Неоантигены и способы их использования

Авторы патента:


Неоантигены и способы их использования
Неоантигены и способы их использования
Неоантигены и способы их использования
Неоантигены и способы их использования
Неоантигены и способы их использования
Неоантигены и способы их использования
Неоантигены и способы их использования
Неоантигены и способы их использования
Неоантигены и способы их использования

Владельцы патента RU 2773273:

БайоНТек ЮЭс Инк. (US)

Изобретение относится к области биотехнологии, конкретно к фармацевтической композиции, содержащей неоантигенный пептид, для применения при лечении рака молочной железы. Полученная фармацевтическая композиция содержит неоантигенный пептид, содержащий опухолеспецифичный неоэпитоп, содержащий одну или несколько смежных мутантных аминокислот, кодируемых последовательностью, полученной мутацией сдвига рамки считывания в GATA3 гене, где опухолеспецифичный неоэпитоп кодируется GATA3 геном раковых клеток субъекта или экспрессируется раковыми клетками субъекта, и может быть использована для эффективного лечения рака молочной железы. 22 з.п. ф-лы, 9 ил., 3 табл., 9 пр.

 

ПЕРЕКРЕСТНЫЕ ССЫЛКИ

[1] По настоящей заявке испрашивается приоритет предварительной заявки США № 62/316530, зарегистрированной 31 марта 2016 года, предварительной заявки США № 62/316533, зарегистрированной 31 марта 2016 года, предварительной заявки США № 62/316547, зарегистрированной 31 марта 2016 года, предварительной заявки США № 62/316552, зарегистрированной 31 марта 2016 года, предварительной заявки США № 62/316567, зарегистрированной 1 апреля 2016 года, и предварительной заявки США № 62/316571, зарегистрированной 1 апреля 2016 года, каждая из которых полностью включена в настоящее описание посредством ссылки.

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

[2] Настоящее изобретение относится к области иммунотерапевтических пептидов, нуклеиновых кислот, кодирующих пептиды, связывающих пептиды средств, и их использованию, например, в иммунотерапии злокачественной опухоли. В одном из аспектов изобретение относится к неоантигенным пептидам, пригодным отдельно или в комбинации с другими опухолеассоциированными пептидами, средствами против злокачественной опухоли или иммуномодулирующими средствами для лечения злокачественной опухоли.

УРОВЕНЬ ТЕХНИКИ, ПРЕДШЕСТВУЮЩИЙ ИЗОБРЕТЕНИЮ

[3] Противоопухолевые вакцины, как правило, состоят из опухолевых антигенов и иммуностимулирующих молекул (например, адъювантов, цитокинов или лигандов TLR), которые действую совместно, индуцируя антиген-специфичные цитотоксические T-клетки (CTL), которые распознают и лизируют опухолевые клетки. Такие вакцины содержат общие тканеспецифические опухолевые антигены или смесь общих и специфических для пациента антигенов в форме препаратов на основе целых опухолевых клеток. Общие тканеспецифические опухолевые антигены в идеале являются иммуногенными белками с избирательной экспрессией в опухолях у многих индивидуумов, и обычно их доставляют пациентам в виде синтетических пептидов или рекомбинантных белков. В противоположность этому, препараты на основе целых опухолевых клеток доставляют пациентам в виде аутологичных облученных клеток, клеточных лизатов, слияний клеток, препараты на основе белков теплового шока или тотальной иРНК. Вследствие того, что целые опухолевые клетки выделяют у аутологичного пациента, клетки могут содержать специфические для пациента опухолевые антигены, а также общие опухолевые антигены. Наконец, существует третий класс опухолевых антигенов, неоантигены, которые редко используют в вакцинах, которые состоят из белков с опухолеспецифичными мутациями (которые могут быть специфическими для пациента или общими), которые приводят к измененным аминокислотным последовательностям. Такие мутантные белки: (a) являются уникальными для опухолевой клетки, т.к. мутация и соответствующей ей белок присутствуют только в опухоли; (b) избегают центральной толерантности и следовательно с большей вероятностью будут являются иммуногенными; (c) обеспечивают прекрасную мишень для иммунологического распознавания, включая гуморальный и клеточный иммунитет. Однако для использования персонализированных неоантигенов необходимым является секвенирование генома каждого пациента, а затем получение композиции со специфическими для пациента неоантигенами. Таким образом, все еще существует необходимость в разработке дополнительных терапевтических средств против злокачественных опухолей.

КРАТКОЕ ОПИСАНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

[4] В настоящем описании предоставлен выделенный неоантигенный пептид, содержащий опухолеспецифичный неоэпитоп, где выделенный неоантигенный пептид не является нативным полипептидом, где неоэпитоп содержит по меньшей мере 8 смежных аминокислот аминокислотной последовательности, представленной: AxByCz, где каждый из A и C представляет собой аминокислоту, соответствующую нативному полипептиду, y представляет собой по меньшей мере 1, и B представляет собой замену или вставку аминокислоты нативного полипептида, x+y+z составляет по меньшей мере 8, по меньшей мере 8 смежных аминокислот содержат By, и нативный полипептид кодируется геном, выбранным из группы, состоящей из: (a) ABL1, где AxByCz представляет собой (i) VADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGKVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVC, (ii) VADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGVVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVC, (iii) LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSATEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF, (iv) SLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLA или (v) STVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQHGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLG; (b) ALK, где AxByCz представляет собой (i) SSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIADFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLL или (ii) QVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFI; (c) BRAF, где AxByCz представляет собой MIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELM; (d) BTK, где AxByCz представляет собой MIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGSLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVND; (e) EEF1B2, где AxByCz представляет собой MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGAT; (f) EGFR, где AxByCz представляет собой (i) SLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIRNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLL или (ii) IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA; (g) ERBB3, где AxByCz представляет собой ERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRMVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDK; (h) ESR1, где AxByCz представляет собой (i) HLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEA, (ii) NQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLPSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSH, (iii) IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLCDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE, (iv) IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLNDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE или (v) IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE; (i) FGFR3, где AxByCz представляет собой HRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERCPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVG; (j) FRG1B, где AxByCz представляет собой AVKLSDSRIALKSGYGKYLGINSDELVGHSDAIGPREQWEPVFQNGKMALSASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAEKETKKKDDIPEEDKG; (k) HER2, где AxByCz представляет собой GSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGLGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCM; (l) IDH1, где AxByCz представляет собой (i) RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM, (ii) RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGCHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM, (iii) RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGGHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM, или (iv) RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGSHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM; (m) НАБОР, где AxByCz представляет собой (i) VEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIANLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYK, или (ii) VEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIANLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYK; (n) MEK, где AxByCz представляет собой (i) ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHESNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI или (ii) LGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSLYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVI; (o) MYC, где AxByCz представляет собой (i) MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSDLQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGG, (ii) FTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLSTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLG или (iii) TNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPIPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGG; (p) PDGFRa, где AxByCz представляет собой VAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIIIEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSYVILS; (q) PIK3CA, где AxByCz представляет собой (i) IEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSKITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPP, (ii) HANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITKQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKP, или (iii) LFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDARHGGWTTKMDWIFHTIKQHALN; (r) POLE, где AxByCz представляет собой QRGGVITDEEETSKKIADQLDNIVDMREYDVPYHIRLSIDIETTKLPLKFRDAETDQIMMISYMIDGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFN; (s) PTEN, где AxByCz представляет собой KFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGQTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY; (t) RAC1, где AxByCz представляет собой MQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGET; и (u) TP53, где AxByCz представляет собой (i) IRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGSMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEP, (ii) TYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRHCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEV, (iii) EGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNQRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHE, (iv) EGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNWRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHE или (v) PEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPL.

[5] В вариантах осуществления нативный полипептид кодируется геном EGFR, ERBB3 или FGFR3, и по меньшей мере один By экспрессируется внеклеточно.

