащей сортазный мотив LPKTG, и GGGG-биотин или АААА-биотин, инкубировали в течение указанных промежутков времени. Реакцию останавливали и проводили анализ, следуя методике, описанной в Примере 4, с использованием магнитных шариков. Для реакции с 10 мкМ биотином осуществляли блокирование реакционной смеси с использованием 20-кратного избытка ингибирующего буфера, реакционную смесь со 100 мкМ биотином блокировали 100-кратным избытком ингибирующего буфера. Измеренная активность (dE/мин) пропорциональна выходу сортазной реакции. Для каждого условия реакции максимальный выход был принят за 100%. Выходы в другие моменты времени нормировали к 100%.

Эксперимент 1 (Фиг. 3):

Исходными веществами были 120 мкМ белок, содержащий LPKTG, 500 мкМ сортаза А Staphylococcus aureus, 10 мкМ GGGG-биотин/АААА-биотин.

 время [ч] 3 7 20 30
LPKTG + A 100% 95% 100% 98%
LPKTG + G 100% 69% 44% 25%

Эксперимент 2 (Фиг. 4):

Исходными веществами были 20 мкМ белок, содержащий LPKTG, 125 мкМ сортаза А Staphylococcus aureus, 100 мкМ GGG/ААА.

  3 7 20 30
LPKTG + A 49% 76% 100% 100%
LPKTG + G 95% 100% 85% 67%

--->

SEQUENCE LISTING

<110> F. Hoffmann-La Roche AG

<120> Новые способы опосредованного ферментами конъюгирования полипептидов

<130> P32480-WO

<150> EP14198532.5

<151> 2014-12-17

<160> 31

<170> PatentIn version 3.5

<210> 1

<211> 5

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> Arg-tag

<400> 1

Arg Arg Arg Arg Arg

1 5

<210> 2

<211> 6

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> Arg-tag 2

<400> 2

Arg Arg Arg Arg Arg Arg

1 5

<210> 3

<211> 6

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> His-tag

<400> 3

His His His His His His

1 5

<210> 4

<211> 19

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 4

Lys Asp His Leu Ile His Asn Val His Lys Glu Phe His Ala His Ala

1 5 10 15

His Asn Lys

<210> 5

<211> 8

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 5

Asp Tyr Lys Asp Asp Asp Asp Lys

1 5

<210> 6

<211> 22

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 6

Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp Ile Asp Tyr

1 5 10 15

Lys Asp Asp Asp Asp Lys

20

<210> 7

<211> 9

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 7

Ala Trp Arg His Pro Gln Phe Gly Gly

1 5

<210> 8

<211> 8

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 8

Trp Ser His Pro Gln Phe Glu Lys

1 5

<210> 9

<211> 10

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 9

Met Asp Val Glu Ala Trp Leu Gly Ala Arg

1 5 10

<210> 10

<211> 16

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 10

Met Asp Val Glu Ala Trp Leu Gly Ala Arg Val Pro Leu Val Glu Thr

1 5 10 15

<210> 11

<211> 38

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 11

Met Asp Glu Lys Thr Thr Gly Trp Arg Gly Gly His Val Val Glu Gly

1 5 10 15

Leu Ala Gly Glu Leu Glu Gln Leu Arg Ala Arg Leu Glu His His Pro

20 25 30

Gln Gly Gln Arg Glu Pro

35

<210> 12

<211> 10

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 12

Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu

1 5 10

<210> 13

<211> 15

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 13

Lys Glu Thr Ala Ala Ala Lys Phe Glu Arg Gln His Met Asp Ser

1 5 10 15

<210> 14

<211> 26

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 14