[6] В настоящем описании предоставлен выделенный неоантигенный пептид, содержащий опухолеспецифичный неоэпитоп, где выделенный неоантигенный пептид не является нативным полипептидом, где неоэпитоп содержит по меньшей мере 8 смежных аминокислот аминокислотной последовательности, представленной: AxByCz, где каждый A представляет собой аминокислоту, соответствующую нативному полипептид; By отсутствует; каждый C представляет собой аминокислоту, кодируемую сдвигом рамки считывания последовательности, кодирующей нативный полипептид; x+y+z составляет по меньшей мере 8; по меньшей мере 8 смежных аминокислот содержат по меньшей мере один Cz; и нативный полипептид кодируется геном, выбранным из группы, состоящей из: (a) APC, где Cz представляет собой (i) AKFQQCHSTLEPNPADCRVLVYLQNQPGTKLLNFLQERNLPPKVVLRHPKVHLNTMFRRPHSCLADVLLSVHLIVLRVVRLPAPFRVNHAVEW, (ii) APVIFQIALDKPCHQAEVKHLHHLLKQLKPSEKYLKIKHLLLKRERVDLSKLQ или (iii) MLQFRGSRFFQMLILYYILPRKVLQMDFLVHPA; (b) ARID1A, где Cz представляет собой (i) ALGPHSRISCLPTQTRGCILLAATPRSSSSSSSNDMIPMAISSPPKAPLLAAPSPASRLQCINSNSRITSGQWMAHMALLPSGTKGRCTACHTALGRGSLSSSSCPQPSPSLPASNKLPSLPLSKMYTTSMAMPILPLPQLLLSADQQAAPRTNFHSSLAETVSLHPLAPMPSKTCHHK, (ii) AHQGFPAAKESRVIQLSLLSLLIPPLTCLASEALPRPLLALPPVLLSLAQDHSRLLQCQATRCHLGHPVASRTASCILP, (iii) PILAATGTSVRTAARTWVPRAAIRVPDPAAVPDDHAGPGAECHGRPLLYTADSSLWTTRPQRVWSTGPDSILQPAKSSPSAAAATLLPATTVPDPSCPTFVSAAATVSTTTAPVLSASILPAAIPASTSAVPGSIPLPAVDDTAAPPEPAPLLTATGSVSLPAAATSAASTLDALPAGCVSSAPVSAVPANCLFPAALPSTAGAISRFIWVSGILSPLNDLQ, (iv) PCRAGRRVPWAASLIHSRFLLMDNKAPAGMVNRARLHITTSKVLTLSSSSHPTPSNHRPRPLMPNLRISSSHSLNHHSSSPLSLHTPSSHPSLHISSPRLHTPPSSRRHSSTPRASPPTHSHRLSLLTSSSNLSSQHPRRSPSRLRILSPSLSSPSKLPIPSSASLHRRSYLKIHLGLRHPQPPQ, (v) RTNPTVRMRPHCVPFWTGRILLPSAASVCPIPFEACHLCQAMTLRCPNTQGCCSSWAS или (vi) TNQALPKIEVICRGTPRCPSTVPPSPAQPYLRVSLPEDRYTQAWAPTSRTPWGAMVPRGVSMAHKVATPGSQTIMPCPMPTTPVQAWLEA; (c) β2M, где Cz представляет собой (i) RMERELKKWSIQTCLSARTGLSISCTTLNSPPLKKMSMPAV или (ii) LCSRYSLFLAWRLSSVLQRFRFTHVIQQRMESQIS; (d) CDH1, где Cz представляет собой (i) RSACVTVKGPLASVGRHSLSKQDCKFLPFWGFLEEFLLC, (ii) IQWGTTTAPRPIRPPFLESKQNCSHFPTPLLASEDRRETGLFLPSAAQKMKKAHFLKTWFRSNPTKTKKARFSTASLAKELTHPLLVSLLLKEKQDG, (iii) PTDPFLGLRLGLHLQKVFHQSHAEYSGAPPPPPAPSGLRFWNPSRIAHISQLLSWPQKTEERLGYSSHQLPRK, (iv) FCCSCCFFGGERWSKSPYCPQRMTPGTTFITMMKKEAEKRTRTLT или (v) WRRNCKAPVSLRKSVQTPARSSPARPDRTRRLPSLGVPGQPWALGAAASRRCCCCCRSPLGSARSRSPATLALTPRATRSRCPGATWREAASWAE; (e) GATA3, где Cz представляет собой (i) PGRPLQTHVLPEPHLALQPLQPHADHAHADAPAIQPVLWTTPPLQHGHRHGLEPCSMLTGPPARVPAVPFDLHFCRSSIMKPKRDGYMFLKAESKIMFATLQRSSLWCLCSNH; или (ii) PRPRRCTRHPACPLDHTTPPAWSPPWVRALLDAHRAPSESPCSPFRLAFLQEQYHEA; (f) MLL2, где Cz представляет собой TRRCHCCPHLRSHPCPHHLRNHPRPHHLRHHACHHHLRNCPHPHFLRHCTCPGRWRNRPSLRRLRSLLCLPHLNHHLFLHWRSRPCLHRKSHPHLLHLRRLYPHHLKHRPCPHHLKNLLCPRHLRNCPLPRHLKHLACLHHLRSHPCPLHLKSHPCLHHRRHLVCSHHLKSLLCPLHLRSLPFPHHLRHHACPHHLRTRLCPHHLKNHLCPPHLRYRAYPPCLWCHACLHRLRNLPCPHRLRSLPRPLHLRLHASPHHLRTPPHPHHLRTHLLPHHRRTRSCPCRWRSHPCCHYLRSRNSAPGPRGRTCHPGLRSRTCPPGLRSHTYLRRLRSHTCPPSLRSHAYALCLRSHTCPPRLRDHICPLSLRNCTCPPRLRSRTCLLCLRSHACPPNLRNHTCPPSLRSHACPPGLRNRICPLSLRSHPCPLGLKSPLRSQANALHLRSCPCSLPLGNHPYLPCLESQPCLSLGNHLCPLCPRSCRCPHLGSHPCRLS; (g) PTEN, где Cz представляет собой (i) SWKGTNWCNDMCIFITSGQIFKGTRGPRFLWGSKDQRQKGSNYSQSEALCVLL, (ii) KRTKCFTFG, (iii) PIFIQTLLLWDFLQKDLKAYTGTILMM, (iv) QKMILTKQIKTKPTDTFLQILR, (v) GFWIQSIKTITRYTIFVLKDIMTPPNLIAELHNILLKTITHHS, (vi) NYSNVQWRNLQSSVCGLPAKGEDIFLQFRTHTTGRQVHVL или (vii) YQSRVLPQTEQDAKKGQNVSLLGKYILHTRTRGNLRKSRKWKSM; (h) TP53, где Cz представляет собой (i) SSQNARGCSPRGPCTSSSYTGGPCTSPLLAPVIFCPFPENLPGQLRFPSGLLAFWDSQVCDLHVLPCPQQDVLPTGQDLPCAAVG, (ii) GAAPTMSAAQIAMVWPLLSILSEWKEICVWSIWMTETLFDIVWWCPMSRLRLALTVPPSTTTTCVTVPAWAA, (iii) TGGPSSPSSHWKTPVVIYWDGTALRCVFVPVLGETGAQRKRISARKGSLTTSCPQGALSEHCPTTPAPLPSQRRNHWMENISPFRSVGVSASRCSES, (iv) FHTPARHPRPRHGHLQAVTAHDGGCEALPPP, (v) CCPRTILNNGSLKTQVQMKLPECQRLLPPWPLHQQLLHRRPLHQPPPGPCHLLSLPRKPTRAATVSVWASCILGQPSL, (vi) VRKHFQTYGNYFLKTTFCPPCRPKQWMI, или (vii) LARTPLPSTRCFANWPRPALCSCGLIPHPRPAPASAPWPSTSSHST; или (i) VHL, где Cz представляет собой (i) ELQETGHRQVALRRSGRPPKCAERPGAADTGAHCTSTDGRLKISVETYTVSSQLLMVLMSLDLDTGLVPSLVSKCLILRVK, (ii) KSDASRLSGA, (iii) RTAYFCQYHTASVYSERAMPPGCPEPSQA, (iv) TRASPPRSSSAIAVRASCCPYGSTSTASRSPTQRCRLARAAASTATEVTFGSSEMQGHTMGFWLTKLNYLCHLSMLTDSLFLPISHCQCIL, (v) SSLRITGDWTSSGRSTKIWKTTQMCRKTWSG, или (vi) RRRRGGVGRRGVRPGRVRPGGTGRRGGDGGRAAAARAALGELARALPGHLLQSQSARRAARMAQLRRRAAALPNAAAWHGPPHPQLPRSPLALQRCRDTRWASG; (j) ACVR2A, где AxByCz представляет собой (i) GVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKRQP, или (ii) GVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKTALKYIFVAVRAICVMKSFLIFRRWKSHSPLQIQLHLSHPITTSCSIPWCHLC; (k) C15ORF40, где AxByCz представляет собой TAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKVGLALFFFFFETKSCSVAQAGVQWRSLGSLQPPPPGFKLFSCLSFLSSWDYRRMPPCLANFCIFNRDGVSPCWSGWS; (l) CNOT1, где AxByCz представляет собой (i) LSVIIFFFVYIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFSVIFSTRCLTDSRYPNICWFK, или (ii) LSVIIFFFVYIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFCYILNTMFDR; (m) EIF2B3, где AxByCz или Cz представляет собой VLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKQWSSVTSLEWTAQERGCSSWLMKQTWMKSWSLRDPSYRSILEYVSTRVLWMPTSTV; (n) EPHB2, где AxByCz или Cz представляет собой SIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKREWEKRKQILGGGGKYKEYFLKRILIRKAMTVLAGDKKGLGRFMRCVQSETKAVSLQLPLGR; (o) ESRP1, где AxByCz представляет собой (i) LDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKKHEGQIC, или (ii) LDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKT; (p) FAM11B, где AxByCz представляет собой GALCKDGRFRSDIGEFEWKLKEGHKKIYGKQSMVDEVSGKVLEMDISKKKHYNRKISIKKLNRMKVPLMKLITRV; (q) GBP3, где AxByCz представляет собой RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKPRDICRIS; (r) JAK1, где AxByCz представляет собой (i) VNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLKTSN или (ii) CRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKNQQLKWTPHILKSAS; (s) LMAN1, где AxByCz представляет собой (i) DDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKRGIPEGPPRPPRAACGGNI, или (ii) DDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKRNSRRATPTSKGSLRRKYLRV; (t) MSH3, где AxByCz представляет собой (i) TKSTLIGEDVNPLIKLDDAVNVDEIMTDTSTSYLLCISENKENVRDKKKGQHFYWHCGSAACHRRGCV, или (ii) LYTKSTLIGEDVNPLIKLDDAVNVDEIMTDTSTSYLLCISENKENVRDKKRATFLLALWECSLPQARLCLIVSRTLLLVQS; (u) NDUFC2, где AxByCz представляет собой (i) LPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFCWILSCKT, или (ii) SLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFLLDIIL; (v) RBM27, где AxByCz представляет собой NQSGGAGEDCQIFSTPGHPKMIYSSSNLKTPSKLCSGSKSHDVQEVLKKKTGSNEVTTRYEEKKTGSVRKANRMPKDVNIQVRKKQKHETRRKSKYNEDFERAWREDLTIKR; (w) RPL22, где AxByCz представляет собой (i) MAPVKKLVVKGGKKKEASSEVHS, или (ii) MAPVKKLVVKGGKKRSKF; (x) SEC31A, где AxByCz представляет собой (i) MPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKN или (ii) MPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKLMLLRLNLRKMCGPF; (y) SEC63, где AxByCz представляет собой (i) AEVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKETFKKKTYTCAITTVKATETKAGKWSRWE, или (ii) MAEVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKRNL; (z) SLC35F5, где AxByCz представляет собой NIMEIRQLPSSHALEAKLSRMSYPVKEQESILKTVGKLTATQVAKISFFFALCGFWQICHIKKHFQTHKLL; (aa) SMAP1, где AxByCz представляет собой (i) YEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKGREKERKGARKAGKTTYS, или (ii) KYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKRKRKREKRSQKSRQNHLQLKSCRRKISNWSLKKVPALKKLRSPLWIF; (bb) TFAM, где AxByCz представляет собой (i) IYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKRVNTAWKTKKTSFSL, или (ii) IYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKS; (cc) TGFBR2, где AxByCz представляет собой (i) KPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKAW, или (ii) EKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKNITPAILTCC; (dd) THAP5, где AxByCz представляет собой VPSKYQFLCSDHFTPDSLDIRWGIRYLKQTAVPTIFSLPEDNQGKDPSKKNPRRKTWKMRKKYAQKPSQKNHLY; (ee) TTK, где AxByCz представляет собой GTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGESHNSSSSKTFEKKGEKNDLQLFVMSDTTYKIYWTVILLNPCGNLHLKTTSL; и (ff) XPOT, где AxByCz представляет собой QQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFLTFSQ.

[7] В настоящем описании предоставлен выделенный неоантигенный пептид, содержащий опухолеспецифичный неоэпитоп, где выделенный неоантигенный пептид не является нативным полипептидом, где неоэпитоп содержит по меньшей мере 8 смежных аминокислот аминокислотной последовательности, представленной: AxByCz, где каждый A представляет собой аминокислоту, соответствующую первому нативному полипептиду; каждый C представляет собой аминокислоту, соответствующую второму нативному полипептиду, или криптический экзон или экзон варианта сплайсинга первого нативного полипептида, каждый B представляет собой аминокислоту, которая не является аминокислотой, соответствующей первому нативному полипептиду, второму нативному полипептиду или криптическому экзону первого нативного полипептида, и x+y+z составляет по меньшей мере 8, где y отсутствует, и по меньшей мере 8 смежных аминокислот содержат по меньшей мере один Ax и по меньшей мере один Cz, или y представляет собой по меньшей мере 1, и по меньшей мере 8 смежных аминокислот содержат по меньшей мере один By, где: (a) первый нативный полипептид кодируется геном BCR, второй нативный полипептид кодируется геном ABL, и (i) y представляет собой 0, и AxByCz представляет собой ERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASG, или (ii) y представляет собой 1, и AxByCz представляет собой ELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNVIVHSATGFKQSSKALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGD; (b) первый нативный полипептид кодируется геном C11orf95, второй нативный полипептид кодируется геном RELA, y представляет собой 1, и AxByCz представляет собой ISNSWDAHLGLGACGEAEGLGVQGAEEEEEEEEEEEEEGAGVPACPPKGPELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTD; (c) первый нативный полипептид кодируется геном CBFB, и второй нативный полипептид кодируется геном MYH11, y представляет собой 0, и AxByCz представляет собой LQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQF; (d) первый нативный полипептид кодируется геном CD74, и второй нативный полипептид кодируется геном ROS1, y представляет собой 0, и AxByCz представляет собой KGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGCRITYYILEIRKSTSNNLQNQ; (e) первый нативный полипептид кодируется геном EGFR, и второй нативный полипептид кодируется (i) геном SEPT14, y представляет собой 0, и AxByCz представляет собой LPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQLQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTD; или (ii) геном EGFR, y представляет собой 1, и AxByCz представляет собой MRPSGTAGAALLALLAALCPASRALEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKD; (f) первый нативный полипептид кодируется геном EML4, второй нативный полипептид кодируется геном ALK, y представляет собой 1, и AxByCz представляет собой SWENSDDSRNKLSKIPSTPKLIPKVTKTADKHKDVIINQAKMSTREKNSQVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDL, (g) первый нативный полипептид кодируется геном FGFR3, второй нативный полипептид кодируется геном TACC3, y представляет собой 0, и AxByCz представляет собой EGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDVKATQEENRELRSRCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELS, (h) первый нативный полипептид кодируется геном NAB, второй нативный полипептид кодируется геном STAT6, y представляет собой по меньшей мере 1, и AxByCz представляет собой RDNTLLLRRVELFSLSRQVARESTYLSSLKGSRLHPEELGGPPLKKLKQEATSKSQIMSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCC; (i) второй нативный полипептид кодируется ERG, y представляет собой 0, и (i) первый нативный полипептид кодируется геном NDRG1, и AxByCz представляет собой MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDW, или (ii) первый нативный полипептид кодируется геном TMPRSS2, и AxByCz представляет собой MALNSEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDW; (j) первый нативный полипептид кодируется геном PML, второй нативный полипептид кодируется геном RARA, y представляет собой 1, и AxByCz представляет собой (i) VLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKG, или (ii) RSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKG; (k) первый нативный полипептид кодируется геном RUNX1, второй нативный полипептид кодируется геном CBFA2T1 (RUNX1T1), y представляет собой 1, и AxByCz представляет собой VARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGT; (l) первый нативный полипептид кодируется геном AR-v7, криптический экзон или экзон варианта сплайсинга кодируется геном AR-v7, y представляет собой 0, и AxByCz представляет собой SCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGEKFRVGNCKHLKMTRP.

[8] В настоящем описании предоставлен выделенный неоантигенный пептид, содержащий опухолеспецифичный неоэпитоп, где выделенный неоантигенный пептид не является нативным полипептидом, где неоэпитоп содержит по меньшей мере 8 смежных аминокислот аминокислотной последовательности, представленной: AxByCz, где каждый A представляет собой аминокислоту, соответствующую первому нативному полипептиду; каждый B представляет собой аминокислоту, которая не является аминокислотой, соответствующей первому нативному полипептиду или второму нативному полипептиду, каждый C представляет собой аминокислоту, кодируемую сдвигом рамки считывания последовательности, кодирующей второй нативный полипептид; x+y+z составляет по меньшей мере 8, где y отсутствует, и по меньшей мере 8 смежных аминокислот содержат по меньшей мере один Cz, или y представляет собой по меньшей мере 1, и по меньшей мере 8 смежных аминокислот содержат по меньшей мере один By и/или по меньшей мере один Cz; и (a) первый нативный полипептид кодируется геном AC011997.1, второй нативный полипептид кодируется геном LRRC69, y представляет собой 1, и AxByCz представляет собой MAGAPPPASLPPCSLISDCCASNQRDSVGVGPSEPGNNIKICNESASRK, (b) первый нативный полипептид кодируется геном EEF1DP3, второй нативный полипептид кодируется геном FRY, y представляет собой 1, и AxByCz представляет собой HGWRPFLPVRARSRWNRRLDVTVANGRSWKYGWSLLRVPQVNGIQVLNVSLKSSSNVISY, (c) первый нативный полипептид кодируется геном MAD1L1, второй нативный полипептид кодируется геном MAFK, y представляет собой 0, и AxByCz представляет собой RLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKLRVPGSSVLVTVPGL, или (d) первый нативный полипептид кодируется геном PPP1R1B, второй нативный полипептид кодируется геном STARD3, y представляет собой 1, и AxByCz представляет собой AEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSALLLRPRPPRPEVGAHQDEQAAQGADPRLGAQPACRGLPGLLTVPQPEPLLAPPSAA.

[9] В вариантах осуществления выделенный неоантигенный пептид содержит последовательность согласно таблице 1. В вариантах осуществления x+y+z составляет не более 500, не более 250, не более 150, не более 125 или не более 100. В вариантах осуществления x+y+z составляет по меньшей мере 8, по меньшей мере 50, по меньшей мере 100, по меньшей мере 200 или по меньшей мере 300. В вариантах осуществления z составляет не более 500, не более 250, не более 150, не более 125 или не более 100. В вариантах осуществления z составляет по меньшей мере 8, по меньшей мере 50, по меньшей мере 100, по меньшей мере 200 или по меньшей мере 300. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 приблизительно до 500 аминокислот. В вариантах осуществления выделенный длина выделенного неоантигенного пептида составляет приблизительно от 8 приблизительно до 100 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 приблизительно до 50 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 15 приблизительно до 35 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 и приблизительно 15 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 и приблизительно 11 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет 9 или 10 аминокислот. В вариантах осуществления выделенный неоантигенный пептид связывает главный комплекс гистосовместимости (MHC) I класса. В вариантах осуществления выделенный неоантигенный пептид связывает MHC I класса с аффинностью связывания приблизительно 500 нМ или менее. В вариантах осуществления выделенный неоантигенный пептид связывает MHC I класса с аффинностью связывания приблизительно 250 нМ или менее. В вариантах осуществления выделенный неоантигенный пептид связывает MHC I класса с аффинностью связывания приблизительно 50 нМ или менее. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 и приблизительно 30 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 приблизительно до 25 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 15 приблизительно до 24 аминокислот. В вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 9 приблизительно до 15 аминокислот. В вариантах осуществления выделенный неоантигенный пептид связывает MHC II класса. В вариантах осуществления выделенный неоантигенный пептид связывает MHC II класса с аффинностью связывания 1000 нМ или менее. В вариантах осуществления выделенный неоантигенный пептид связывает MHC I класса с аффинностью связывания приблизительно 500 нМ или менее. В вариантах осуществления выделенный неоантигенный пептид дополнительно содержит фланкирующие аминокислоты. В вариантах осуществления фланкирующие аминокислоты не являются природными фланкирующими аминокислотами. В вариантах осуществления общая длина выделенного неоантигенного пептида составляет по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29, по меньшей мере 30, по меньшей мере 40, по меньшей мере 50, по меньшей мере 60, по меньшей мере 70, по меньшей мере 80, по меньшей мере 90, по меньшей мере 100, по меньшей мере 150, по меньшей мере 200, по меньшей мере 250, по меньшей мере 300, по меньшей мере 350, по меньшей мере 400, по меньшей мере 450, или по меньшей мере 500 аминокислоты. В вариантах осуществления общая длина выделенного неоантигенного пептида составляет не более 8, не более 9, не более 10, не более 11, не более 12, не более 13, не более 14, не более 15, не более 16, не более 17, не более 18, не более 19, не более 20, не более 21, не более 22, не более 23, не более 24, не более 25, не более 26, не более 27, не более 28, не более 29, не более 30, не более 40, не более 50, не более 60, не более 70, не более 80, не более 90, не более 100, не более 150, не более 200, не более 250, не более 300, не более 350, не более 400, не более 450 или не более 500 аминокислот. В вариантах осуществления выделенный неоантигенный пептид представляет собой первый неоантигенный пептид, связанный по меньшей мере со вторым неоантигенным пептидом. В вариантах осуществления выделенный неоантигенный пептид связан по меньшей мере со вторым неоантигенным пептидом через поли-глициновый или поли-сериновый линкер. В вариантах осуществления второй неоантигенный пептид связывает MHC I класса или II класса с аффинностью связывания менее чем приблизительно 1000 нМ. В вариантах осуществления второй неоантигенный пептид связывает MHC I класса или II класса с аффинностью связывания менее чем приблизительно 500 нМ. В вариантах осуществления выделенный неоантигенный пептид и второй неоантигенный пептид связывают лейкоцитарный антиген человека (HLA) -A, -B, -C, -DP, -DQ или -DR. В вариантах осуществления выделенный неоантигенный пептид связывает HLA I класса, и второй неоантигенный пептид связывает HLA II класса. В вариантах осуществления выделенный неоантигенный пептид связывает HLA II класса, и второй неоантигенный пептид связывает HLA I класса. В вариантах осуществления выделенный неоантигенный пептид дополнительно содержит модификацию, которая увеличивает время полужизни in vivo, направленность клеток, захват антигена, процессирование антигена, аффинность к MHC, стабильность MHC, презентацию антигена или их сочетание. В вариантах осуществления модификация представляет собой конъюгацию с белком-носителем, конъюгацию с лигандом, конъюгацию с антителом, пэгилирование, полисиалирование, гесилирование, рекомбинантные миметики PEG, слияние с Fc, слияние с альбумином, присоединение наночастиц, инкапсуляцию в оболочку из наночастиц, слияние с холестерином, слияние с железом, ацилирование, амидирование, гликозилирование, окисление боковой цепи, фосфорилирование, биотинилирование, добавление поверхностно-активного вещества, добавление миметиков аминокислот или добавление неприродных аминокислот. В вариантах осуществления выделенный неоантигенный пептид дополнительно содержит модификацию, которая увеличивает направленность клеток на антигенпрезентирующие клетки. В вариантах осуществления антигенпрезентирующие клетки представляет собой дендритные клетки. В вариантах осуществления дендритные клетки направляют с помощью маркера DEC205, XCR1, CD197, CD80, CD86, CD123, CD209, CD273, CD283, CD289, CD184, CD85h, CD85j, CD85k, CD85d, CD85g, CD85a, CD141, CD11c, CD83, рецептора TSLP, Clec9a или CD1a. В вариантах осуществления дендритные клетки направляют с помощью маркера CD141, DEC205, Clec9a или XCR1. В вариантах осуществления дендритные клетки представляет собой аутологичные клетки. В вариантах осуществления одна или более дендритных клеток являются связаны с T-клеткой. В вариантах осуществления T-клетка представляет собой аутологичную T-клетку. В вариантах осуществления выделенный неоантигенный пептид не является выделенным неоантигенным пептидом, приведенным в таблице 2. В вариантах осуществления выделенный неоантигенный пептид является слитым по меньшей мере с одним дополнительным неоантигенным пептидом, приведенным в таблице 1 или 2.