Lys Arg Arg Trp Lys Lys Asn Phe Ile Ala Val Ser Ala Ala Asn Arg

1 5 10 15

Phe Lys Lys Ile Ser Ser Ser Gly Ala Leu

20 25

<210> 15

<211> 47

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> аминокислотная метка

<400> 15

Pro Ala Thr Thr Thr Gly Ser Ser Pro Gly Pro Thr Gln Ser His Tyr

1 5 10 15

Gly Gln Cys Gly Gly Ile Gly Tyr Ser Gly Pro Thr Val Cys Ala Ser

20 25 30

Gly Thr Thr Cys Gln Val Leu Asn Pro Tyr Tyr Ser Gln Cys Leu

35 40 45

<210> 16

<211> 32

<212> ПРТ

<213> Butyrivibrio fibrisolvens

<400> 16

Met Asp Trp Asn Ala Asn Ile Ala Pro Gly Asn Ser Val Glu Phe Gly

1 5 10 15

Ile Gln Gly Ala Gly Ser Val Gly Asn Val Ile Asp Ile Thr Val Glu

20 25 30

<210> 17

<211> 51

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> хитинсвязывающий домен

<400> 17

Thr Asn Pro Gly Val Ser Ala Trp Gln Val Asn Thr Ala Tyr Thr Ala

1 5 10 15

Gly Gln Leu Val Thr Tyr Asn Gly Lys Thr Tyr Lys Cys Leu Gln Pro

20 25 30

His Thr Ser Leu Ala Gly Trp Glu Pro Ser Asn Val Pro Ala Leu Trp

35 40 45

Gln Leu Gln

50

<210> 18

<211> 209

<212> ПРТ

<213> Chondrus crispus

<400> 18

Met Pro Glu Ile Lys Leu Thr Tyr Phe Asp Met Arg Gly Arg Ala Glu

1 5 10 15

Ala Ser Arg Leu Ala Leu Val Val Gly Glu Ile Pro Phe Glu Asp Glu

20 25 30

Arg Val Val Phe Asp His Trp Lys Glu Ala Lys Pro Lys Thr Pro Tyr

35 40 45

Ala Ala Leu Pro Met Leu Thr Val Asp Gly Met Gln Val Ala Gln Ser

50 55 60

Asp Ala Ile Leu Arg Tyr Cys Gly Lys Leu Ala Gly Leu Tyr Pro Ser

65 70 75 80

Asp Pro Leu Glu Ala Ala Lys Val Asp Glu Val Gly Gly Val Ile Asp

85 90 95

Asp Val Thr His Ala Met Tyr Arg Tyr Arg Gly Asp Asp Lys Asp Lys

100 105 110

Leu Arg Glu Glu Arg Asp Lys Phe Ser Lys Val Asp Val Pro Arg Tyr

115 120 125

Val Gly Ala Leu Glu Lys Arg Leu Glu Ala Phe Gly Asp Gly Pro Trp

130 135 140

Ala Val Gly Gly Asn Met Thr Ile Ala Asp Leu His Ile Cys His Leu

145 150 155 160

Val Thr Asn Ile Arg Cys Gly Met Leu Asp Phe Val Asp Lys Asp Leu

165 170 175

Leu Glu Gly Tyr Val Arg Ile Val Lys Ser Tyr Ser Ala Val Met Glu

180 185 190

His Pro Lys Val Thr Glu Trp Tyr Glu Lys Lys Pro Val Lys Met Phe

195 200 205

Ser

<210> 19

<211> 396

<212> ПРТ

<213> Escherichia coli

<400> 19

Met Lys Ile Lys Thr Gly Ala Arg Ile Leu Ala Leu Ser Ala Leu Thr

1 5 10 15

Thr Met Met Phe Ser Ala Ser Ala Leu Ala Lys Ile Glu Glu Gly Lys

20 25 30

Leu Val Ile Trp Ile Asn Gly Asp Lys Gly Tyr Asn Gly Leu Ala Glu

35 40 45

Val Gly Lys Lys Phe Glu Lys Asp Thr Gly Ile Lys Val Thr Val Glu

50 55 60

His Pro Asp Lys Leu Glu Glu Lys Phe Pro Gln Val Ala Ala Thr Gly

65 70 75 80

Asp Gly Pro Asp Ile Ile Phe Trp Ala His Asp Arg Phe Gly Gly Tyr

85 90 95

Ala Gln Ser Gly Leu Leu Ala Glu Ile Thr Pro Asp Lys Ala Phe Gln

100 105 110

Asp Lys Leu Tyr Pro Phe Thr Trp Asp Ala Val Arg Tyr Asn Gly Lys

115 120 125

Leu Ile Ala Tyr Pro Ile Ala Val Glu Ala Leu Ser Leu Ile Tyr Asn

130 135 140

Lys Asp Leu Leu Pro Asn Pro Pro Lys Thr Trp Glu Glu Ile Pro Ala

145 150 155 160

Leu Asp Lys Glu Leu Lys Ala Lys Gly Lys Ser Ala Leu Met Phe Asn

165 170 175

Leu Gln Glu Pro Tyr Phe Thr Trp Pro Leu Ile Ala Ala Asp Gly Gly

180 185 190

Tyr Ala Phe Lys Tyr Glu Asn Gly Lys Tyr Asp Ile Lys Asp Val Gly

195 200 205

Val Asp Asn Ala Gly Ala Lys Ala Gly Leu Thr Phe Leu Val Asp Leu

210 215 220