[10] В настоящем описании предоставлена система доставки in vivo, содержащая выделенный неоантигенный пептид, описываемый в настоящем описании. В вариантах осуществления система доставки включает проникающие в клетку пептиды, инкапсуляцию в оболочку из наночастиц, вирусоподобные частицы, липосомы или любое их сочетание. В вариантах осуществления проникающий в клетку пептид представляет собой пептид TAT, вирус простого герпеса VP22, транспортан, Antp или любое их сочетание.

[11] В настоящем описании предоставлена клетка, содержащая выделенный неоантигенный пептид, описываемый в настоящем описании. В вариантах осуществления клетка представляет собой антигенпрезентирующую клетку. В вариантах осуществления клетка представляет собой дендритную клетку. В вариантах осуществления клетка представляет собой аутологичную клетку. В вариантах осуществления клетка является связанной с T-клеткой. В вариантах осуществления T-клетка представляет собой аутологичную T-клетку.

[12] В настоящем описании предоставлена композиция, содержащая выделенный неоантигенный пептид, описываемый в настоящем описании.

[13] В вариантах осуществления композиция содержит по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29, по меньшей мере 30, по меньшей мере 40, по меньшей мере 50, по меньшей мере 60, по меньшей мере 70, по меньшей мере 80, по меньшей мере 90 или по меньшей мере 100 выделенных неоантигенных пептидов, содержащих опухолеспецифичный неоэпитоп в соответствии с таблицей 1 или 2. В вариантах осуществления композиция содержит приблизительно от 2 приблизительно до 20 неоантигенных пептидов или приблизительно от 2 приблизительно до 30 неоантигенных пептидов. В вариантах осуществления неоантиген, специфический для опухоли отдельного индивидуума. В вариантах осуществления композиция дополнительно содержит по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, или по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29, по меньшей мере 30, по меньшей мере 40, по меньшей мере 50, по меньшей мере 60, по меньшей мере 70, по меньшей мере 80, по меньшей мере 90 или по меньшей мере 100 дополнительных неоантигенных пептидов. В вариантах осуществления композиция содержит приблизительно от 4 приблизительно до 20 дополнительных неоантигенных пептидов, приблизительно от 4 приблизительно до 30 дополнительных неоантигенных пептидов. В вариантах осуществления по меньшей мере один из дополнительных неоантигенных пептидов является специфическим для опухоли отдельного индивидуума. В вариантах осуществления специфический неоантигенный пептид от индивидуума выбирают посредством идентификации различий последовательностей генома, экзома и/или транскриптома образца опухоли индивидуума и генома, экзома и/или транскриптома не являющегося опухолью образца. В вариантах осуществления образцы представляют собой свежие или фиксированные формалином погруженные в парафин опухолевые ткани, свежие выделенные клетки или циркулирующие опухолевые клетки. В вариантах осуществления различия последовательностей определяют секвенированием нового поколения.

[14] В настоящем описании предоставлен выделенный полинуклеотид, кодирующий выделенный неоантигенный пептид, описываемый в настоящем описании. В вариантах осуществления полинуклеотид представляет собой ДНК. В вариантах осуществления полинуклеотид представляет собой РНК. В вариантах осуществления РНК представляет собой самоамплифицирующуюся РНК. В вариантах осуществления РНК модифицируют для повышения стабильности, повышения направленности на клетки, повышения эффективности трансляции, адъювантности, доступности в цитозоле и/или уменьшения цитотоксичности. В вариантах осуществления модификация представляет собой конъюгацию с белком-носителем, конъюгацию с лигандом, конъюгацию с антителом, оптимизацию кодона, повышенное содержание GC, введение модифицированных нуклеозидов, введение 5'-кэпа или аналога кэпа и/или введение немаскированной последовательности поли-A.

[15] В настоящем описании предоставлена клетка, содержащая полинуклеотид, описываемый в настоящем описании.

[16] В настоящем описании предоставлен вектор, содержащий полинуклеотид, описываемый в настоящем описании. В вариантах осуществления полинуклеотид является функционально связанным с промотором. В вариантах осуществления вектор представляет собой самоамплифицирующийся репликон РНК, плазмиду, фаг, транспозон, космида, вирус или вирион. В вариантах осуществления вектор получают из аденоассоциированного вируса, вируса герпеса, лентивируса или их псевдотипа.

[17] В настоящем описании предоставлена система доставки in vivo, содержащая выделенный полинуклеотид, описываемый в настоящем описании. В вариантах осуществления система доставки содержит сферические нуклеиновые кислоты, вирусы, вирусоподобные частицы, плазмиды, бактериальные плазмиды или наночастицы.

[18] В настоящем описании предоставлена клетка, содержащая вектор или систему доставки, описываемые в настоящем описании. В вариантах осуществления клетка представляет собой антигенпрезентирующую клетку. В вариантах осуществления клетка представляет собой дендритную клетку. В вариантах осуществления клетка представляет собой незрелую дендритную клетку.

[19] В настоящем описании предоставлена композиция, содержащая по меньшей мере один полинуклеотид, описываемый в настоящем описании. В вариантах осуществления композиция содержит по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29, по меньшей мере 30, по меньшей мере 40, по меньшей мере 50, по меньшей мере 60, по меньшей мере 70, по меньшей мере 80, по меньшей мере 90 или по меньшей мере 100 выделенных полинуклеотидов. В вариантах осуществления композиция содержит приблизительно от 2 и приблизительно до 20 выделенных полинуклеотидов, или приблизительно от 2 приблизительно до 30 выделенных полинуклеотидов. В вариантах осуществления неоантигенные пептиды, кодируются вектором, содержащим один или более выделенных полинуклеотидов. В вариантах осуществления композиция дополнительно содержит по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29, по меньшей мере 30, по меньшей мере 40, по меньшей мере 50, по меньшей мере 60, по меньшей мере 70, по меньшей мере 80, по меньшей мере 90 или по меньшей мере 100 дополнительных неоантигенных полинуклеотидов, кодирующих дополнительные неоантигенные пептиды. В вариантах осуществления один или более дополнительных неоантигенных пептидов, кодируются вектором, содержащим один или более дополнительных неоантигенных полинуклеотидов. В вариантах осуществления композиция содержит приблизительно от 4 приблизительно до 20 дополнительных неоантигенных полинуклеотидов или приблизительно от 4 приблизительно до 30 дополнительных неоантигенных полинуклеотидов. В вариантах осуществления выделенный полинуклеотиды и дополнительных неоантигенных полинуклеотидов являются связанными. В вариантах осуществления полинуклеотиды связывают с использованием нуклеиновых кислот, которые кодируют поли-глициновый или поли-сериновый линкер. В вариантах осуществления по меньшей мере один из дополнительных неоантигенных пептидов является специфическим для отдельной опухоли индивидуума. В вариантах осуществления индивидуум специфический неоантигенный пептид от индивидуума выбирают посредством идентификации различий последовательностей генома, экзома и/или транскриптома образца опухоли индивидуума и генома, экзома и/или транскриптома не являющегося опухолью образца. В вариантах осуществления образцы представляют собой свежие или фиксированные формалином погруженные в парафин опухолевые ткани, свежие выделенные клетки или циркулирующие опухолевые клетки. В вариантах осуществления различия последовательностей определяют секвенированием нового поколения.

[20] В настоящем описании предоставлен T-клеточный рецептор (TCR), способный связывать по меньшей мере один неоантигенный пептид, описываемый в настоящем описании, или комплекс MHC-пептид, содержащий по меньшей мере один неоантигенный пептид, описываемый в настоящем описании. В вариантах осуществления MHC из MHC-пептида представляет собой MHC I класса или II класса. В вариантах осуществления TCR представляет собой биспецифический TCR, дополнительно содержащий домен, содержащий антитело или фрагмент антитела, способный связывать антиген. В вариантах осуществления антиген представляет собой специфический к T-клетке антиген. В вариантах осуществления антиген представляет собой CD3. В вариантах осуществления антитело или фрагмент антитела представляет собой scFv против CD3.

[21] В настоящем описании предоставлен химерный антигенный рецептор, содержащий: (i) активирующую T-клетки молекулу; (ii) трансмембранный область и (iii) антигенраспознающий фрагмент, способный связывать по меньшей мере один неоантигенный пептид, описываемый в настоящем описании, или комплекс MHC-пептид, содержащий по меньшей мере один неоантигенный пептид, описываемый в настоящем описании. В вариантах осуществления CD3-дзета представляет собой активирующую T-клетки молекулу. В вариантах осуществления химерный антигенный рецептор дополнительно содержит по меньшей мере один костимулирующий сигнальный домен. В вариантах осуществления сигнальный домен представляет собой CD28, 4-1BB, ICOS, OX40, ITAM, или Fc-эпсилон-RI-гамма. В вариантах осуществления антигенраспознающий фрагмент способен связывать выделенный неоантигенный пептид в пределах MHC I класса или II класса. В вариантах осуществления CD3-дзета, трансмембранная область CD28, CTLA-4, ICOS, BTLA, KIR, LAG3, CD137, OX40, CD27, CD40L, Tim-3, A2aR или PD-1. В вариантах осуществления неоантигенный пептид располагается во внеклеточном домене опухолеассоциированного полипептида. В вариантах осуществления MHC из MHC-пептида представляет собой MHC I класса или II класса.

[22] В настоящем описании предоставлена T-клетка, содержащая T-клеточный рецептор или химерный антигенный рецептор, описываемый в настоящем описании, необязательно, где T-клетка представляет собой хелперную или цитотоксическую T-клетку. В вариантах осуществления T-клетка представляет собой T-клетку индивидуума.

[23] В настоящем описании предоставлена T-клетка, содержащая T-клеточный рецептор (TCR), способный связывать по меньшей мере один неоантигенный пептид, описываемый в настоящем описании, или комплекс MHC-пептид, содержащий по меньшей мере один неоантигенный пептид, описываемый в настоящем описании, где T-клетка представляет собой T-клетку, выделенную из популяции T-клеток от индивидуума, которую инкубировали с антигенпрезентирующими клетками и одним или более из по меньшей мере одного неоантигенного пептида, описываемого в настоящем описании, в течение периода времени, достаточного для активации T-клеток. В вариантах осуществления T-клетка представляет собой CD8+ T-клетку, хелперную T-клетку или цитотоксическую T-клетку. В вариантах осуществления популяция T-клеток от индивидуума представляет собой популяцию CD8+ T-клеток от индивидуума. В вариантах осуществления один или более из по меньшей мере одного неоантигенного пептида, описываемого в настоящем описании, представляет собой специфический для индивидуума неоантигенный пептид. В вариантах осуществления специфический для индивидуума неоантигенный пептид содержит отличный опухолевый неоэпитоп, который представляет собой эпитоп, специфический для опухоли индивидуума. В вариантах осуществления специфический для индивидуума неоантигенный пептид является продуктом экспрессии опухолеспецифической проявляющейся мутации, которая не присутствует в не являющемся опухолью образце от индивидуума. В вариантах осуществления специфический для индивидуума неоантигенный пептид связывается с белком HLA индивидуума. В вариантах осуществления специфический для индивидуума неоантигенный пептид связывается с белком HLA индивидуума с IC50 менее чем 500 нМ. В вариантах осуществления активированные CD8+ T-клетки отделяют от антигенпрезентирующих клеток. В вариантах осуществления антигенпрезентирующие клетки представляют собой дендритные клетки или размноженные CD40L B-клетки. В вариантах осуществления антигенпрезентирующие клетки являются нетрансформированными клетками. В вариантах осуществления антигенпрезентирующие клетки являются неинфицированными клетками. В вариантах осуществления антигенпрезентирующие клетки являются аутологичными. В вариантах осуществления антигенпрезентирующие клетки обрабатывали для снятия эндогенных ассоциированных с MHC пептидов с их поверхности. В вариантах осуществления обработка для снятия эндогенных ассоциированных с MHC пептидов включает культивирование клеток приблизительно при 26°C. В вариантах осуществления обработка для снятия эндогенных ассоциированных с MHC пептидов включает обработку клеток раствором умеренной кислоты. В вариантах осуществления антигенпрезентирующие клетки нагружали по меньшей мере одним неоантигенным пептидом, описываемым в настоящем описании. В вариантах осуществления нагрузка включает инкубацию антигенпрезентирующих клеток в присутствии по меньшей мере приблизительно 2 мкг/мл каждого из по меньшей мере одного неоантигенного пептида, описываемого в настоящем описании. В вариантах осуществления отношение выделенных T-клеток к антигенпрезентирующим клеткам составляет приблизительно от 30:1 и 300:1. В вариантах осуществления инкубацию выделенной популяции T-клеток проводят в присутствии IL-2 и IL-7. В вариантах осуществления MHC из MHC-пептид представляет собой MHC I класса или II класса.

[24] В настоящем описании предоставлен способ активации опухолеспецифических T-клеток, включающий: выделение популяции T-клеток от индивидуума и инкубацию выделенной популяции T-клеток с антигенпрезентирующими клетками и по меньшей мере одним неоантигенным пептидом, описываемым в настоящем описании, в течение периода времени, достаточного для активации T-клеток. В вариантах осуществления T-клетка представляет собой CD8+ T-клетку, хелперную T-клетку или цитотоксическую T-клетку. В вариантах осуществления популяция T-клеток от индивидуума представляет собой популяцию CD8+ T-клеток от индивидуума. В вариантах осуществления один или более из по меньшей мере одного неоантигенного пептида, описываемого в настоящем описании, представляет собой специфический для индивидуума неоантигенный пептид. В вариантах осуществления специфический для индивидуума неоантигенный пептид содержит отличный опухолевый неоэпитоп, который является эпитопом, специфическим для опухоли индивидуума. В вариантах осуществления специфический для индивидуума неоантигенный пептид представляет собой продукт экспрессии опухолеспецифической проявляющейся мутации, которая не присутствует в не являющемся опухолью образце индивидуума. В вариантах осуществления специфический для индивидуума неоантигенный пептид связывается с белком HLA индивидуума. В вариантах осуществления специфический для индивидуума неоантигенный пептид связывается с белком HLA индивидуума с IC50 менее чем 500 нМ. В вариантах осуществления способ дополнительно включает отделение активированных T-клеток от антигенпрезентирующих клеток. В вариантах осуществления способ дополнительно включает тестирование активированных T-клеток на подтверждение реактивности против по меньшей мере одного неоантигенного пептида, описываемого в настоящем описании. В вариантах осуществления антигенпрезентирующие клетки представляют собой дендритные клетки или размноженные CD40L B-клетки. В вариантах осуществления антигенпрезентирующие клетки представляют собой нетрансформированные клетки. В вариантах осуществления антигенпрезентирующие клетки представляют собой неинфицированные клетки. В вариантах осуществления антигенпрезентирующие клетки являются аутологичными. В вариантах осуществления антигенпрезентирующие клетки обрабатывали для снятия эндогенных ассоциированных с MHC пептидов с их поверхности. В вариантах осуществления обработка для снятия эндогенных ассоциированных с MHC пептидов включает культивирование клеток приблизительно при 26°C. В вариантах осуществления обработка для снятия эндогенных ассоциированных с MHC пептидов включает обработку клеток раствором умеренной кислоты. В вариантах осуществления антигенпрезентирующие клетки нагружали по меньшей мере одним неоантигенным пептидом, описываемый в настоящем описании. В вариантах осуществления нагрузка включает инкубацию антигенпрезентирующих клеток в присутствии по меньшей мере приблизительно 2 мкг/мл каждого из по меньшей мере одного неоантигенного пептида, описываемого в настоящем описании. В вариантах осуществления отношение выделенных T-клеток к антигенпрезентирующим клеткам составляет приблизительно от 30:1 и 300:1. В вариантах осуществления инкубацию выделенной популяции T-клеток проводят в присутствии IL-2 и IL-7. В вариантах осуществления MHC из MHC-пептид представляет собой MHC I класса или II класса.

[25] В настоящем описании предоставлена композиция, содержащая активированные опухолеспецифические T-клетки, получаемые способом, описываемым в настоящем описании.

[26] В настоящем описании предоставлен способ лечения злокачественной опухоли у индивидуума, включающий введение индивидууму терапевтически эффективного количества активированной опухолеспецифической T-клетки, описываемой в настоящем описании, или получаемой способом, описываемым в настоящем описании. В вариантах осуществления введение включает введение приблизительно от 106 до 1012, приблизительно от 108 до 1011 или приблизительно от 109 до 1010 активированных опухолеспецифических T-клеток.

[27] В настоящем описании предоставлена нуклеиновая кислота, содержащая промотор, функционально связанный с полинуклеотидом, кодирующий T-клеточный рецептор, описываемый в настоящем описании. В вариантах осуществления TCR способен связывать по меньшей мере один неоантигенный пептид в пределах главного комплекса гистосовместимости (MHC) I класса или II класса.

[28] В настоящем описании предоставлена нуклеиновая кислота, содержащая промотор, функционально связанный с полинуклеотидом, кодирующим химерный антигенный рецептор, описываемый в настоящем описании. В вариантах осуществления антигенраспознающий фрагмент способен связывать по меньшей мере один неоантигенный пептид в пределах главного комплекса гистосовместимости (MHC) I класса или II класса. В вариантах осуществления неоантигенный пептид располагается во внеклеточном домене опухолеассоциированного полипептида. В вариантах осуществления нуклеиновая кислота содержит трансмембранную область CD3-дзета, CD28, CTLA-4, ICOS, BTLA, KIR, LAG3, CD137, OX40, CD27, CD40L, Tim-3, A2aR или PD-1.

[29] В настоящем описании предоставлено антитело или фрагмент антитела способный связывать по меньшей мере один неоантигенный пептид, описываемый в настоящем описании, или комплекс MHC-пептид, содержащий по меньшей мере один неоантигенный пептид, описываемый в настоящем описании, необязательно, где фрагмент антитела представляет собой привлекающий T-клетки биспецифический активатор (BiTE). В вариантах осуществления антитело или фрагмент антитела связывается с внеклеточным участком по меньшей мере одного неоантигенного пептида. В вариантах осуществления нативный полипептид кодируется геном, выбранным из группы, состоящей из: β2M, где Cz представляет собой RMERELKKWSIQTCLSARTGLSISCTTLNSPPLKKMSMPAV, или LCSRYSLFLAWRLSSVLQRFRFTHVIQQRMESQIS; EGFR, где AxByCz представляет собой IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA; BTK, где AxByCz представляет собой MIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGSLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVND; или ESR1, где AxByCz представляет собой HLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEA, NQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLPSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSH, IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLCDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE, IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLNDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE, или IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE; или HER2, где AxByCz представляет собой GSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGLGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCM. В вариантах осуществления антитело или фрагмент антитела представляет собой биспецифическое антитело или фрагмент антитела. В вариантах осуществления один антигенсвязывающий домен биспецифического антитела или фрагмента антитела представляет собой связывающий домен против CD3.

[30] В настоящем описании предоставлена модифицированная клетка, трансфицированная или трансдуцированная нуклеиновой кислотой, описываемой в настоящем описании. В вариантах осуществления модифицированная клетка представляет собой T-клетку, проникающий в опухоль лимфоцит, NK-T-клетку, экспрессирующую TCR клетку, CD4+ T-клетку, CD8+ T-клетку или NK клетку.

[31] В настоящем описании предоставлена композиция, содержащая T-клеточный рецептор или химерный антигенный рецептор, описываемый в настоящем описании.