Ile Lys Asn Lys His Met Asn Ala Asp Thr Asp Tyr Ser Ile Ala Glu

225 230 235 240

Ala Ala Phe Asn Lys Gly Glu Thr Ala Met Thr Ile Asn Gly Pro Trp

245 250 255

Ala Trp Ser Asn Ile Asp Thr Ser Lys Val Asn Tyr Gly Val Thr Val

260 265 270

Leu Pro Thr Phe Lys Gly Gln Pro Ser Lys Pro Phe Val Gly Val Leu

275 280 285

Ser Ala Gly Ile Asn Ala Ala Ser Pro Asn Lys Glu Leu Ala Lys Glu

290 295 300

Phe Leu Glu Asn Tyr Leu Leu Thr Asp Glu Gly Leu Glu Ala Val Asn

305 310 315 320

Lys Asp Lys Pro Leu Gly Ala Val Ala Leu Lys Ser Tyr Glu Glu Glu

325 330 335

Leu Ala Lys Asp Pro Arg Ile Ala Ala Thr Met Glu Asn Ala Gln Lys

340 345 350

Gly Glu Ile Met Pro Asn Ile Pro Gln Met Ser Ala Phe Trp Tyr Ala

355 360 365

Val Arg Thr Ala Val Ile Asn Ala Ala Ser Gly Arg Gln Thr Val Asp

370 375 380

Glu Ala Leu Lys Asp Ala Gln Thr Arg Ile Thr Lys

385 390 395

<210> 20

<211> 5

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> Аминокислотная последовательность сортазного мотива

<220>

<221> MISC_FEATURE

<222> (3)..(3)

<223> Xaa = может быть любой из 20 протеиногенных аминокислот

<400> 20

Leu Pro Xaa Thr Gly

1 5

<210> 21

<211> 147

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> зрелая растворимая сортаза

<400> 21

Gln Ala Lys Pro Gln Ile Pro Lys Asp Lys Ser Lys Val Ala Gly Tyr

1 5 10 15

Ile Glu Ile Pro Asp Ala Asp Ile Lys Glu Pro Val Tyr Pro Gly Pro

20 25 30

Ala Thr Pro Glu Gln Leu Asn Arg Gly Val Ser Phe Ala Glu Glu Asn

35 40 45

Glu Ser Leu Asp Asp Gln Asn Ile Ser Ile Ala Gly His Thr Phe Ile

50 55 60

Asp Arg Pro Asn Tyr Gln Phe Thr Asn Leu Lys Ala Ala Lys Lys Gly

65 70 75 80

Ser Met Val Tyr Phe Lys Val Gly Asn Glu Thr Arg Lys Tyr Lys Met

85 90 95

Thr Ser Ile Arg Asp Val Lys Pro Thr Asp Val Gly Val Leu Asp Glu

100 105 110

Gln Lys Gly Lys Asp Lys Gln Leu Thr Leu Ile Thr Cys Asp Asp Tyr

115 120 125

Asn Glu Lys Thr Gly Val Trp Glu Lys Arg Lys Ile Phe Val Ala Thr

130 135 140

Glu Val Lys

145

<210> 22

<211> 2

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоглициновый мотив

<400> 22

Gly Gly

1

<210> 23

<211> 3

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоглициновый мотив

<400> 23

Gly Gly Gly

1

<210> 24

<211> 4

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоглициновый мотив

<400> 24

Gly Gly Gly Gly

1

<210> 25

<211> 5

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоглициновый мотив

<400> 25

Gly Gly Gly Gly Gly

1 5

<210> 26

<211> 2

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоаланиновый мотив

<400> 26

Ala Ala

1

<210> 27

<211> 3

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоаланиновый мотив

<400> 27

Ala Ala Ala

1

<210> 28

<211> 4

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоаланиновый мотив

<400> 28

Ala Ala Ala Ala

1

<210> 29

<211> 5

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> олигоаланиновый мотив

<400> 29

Ala Ala Ala Ala Ala

1 5

<210> 30

<211> 5

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> сортазный мотив

<400> 30

Leu Pro Glu Thr Gly

1 5

<210> 31

<211> 12

<212> ПРТ

<213> Искусственная последовательность

<220>

<223> метка для очистки

<400> 31

Met Arg Gly Ser His His His His His His Gly Ser

1 5 10

<---

1. Способ получения продукта ферментативного конъюгирования двух полипептидов, включающий следующие стадии:

- инкубирование

i) первого полипептида, содержащего аминокислотную последовательность LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком),

ii) второго полипептида, который содержит олигоаланин Am (m равен 3 (SEQ ID NO: 27) или 4 (SEQ ID NO: 28)) на его N-конце,

iii) третьего полипептида с сортазной активностью, который получен из сортазы А Staphylococcus aureus, где третий полипептид имеет аминокислотную последовательность SEQ ID NO: 21, и

- выделение конъюгата из реакционной смеси и посредством этого получение продукта ферментативного конъюгирования двух полипептидов.

2. Способ по п.1, в котором первый полипептид содержит на его С-конце аминокислотную последовательность LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком).

3. Способ по п.2, в котором первый полипептид содержит на его С-конце аминокислотную последовательность LPETG (SEQ ID NO: 30).

4. Способ по любому из пп.1-3, в котором второй полипептид имеет на его N-конце олигоаланин SEQ ID NO: 26 или SEQ ID NO: 27.

5. Способ по любому из пп.1-4, в котором первый полипептид и второй полипептид независимо друг от друга выбраны из вариабельного домена антитела, фрагмента Fab тяжелой цепи антитела, области Fc антитела, метки, пептида, содержащего аминокислотную последовательность LPXTG (SEQ ID NO: 20, где Х может быть любым аминокислотным остатком), линкера и группировки несортазного мотива.



 

Похожие патенты:

Настоящее изобретение относится к области иммунологии и биотехнологии. Предложены новые варианты антител или их антигенсвязывающих фрагментов, которые специфично связываются с ММР9 и содержат вариабельные области тяжелой и легкой цепей, каждая из которых характеризуется наличием по меньшей мере соответствующих CDRs1-3.

Изобретение относится к биотехнологии. Описана система CRISPR класса 2, содержащая: (i) единичный полинуклеотид, содержащий (a) нацеленную на мишень область, содержащую дезоксирибонуклеиновую кислоту (ДНК) или рибонуклеиновую кислоту (РНК); и (b) активирующую область, смежную с указанной нацеленной на мишень областью, содержащую ДНК; и где указанная активирующая область содержит стебель и выпетливание и способна взаимодействовать с белком Cas9; и (ii) Cas9.

Группа изобретений относится к получению L-аминокислот. Предложена система расщепления глицина, содержащая ферменты GcvP, GcvT и GcvH, указанная система содержит по меньшей мере один из следующих полипептидов: фермент GcvP с последовательностью, которая по меньшей мере на 90% идентична последовательности под SEQ ID NO: 40, фермент GcvТ с последовательностью, которая по меньшей мере на 90% идентична последовательности под SEQ ID NO: 42, фермент GcvН с последовательностью, которая по меньшей мере на 90% идентична последовательности под SEQ ID NO: 38.

Изобретение относится к области биотехнологии. Предложена выделенная молекула нуклеиновой кислоты, кодирующая белок с фитазной активностью.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая соединение, содержащее модифицированный олигонуклеотид для снижения мРНК и/или белка ПКК (варианты), конъюгированное антисмысловое соединение, содержащее вышеуказанное соединение для снижения экспрессии мРНК и/или белка ПКК, композицию для предупреждения, лечения или облегчения связанного с ПКК заболевания, расстройства или состояния, применение соединения и применение композиции для предупреждения, лечения или облегчения связанного с ПКК заболевания, расстройства или состояния, применение соединения и применение композиции для лечения воспалительного заболевания или тромбоэмболического заболевания.

Изобретение относится к области биотехнологии. Предложена рекомбинантная плазмида pNanH, экспрессирующая клонированный ген nanH (нейраминидазы) Vibrio cholerae, встроенный по сайтам BamHI-PstI в полилинкер векторной плазмиды pQE30, под контролем Т5-промотора.

Изобретение относится к области биотехнологии. Предложен вариант сериновой протеазы субтилизина, аминокислотная последовательность которого включает комбинацию аминокислотных замен по сравнению с родительской протеазой субтилизином GG36 Bacillus lentus.