[32] В настоящем описании предоставлена композиция, содержащая аутологичные T-клетки индивидуума, содержащие T-клеточный рецептор или химерный антигенный рецептор, описываемый в настоящем описании. В вариантах осуществления композиция дополнительно содержит ингибитор иммунной контрольной точки. В вариантах осуществления композиция дополнительно содержит по меньшей мере два ингибитора иммунных контрольных точек. В вариантах осуществления каждый из ингибиторов иммунных контрольных точек ингибирует белок контрольных точек, выбранный из группы, состоящей из семейства лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7 или их сочетания. В вариантах осуществления каждый из ингибиторов иммунных контрольных точек взаимодействует с лигандом белка контрольных точек, выбранным из группы, состоящей из семейства лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7 или их сочетания. В вариантах осуществления T-клетки представляют собой T-клетки с нокаутом по PD-1 и/или CTLA4, необязательно, где T-клетки с нокаутом по PD-1 и/или CTLA4 получают с использованием системы CRISPR. В вариантах осуществления композиция дополнительно содержит иммуномодулятор или адъювант. В вариантах осуществления иммуномодулятор представляет собой костимулирующий лиганд, лиганд TNF, лиганд суперсемейства Ig, CD28, CD80, CD86, ICOS, CD40L, OX40, CD27, GITR, CD30, DR3, CD69 или 4-1BB. В вариантах осуществления иммуномодулятор представляет собой по меньшей мере одну злокачественную клетку или экстракт злокачественных клеток. В вариантах осуществления злокачественная клетка является аутологичной для индивидуума, нуждающегося в композиции. В вариантах осуществления злокачественная клетка подвергается лизису или действию УФ-излучения. В вариантах осуществления композиция дополнительно содержит адъювант. В вариантах осуществления адъювант выбран из группы, состоящей из: поли(I:C), поли-ICLC, агониста STING, 1018 ISS, солей алюминия, Amplivax, AS15, BCG, CP-870.893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, имихимод, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, JuvImmune, LipoVac, MF59, монофосфориллипид A, Montanide IMS 1312 VG, Montanide ISA 206 VG, Montanide ISA 50 V2, Montanide ISA 51 VG, OK-432, OM-174, OM-197-MP-EC, агониста ISA-TLR2, ONTAK, PepTel®, векторной системы, микрочастиц PLG, резиквимод, SRL172, виросом и других вирусоподобных частиц, YF-17D, VEGF-Trap, R848, бета-глюкана, Pam3Cys, Pam3CSK4, акриловых или метакриловых полимеров, сополимеров малеинового ангидрида, и стимулона QS21. В вариантах осуществления композиция вызывает гуморальный ответ при введении индивидууму. В вариантах осуществления композиция индуцирует 1 тип T-хелперных клеток при введении индивидууму.

[33] В настоящем описании предоставлен способ ингибирования роста опухолевой клетки, экспрессирующей опухолеспецифичный неоэпитоп, включающий приведение опухолевой клетки в контакт с пептидом, полинуклеотидом, системой доставки, вектором, композицией, антителом или клетками, описываемыми в настоящем описании.

[34] В настоящем описании предоставлен способ профилактики у индивидуума, включающий приведение клетки индивидуума в контакт с пептидом, полинуклеотидом, системой доставки, вектором, композицией, антителом или клетками, описываемыми в настоящем описании. В вариантах осуществления нативный полипептид кодируется геном, выбранным из группы, состоящей из: β2M, где Cz представляет собой RMERELKKWSIQTCLSARTGLSISCTTLNSPPLKKMSMPAV или LCSRYSLFLAWRLSSVLQRFRFTHVIQQRMESQIS; EGFR, где AxByCz представляет собой IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA; BTK, где AxByCz представляет собой MIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGSLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVND или ESR1, где AxByCz представляет собой HLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEA, NQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLPSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSH, IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLCDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE, IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLNDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE, или IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE, и HER2, где AxByCz представляет собой GSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGLGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCM.

[35] В настоящем описании предоставлен способ лечения злокачественной опухоли или стимуляции, усиления или продления противоопухолевого ответа у нуждающегося в этом индивидуума, включающий введение индивидууму пептида, полинуклеотида, вектора, композиция, антитела или клеток, описываемых в настоящем описании. В вариантах осуществления индивидуум является человеком. В вариантах осуществления индивидуум страдает злокачественной опухолью. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из злокачественной опухоли мочеполовой системы, гинекологического рака, рака легких, желудочно-кишечного рака, рака головы и шеи, злокачественной глиобластомы, злокачественной мезотелиомы, неметастатического или метастатического рака молочной железы, злокачественной меланомы, карциномы из клеток Меркеля или саркомы кости и мягких тканей, гематологический неоплазий, множественной миеломы, острого миелогенного лейкоза, хронического миелогеннго лейкоза, миелодиспластического синдрома и острого лимфобластного лейкоза, немелкоклеточного рака легких (NSCLC), рака молочной железы, метастатического колоректального рака, гормончувствительного или гормонрезистентного рака предстательной железы, колоректальнго рака, рака яичника, гепатоцеллюлярного рака, печеночноклеточного рака, рака поджелудочной железы, рака желудка, рака пищевода, видов гепатоцеллюлярного рака, видов холангиогенного рака, плоскоклеточного рака головы и шеи, саркомы мягких тканей и мелкоклеточного рака легких. В вариантах осуществления пептид, полинуклеотид, вектор, композиция, антитело или клетки, описываемые в настоящем описании, предназначены для применения в лечении соответствующей злокачественной опухоли в соответствии с таблицей 1 или таблицей 2. В вариантах осуществления пептид, полинуклеотид, вектор, композиция, антитело или клетки, описываемые в настоящем описании, предназначены для применения в лечении индивидуума с типом HLA, который соответствует типу HLA в соответствии с таблицей 1 или таблицей 2. В вариантах осуществления индивидуум подвергался хирургическому удалению опухоли. В вариантах осуществления пептид, полинуклеотид, вектор, композицию или клетки вводят посредством внутривенного, интраперитонеального, внутриопухолевого, внутрикожного или подкожного введения. В вариантах осуществления пептид, полинуклеотид, вектор, композицию или клетки вводят в анатомический участок, который впадает в лимфатический коллектор. В вариантах осуществления введение проводят в несколько лимфатических коллекторов. В вариантах осуществления введение проводят подкожным или внутрикожным путем. В вариантах осуществления вводят пептид. В вариантах осуществления введение проводят внутрь опухоли. В вариантах осуществления полинуклеотид необязательно вводят РНК. В вариантах осуществления полинуклеотид вводят внутривенно. В вариантах осуществления клетка представляет собой T-клетку или дендритную клетку. В вариантах осуществления пептид или полинуклеотид содержит фрагмент, направленный на антигенпрезентирующие клетки. В вариантах осуществления клетка представляет собой аутологичную клетку. В вариантах осуществления способ дополнительно включает введение по меньшей мере одного ингибитора иммунных контрольных точек индивидууму. В вариантах осуществления ингибитор контрольных точек представляет собой биологическое терапевтическое средство или низкомолекулярное соединение. В вариантах осуществления ингибитор контрольных точек выбран из группы, состоящей из моноклонального антитела, гуманизированного антитела, полностью принадлежащего человеку антитела и слитого белка или их сочетания. В вариантах осуществления ингибиторы контрольных точек представляют собой антитело к PD-1 или антитело к PD-L1. В вариантах осуществления ингибитор контрольных точек выбран из группы, состоящей из ипилимумаба, тремелимумаба, ниволумаба, авелумаба, дурвалумаба, атезолизумаба, пемобролизумаба и любого их сочетания. В вариантах осуществления ингибитор контрольных точек ингибирует белок контрольных точек, выбранный из группы, состоящей из семейства лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7, и любого их сочетания. В вариантах осуществления ингибитор контрольных точек взаимодействует с лигандом белка контрольных точек, выбранным из группы, состоящей из семейства лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7 или их сочетания. В вариантах осуществления вводят два или более ингибитора контрольных точек. В вариантах осуществления по меньшей мере один из двух или более ингибиторов контрольных точек представляет собой антитело к PD-1 или антитело к PD-L1. В вариантах осуществления по меньшей мере один из двух или более ингибиторов контрольных точек выбран из группы, состоящей из ипилимумаба, тремелимумаба, ниволумаба, авелумаба, дурвалумаба, атезолизумаба и пемобролизумаба. В вариантах осуществления ингибитор контрольных точек и композицию вводят одновременно или последовательно в любом порядке. В вариантах осуществления пептид, полинуклеотид, вектор, композицию или клетки вводят до ингибитора контрольных точек. В вариантах осуществления пептид, полинуклеотид, вектор, композицию или клетки вводят после ингибитора контрольных точек. В вариантах осуществления введение ингибитора контрольных точек продолжают на всем протяжении терапии неоантигенным пептидом, полинуклеотидом, вектором, композицией или клетками. В вариантах осуществления терапию неоантигенным пептидом, полинуклеотидом, вектором, композицией или клетками проводят у индивидуумов, которые частично реагируют или не реагируют на терапию ингибитором контрольных точек. В вариантах осуществления композицию вводят внутривенно или подкожно. В вариантах осуществления ингибитор контрольных точек вводят внутривенно или подкожно. В вариантах осуществления ингибитор контрольных точек вводят подкожно приблизительно в 2 см от участка введения композиции. В вариантах осуществления композицию вводят в тот же дренирующий лимфоузел что и ингибитор контрольных точек. В вариантах осуществления способ дополнительно включает введение дополнительного терапевтического средство индивидууму до, одновременно или после лечения пептидом, полинуклеотидом, вектором, композицией или клетками. В вариантах осуществления дополнительное средство представляет собой химиотерапевтическое средство, иммуномодулирующее лекарственное средство, модифицирующее иммунный метаболизм лекарственное средство, направленную терапию, облучение, антиангиогенное средство или средство, которое уменьшает подавление иммунитета. В вариантах осуществления химиотерапевтическое средство представляет собой алкилирующее средство, ингибитор топоизомеразы, антиметаболит или антимитотическое средство. В вариантах осуществления дополнительное средство представляет собой антитело-агонист к индуцированному глюкокортикоидом семейству рецепторов фактора некроза опухоли (GITR) или фрагмент, ибрутиниб, доцетаксел, цисплатин, антитело-агонист к CD40 или фрагмент антитела, ингибитор IDO или циклофосфамид. В вариантах осуществления способ вызывает CD4+ T-клеточный иммунный ответ или CD8+ T-клеточный иммунный ответ. В вариантах осуществления способ вызывает CD4+ T-клеточный иммунный ответ и CD8+ T-клеточный иммунный ответ.

[36] В настоящем описании предоставлен способ стимуляции иммунного ответа у индивидуума, включающий введение эффективного количества модифицированных клеток или композиции, описываемой в настоящем описании. В вариантах осуществления иммунный ответ представляет собой цитотоксический и/или гуморальный иммунный ответ. В вариантах осуществления способ стимулирует Опосредованный T-клетками иммунный ответ у индивидуума. В вариантах осуществления опосредованный T-клетками иммунный ответ направлен на клетку-мишень. В вариантах осуществления клетка-мишень представляет собой опухолевую клетку. В вариантах осуществления модифицированные клетки трансфицируют или трансдуцируют in vivo. В вариантах осуществления модифицированные клетки трансфицируют или трансдуцируют ex vivo. В вариантах осуществления модифицированные клетки являются аутологичными T-клетками индивидуума. В вариантах осуществления аутологичные T-клетки индивидуума получают от индивидуума, который получал вакцину на основе неоантигенного пептида или нуклеиновой кислоты. В вариантах осуществления вакцина на основе неоантигенного пептида или нуклеиновой кислоты содержит по меньшей мере один персонализированный неоантиген. В вариантах осуществления вакцина на основе неоантигенного пептида или нуклеиновой кислоты содержит по меньшей мере один дополнительный неоантигенный пептид, приведенный в таблице 1 или 2. В вариантах осуществления индивидуум получал химиотерапевтическое средство, иммуномодулирующее лекарственное средство, модифицирующее иммунный метаболизм лекарственное средство, направленную терапию или облучение до и/или после получения вакцины на основе неоантигенного пептида или нуклеиновой кислоты. В вариантах осуществления индивидуум получает лечение по меньшей мере одним ингибитором контрольных точек. В вариантах осуществления аутологичные T-клетки получают от индивидуума, который уже получал по меньшей мере один цикл T-клеточной терапии, включавшей неоантиген. В вариантах осуществления способ дополнительно включает адоптивную T-клеточную терапию. В вариантах осуществления адоптивная T-клеточная терапия включает аутологичные T-клетки. В вариантах осуществления аутологичные T-клетки направлены против опухолевых антигенов. В вариантах осуществления адоптивная T-клеточная терапия дополнительно включает аллогенные T-клетки. В вариантах осуществления аллогенные T-клетки направлены против опухолевых антигенов. В вариантах осуществления адоптивную T-клеточную терапию проводят до введения ингибитора контрольных точек, после ингибитора контрольных точек или одновременно с ингибитором контрольных точек.

[37] В настоящем описании предоставлен способ оценки эффективности любых клеток, описываемых в настоящем описании, включающий: (i) определение количества или концентрации клеток-мишеней в первом образце, получаемом от индивидуума до введения модифицированной клетки, (ii) определение количества или концентрации клеток-мишеней во втором образце, получаемом от индивидуума после введения модифицированной клетки, и (iii) определение увеличения или уменьшения количества или концентрации клеток-мишеней во втором образце по сравнению с количеством или концентрацией клеток-мишеней в первом образце. В вариантах осуществления эффективность лечения определяют мониторингом клинического исхода; увеличения, усиления или пролонгирования противоопухолевой активности T-клетками; увеличения количества противоопухолевых T-клеток или активированных T-клеток по сравнению с количеством до лечения; B-клеточной активности; CD4+ T-клеточной активности или их сочетания. В вариантах осуществления эффективность лечения определяют мониторингом биомаркера. В вариантах осуществления биомаркер выбран из группы, состоящей из CEA, Her-2/neu, антигена опухоли мочевого пузыря, тиреоглобулина, альфа-фетопротеина, PSA, CA 125, CA19.9, CA 15.3, лептина, пролактина, остеопонтина, IGF-II, CD98, фасцина, sPIgR, 14-3-3-эта, тропонина I, циркулирующей РНК или ДНК опухолевой клетки и натрийуретического пептида типа b. В вариантах осуществления клинический исход выбран из группы, состоящей из регрессии опухоли; уменьшения размера опухоли; некроза опухоли; противоопухолевого ответа иммунной системой; распространения, рецидива или метастазирования опухоли, или их сочетания. В вариантах осуществления эффект лечение прогнозируют на основании присутствия T-клеток или присутствия генной сигнатуры, указывающей на Т-клеточное воспаление, или их сочетания.

[38] В настоящем описании предоставлен способ лечения злокачественной опухоли или стимуляции, усиления или продления противоопухолевого ответа у нуждающегося в этом индивидуума, включающий введение индивидууму: пептида, полинуклеотида, вектора, композиции, антитела или клеток, описываемых в настоящем описании; и по меньшей мере одного ингибитора контрольных точек. В вариантах осуществления способ дополнительно включает введение иммуномодулятора или адъюванта. В вариантах осуществления иммуномодулятор или адъювант выбран из группы, состоящей из поли(I:C), поли-ICLC, агонист STING, 1018 ISS, соли алюминия, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, имихимод, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, JuvImmune, LipoVac, MF59, монофосфориллипид A, Montanide IMS 1312 VG, Montanide ISA 206 VG, Montanide ISA 50 V2, Montanide ISA 51 VG, OK-432, OM-174, OM-197-MP-EC, агонист ISA-TLR2, ONTAK, векторной системы PepTel®, микрочастиц PLG, резиквимода, SRL172, виросом и других вирусоподобных частиц, YF-17D, VEGF-Trap, R848, бета-глюкана, Pam3Cys, Pam3CSK4, акриловых или метакриловых полимеров, сополимеров малеинового ангидрида и стимунола QS21, костимулирующего лиганда, лиганда TNF, лиганда суперсемейства Ig, CD28, CD80, CD86, ICOS, CD40L, OX40, CD27, GITR, CD30, DR3, CD69 или 4-1BB. В вариантах осуществления иммуномодулятор или адъювант представляет собой поли-ICLC. В вариантах осуществления ингибитор контрольных точек представляет собой антитело к PDl или фрагмент. В вариантах осуществления антитело к PDl или фрагмент представляет собой ниволумаб или пемболизумаб. В вариантах осуществления ингибитор контрольных точек представляет собой антитело к PD-L1 или фрагмент. В вариантах осуществления антитело к PD-L1 или фрагмент представляет собой велумаб, дурвалумаб или атезолизумаб. В вариантах осуществления ингибитор контрольных точек представляет собой антитело к CTLA4 или фрагмент. В вариантах осуществления антитело к CTLA4 представляет собой ипилимумаб или тремелимумаба. В вариантах осуществления способ включает введение антитела к PD1 и антитела к CTLA4. В вариантах осуществления введение ингибитора контрольных точек начинают до введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В вариантах осуществления введение ингибитора контрольных точек начинают после начала введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В вариантах осуществления введение ингибитора контрольных точек начинают одновременно с началом введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В вариантах осуществления пептид, полинуклеотид, вектор, композицию, антитело или клетку вводят внутривенно или подкожно. В вариантах осуществления ингибитор контрольных точек вводят внутривенно или подкожно. В вариантах осуществления ингибитор контрольных точек вводят подкожно приблизительно в 2 см от участка введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В вариантах осуществления пептид, полинуклеотид, вектор, композиция, антитело или клетку вводят в тот же дренирующий лимфоузел, что и ингибитор контрольных точек.

[39] В настоящем описании предоставлен набор, содержащий пептид, полинуклеотид, вектор, композиция, антитело, клетки или композицию, описываемую в настоящем описании. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: рака надпочечника, рака мочевого пузыря, рака молочной железы, рака шейки матки, колоректального рака, глиобалстомы, рака головы и шеи, хромофобного рака почки, светлоклеточного рака почки, папиллярного рака почки, рака печени, аденокарциномы легких, плоскоклеточного рака легких, рака яичника, рака поджелудочной железы, меланомы, рака желудка, рак эндометрия тела матки и карциносаркому матки. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: рака предстательной железы, рака мочевого пузыря, плоскоклеточного рака легких, NSCLC, рака молочной железы, рака головы и шеи, аденокарциномы легких, GBM, глиомы, CML, AML, супратенториальной эпендимомы, острого промиелоцитарного лейкоза, солитарных фиброзных опухолей и устойчивой к кризотинибу злокачественной опухоли. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: CRC, рака головы и шеи, рака желудка, плоскоклеточного рака легких, аденокарциномы легких, рака предстательной железы, рака мочевого пузыря, рака желудка, почечноклеточной карциномы и рака матки. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: меланомы, плоскоклеточного рака легких, DLBCL, рака матки, рака головы и шеи, рака матки, рака печени и CRC. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: рака лимфатической системы; лимфомы Беркита, нейробластомы, аденокарциномы предстательной железы, колоректальной аденокарциномы; аденокарциномы матки/эндометрия; MSI+; серозной карциномы эндометрия; карциносаркомы матки - злокачественной смешанной мезодермальной опухоли; глиомы; астроцитомы; GBM, острого миелолейкоза. ассоциированного с MDS; хронического лимфоцитарного лецкоза - мелкоклеточной лимфомы; миелодиспластического синдрома; острого миелолейкоза; карциномы молочной железы люминального типа NS; хронического миелоидного лейкоза; протоковой карциномы поджелудочной железы; хронического миеломоноцитарного лейкоза; миелофиброза; миелодиспластического синдрома; аденокарциномы предстательной железы; эссенциальной тромбоцитемии и медулломиобластомы. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: колоректального рака, рака матка, рака эндометрия и рака желудка. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: рака шейки матки, рака головы и шеи, рака анального канала, рака желудка, лимфомы Беркита и носоглоточной карциномы. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: рака мочевого пузыря, колоректального рака и рака желудок. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: рака легких, CRC, меланомы, рака молочной железы, NSCLC и CLL. В вариантах осуществления индивидуум частично реагирует или не реагирует на терапию ингибитором контрольных точек. В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: уротелиальной карциномы мочевого пузыря (BLCA), инвазивной карциномы молочной железы (BRCA), рака молочной железы, плоскоклеточной карциномы шейки матки и эндоцервикальной аденокарциномы (CESC), хронического лимфоцитарного лейкоза (CLL), колоректального рака (CRC), мультиформной глиобластомы (GBM), плоскоклеточной карциномы головы и шеи (HNSC), папиллярно-клеточной карциномы почки (KIRP), печеночноклеточной карциномы (LIHC), аденокарциномы легких (LUAD), плоскоклеточной карциномы легких (LUSC), аденокарциномы поджелудочной железы (PAAD), рака предстательной железы, меланомы кожи (SKCM), аденокарциномы желудка (STAD), аденокарциномы щитовидной железы (THCA) и эндометриоидной карциномы тела матки (UCEC). В вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из: колоректального рака, рака матки, рака эндометрия, рака желудка и синдрома Линча. В вариантах осуществления злокачественная опухоль представляет собой MSI+ злокачественную опухоль.

[40] Настоящее изобретение относится к выделенному неоантигенному пептиду, содержащему опухолеспецифичный неоэпитоп, определяемый в таблице 1, где выделенный неоантигенный пептид не является нативным полипептидом. Настоящее изобретение также относится к выделенному неоантигенному пептиду, который содержит опухолеспецифичный неоэпитоп и определен в таблице 1.

[41] В определенных вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 приблизительно до 50 аминокислот. В другом варианте осуществления длина выделенного неоантигенного пептида составляет приблизительно от 15 приблизительно до 35 аминокислот. В другом варианте осуществления длина выделенного неоантигенного пептида составляет приблизительно 15 аминокислот или менее. В другом варианте осуществления длина выделенного неоантигенного пептида составляет приблизительно от 8 и приблизительно 11 аминокислот. В другом варианте осуществления длина выделенного неоантигенного пептида составляет 9 или 10 аминокислот. В другом варианте осуществления выделенный неоантигенный пептид связывает главный комплекс гистосовместимости (MHC) I класса. В другом варианте осуществления выделенный неоантигенный пептид связывает MHC I класса с аффинностью связывания менее чем приблизительно 500 нМ.