Группа изобретений относится к микроорганизму рода Saccharomyces, обладающему способностью продуцировать молочную кислоту по сравнению с немодифицированным микроорганизмом, и к способу продуцирования молочной кислоты с его использованием.

Изобретение относится к биотехнологии, в частности к получению рекомбинантной бутирилхолинэстеразы человека (БуХЭ). Предложена рекомбинантная плазмидная ДНК pPicZαA/BChE-14, обеспечивающая продукцию модифицированной бутирилхолинэстеразы человека rhBChE-14 и состоящая из нуклеотидной последовательности с SEQ ID NO.:1.

Группа изобретений относится к гетеротрофному микроорганизму, генетически модифицированному для продукции 1,2-пропандиола, и к способу получения 1,2-пропандиола. В указанном микроорганизме сверхэкспрессируется по меньшей мере один ген, кодирующий НАДФН-зависимую ацетолредуктазу, или мутантный ген gldA*, кодирующий НАДФН-зависимую глицеролдегидрогеназу, содержащую замену аминокислотного остатка аспарагиновой кислоты в положении 37 белка GldA Escherichia coli К12 на глицин, аланин или валин.

Группа изобретений относится к биотехнологии, а именно к применению Lys-C и способу протеолитического процессинга одноцепочечного ботулинического нейротоксина серотипа А (BoNT/A) для образования активного двухцепочечного ботулинического нейротоксина серотипа А (BoNT/A).
Группа изобретений относится к вариантам способа получения пищевого белкового ингредиента, а также пищевому белковому ингредиенту, полученному способом. Предложен способ получения пищевого белкового ингредиента, включающий обработку содержащего белок материала восстанавливающим агентом, хаотропным агентом, детергентом или их смесями.

Изобретение относится к области биотехнологии, конкретно к терапевтическим композициям секретоглобинов человека, и может быть использовано в медицине для предупреждения осложнений острых и хронических состояний дыхательной системы.

Группа изобретений относится к области биотехнологии. Представлен способ получения молекулярного комплекса, обладающего активностью GAA (кислой альфа-глюкозидазы), включающий контактирование полипептида с активностью GAA с протеазой из гриба вида Aspergillus oryzae, при этом указанная протеаза расщепляет указанный полипептид в одном или более сайтах между аминокислотой 50 и аминокислотой 74 последовательности указанного полипептида.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению белков, и может быть использовано для получения поверхностно-активных белков.

Группа изобретений относится к неочищенному ферментному препарату, способу его получения и применению указанного препарата. Предложен неочищенный ферментный препарат для гидролиза зернового продукта, полученный в процессе ферментации коджи в твердом состоянии.

Настоящее изобретение относится к области биотехнологии, конкретно к получению меченого альдегидом антитела для конъюгации с интересующим лекарственным средством, и может быть использовано в медицине.

Группа изобретений относится к пищевой, сельскохозяйственной, косметической и фармацевтической отраслям. Получают суспензию растительных белков, выбранных из группы, включающей гороховые белки, картофельные белки и кукурузные белки, с содержанием сухого вещества от 10 до 15%.

Группа изобретений относится к молочной промышленности. Молочный продукт с гидролизованным белком с низким содержанием лактозы получают следующим способом.

Изобретение относится к биотехнологии и представляет собой выделенный полипептид, обладающий трипсиноподобной эндопептидазной активностью. Изобретение касается также способа получения такого полипептида, включающего культивирование рекомбинантной клетки-хозяина Bacillus subtilis, содержащей полинуклеотид, кодирующий заявленный полипептид, функционально связанный с одной или более контрольными последовательностями, которые направляют продукцию полипептида в условиях, благоприятных для продукции полипептида; и выделения полипептида.

Изобретение относится к области биотехнологии. Предложено моющее или чистящее средство, содержащее комбинацию протеазы и α-амилазы.

Изобретение относится к области биотехнологии. Предложен способ получения продукта ферментативного конъюгирования двух полипептидов. Осуществляют инкубирование первого полипептида, содержащего аминокислотную последовательность LPXTG, второго полипептида, который имеет на его конце олигоаланиновую аминокислотную последовательность Am, и третьего полипептида с сортазной активностью, полученного из сортазы А Staphylococcus aureus. Затем выделяют конъюгат из реакционной смеси. Изобретение обеспечивает подавление обратной реакции или гидролиза образовавшегося продукта. 4 з.п. ф-лы, 4 ил., 1 табл., 5 пр.

Наверх