[42] В определенных вариантах осуществления длина выделенного неоантигенного пептида составляет приблизительно 30 аминокислот или менее. В другом варианте осуществления длина выделенного неоантигенного пептида составляет приблизительно от 6 и приблизительно 25 аминокислот. В другом варианте осуществления длина выделенного неоантигенного пептида составляет приблизительно от 15 и приблизительно 24 аминокислот. В другом варианте осуществления длина выделенного неоантигенного пептида составляет приблизительно от 9 и приблизительно 15 аминокислот. В другом варианте осуществления выделенный неоантигенный пептид связывает MHC II класса. В другом варианте осуществления выделенный неоантигенный пептид связывает MHC II класса с аффинностью связывания менее чем приблизительно 1000 нМ.

[43] В определенных вариантах осуществления выделенный неоантигенный пептид дополнительно содержит фланкирующие аминокислоты. В другом варианте осуществления фланкирующие аминокислоты не являются нативными фланкирующими аминокислотами. В другом варианте осуществления выделенный неоантигенный пептид связан по меньшей мере со вторым неоантигенным пептидом. В другом варианте осуществления пептиды связывают с использованием полиглицинового или полисеринового линкера. В другом варианте осуществления второй неоантигенный пептид связывает MHC I класса или II класса с аффинностью связывания менее чем приблизительно 1000 нМ. В другом варианте осуществления второй неоантигенный пептид связывает MHC I класса или II класса с аффинностью связывания менее чем приблизительно 500 нМ. В другом варианте осуществления оба неоэпитопа связывают лейкоцитарный антиген человека (HLA) -A, -B, -C, -DP, -DQ или -DR. В другом варианте осуществления выделенный неоантигенный пептид связывает HLA I класса, а второй неоантигенный пептид связывает HLA II класса. В другом варианте осуществления выделенный неоантигенный пептид связывает HLA II класса, а второй неоантигенный пептид связывает HLA I класса.

[44] В определенных вариантах осуществления выделенный неоантигенный пептид дополнительно содержит модификации, которые увеличивают время полужизни in vivo, направленность на клетки, захват антигена, процессирование антигена, аффинность MHC, стабильность MHC или презентацию антигена. В другом варианте осуществления модификация представляет собой конъюгацию с белком-носителем, конъюгацию с лигандом, конъюгацию с антителом, пэгилирование, полисиалирование, гесилирование, рекомбинантные миметики PEG, слияние с Fc, слияние с альбумином, присоединение наночастиц, инкапсуляцию в оболочку из наночастиц, слияние с холестерином, слияние с железом, ацилирование, амидирование, гликозилирование, окисление боковой цепи, фосфорилирование, биотинилирование, добавление поверхностно-активного вещества, добавление миметиков аминокислот или добавление неприродных аминокислот. В другом варианте осуществления клетки, которые подвергаются направленному воздействию, представляют собой антигенпрезентирующие клетки. В другом варианте осуществления антигенпрезентирующие клетки представляют собой дендритные клетки. В другом варианте осуществления дендритные клетки подвергаются направленному действию с использованием маркера DEC205, XCR1, CD197, CD80, CD86, CD123, CD209, CD273, CD283, CD289, CD184, CD85h, CD85j, CD85k, CD85d, CD85g, CD85a, CD141, CD11c, CD83, рецептора TSLP, Clec9a или CD1a. В другом варианте осуществления дендритные клетки подвергаются направленному действию с использованием маркера CD141, DEC205 или XCR1.

[45] В определенных вариантах осуществления изобретение относится к системе доставки in vivo, содержащей выделенный неоантигенный пептид, описываемый в настоящем описании. В другом варианте осуществления система доставки включает проникающие в клетку пептиды, инкапсуляцию в оболочку из наночастиц, вирусоподобные частицы или липосомы. В другом варианте осуществления проникающий в клетку пептид представляет собой пептид TAT, вирус простого герпеса VP22, транспортан или Antp.

[46] В определенных вариантах осуществления изобретение относится к клетке, содержащей выделенный неоантигенный пептид, описываемый в настоящем описании. В другом варианте осуществления клетка представляет собой антигенпрезентирующую клетку. В другом варианте осуществления клетка представляет собой дендритную клетку.

[47] В определенных вариантах осуществления изобретение относится к композиции, содержащей выделенный неоантигенный пептид, описываемый в настоящем описании. В другом варианте осуществления композиция содержит по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29 или по меньшей мере 30 выделенных неоантигенных пептидов, содержащих опухолеспецифичный неоэпитоп, определяемый в таблице 1 или 2. В другом варианте осуществления композиция содержит от 2 до 20 неоантигенных пептидов. В другом варианте осуществления композиция дополнительно содержит по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, или по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29 или по меньшей мере 30 дополнительных неоантигенных пептидов. В другом варианте осуществления композиция содержит приблизительно от 4 и приблизительно от 20 дополнительных неоантигенных пептидов. В другом варианте осуществления дополнительный неоантигенный пептид является специфическим для отдельной опухоли пациента. В другом варианте осуществления специфический неоантигенный пептид пациента выбран путем идентификации различий последовательностей между геном, экзом и/или транскриптомом образца опухоли пациента и геном, экзом и/или транскриптомом не являющегося опухолью образца. В другом варианте осуществления образцы являются свежими или фиксированными в формалине, погруженными в парафин опухолевыми тканями, только что выделенными клетками или циркулирующими опухолевыми клетками. В другом варианте осуществления различия последовательностей определяют секвенированием нового поколения.

[48] В определенных вариантах осуществления изобретение относится к выделенному полинуклеотиду, кодирующему выделенный неоантигенный пептид, описываемый в настоящем описании. В другом варианте осуществления выделенный полинуклеотид представляет собой РНК, необязательно самоамплифицирующуюся РНК. В другом варианте осуществления РНК модифицируют для повышения стабильность, повышения направленности на клетки, повышения эффективности трансляции, адъювантности, доступности в цитозоле и/или уменьшения цитотоксичности. В другом варианте осуществления модификация представляет собой конъюгацию с белком-носителем, конъюгацию с лигандом, конъюгацию с антителом, оптимизацию кодона, повышенное содержание GC, введение модифицированных нуклеозидов, введение 5'-кэпа или аналога кэпа и/или введение немаскированной последовательности поли-A.

[49] В определенных вариантах осуществления изобретение относится к клетке, содержащей полинуклеотид, описываемый в настоящем описании.

[50] В определенных вариантах осуществления изобретение относится к вектору, содержащему полинуклеотид, описываемый в настоящем описании. В другом варианте осуществления полинуклеотид является функционально связанным с промотором. В другом варианте осуществления вектор содержит самоамплифицирующийся репликон РНК, плазмиду, фаг, транспозон, космиду, вирус или вирион. В другом варианте осуществления вектор представляет собой аденоассоциированный вирус, вирус герпеса, лентивирус или их псевдотипы.

[51] В определенных вариантах осуществления изобретение относится к системе доставки in vivo, содеждащей выделенный полинуклеотид, описываемый в настоящем описании. В другом варианте осуществления система доставки включает сферические нуклеиновые кислоты, вирусы, вирусоподобные частицы, плазмиды, бактериальные плазмиды или наночастицы.

[52] В определенных вариантах осуществления изобретение относится к клетке, содержащей вектор или систему доставки, описываемые в настоящем описании. В другом варианте осуществления клетка представляет собой антигенпрезентирующую клетку. В другом варианте осуществления клетка представляет собой дендритную клетку. В другом варианте осуществления клетка представляет собой незрелую дендритную клетку.

[53] В определенных вариантах осуществления изобретение относится к композиции, содержащей по меньшей мере один полинуклеотид, описываемый в настоящем описании. В другом варианте осуществления композиция содержит по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29 или по меньшей мере 30 выделенных полинуклеотидов. В другом варианте осуществления композиция содержит приблизительно от 2 и приблизительно 20 полинуклеотидов, которые кодируют неоантигенные пептиды. В другом варианте осуществления композиция дополнительно содержит по меньшей мере 1, по меньшей мере 2, по меньшей мере 3, по меньшей мере 4, по меньшей мере 5, по меньшей мере 6, по меньшей мере 7, по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29 или по меньшей мере 30 дополнительных неоантигенных полинуклеотидов, кодирующих дополнительные неоантигенные пептиды. В определенных вариантах осуществления композиция содержит приблизительно от 4 и приблизительно от 20 дополнительных неоантигенных полинуклеотидов. В определенных вариантах осуществления выделенные полинуклеотиды и дополнительные неоантигенные полинуклеотиды являются связанными. В определенных вариантах осуществления полинуклеотиды связывают с использовнием нуклеиновой кислоты, которая кодирует полиглициновый или полисериновый линкер. В определенных вариантах осуществления по меньшей мере один из дополнительных неоантигенных пептидов является специфическим для отдельной опухоли пациента. В определенных вариантах осуществления специфический неоантигенный пептид пациента выбран путем идентификации различий последовательностей между геном, экзомом и/или транскриптомом образца опухоли пациента и геном, экзомом и/или транскриптомом не являющегося опухолью образца. В определенных вариантах осуществления образцы являются свежими или фиксированными в формалине, погруженными в парафин опухолевыми тканями, только что выделенными клетками, или циркулирующие опухолевые клетки. В определенных вариантах осуществления различия последовательностей определяют секвенированием нового поколения.

[54] В определенных вариантах осуществления изобретение относится к T-клеточному рецептору (TCR), способному связывать по меньшей мере один неоантигенный пептид, описываемый в настоящем описании. В определенных вариантах осуществления TCR способен связывать выделенный неоантигенный пептид в пределах MHC I класса или II класса.

[55] В определенных вариантах осуществления изобретение относится к химерному антигенному рецептору, содержащему: (i) активирующую T-клетки молекулу; (ii) трансмембранную область и (iii) антигенраспознающий фрагмент, способный связывать выделенный неоантигенный пептид, описываемый в настоящем описании. В определенных вариантах осуществления химерный антигенный рецептор содержит CD3-дзета в качестве активирующую T-клетки молекулы. В определенных вариантах осуществления химерный антигенный рецептор дополнительно содержит по меньшей мере один костимулирующий сигнальный домен. В определенных вариантах осуществления сигнальный домен представляет собой CD28, 4-1BB, ICOS, OX40, ITAM или Fc эпсилон RI-гамма. В определенных вариантах осуществления антигенраспознающий фрагмент способен связывать выделенный неоантигенный пептид в пределах MHC I класса или II класса. В определенных вариантах осуществления химерный антигенный рецептор содержит трансмембранную область CD3-дзета, CD28, CTLA-4, ICOS, BTLA, KIR, LAG3, CD137, OX40, CD27, CD40L, Tim-3, A2aR или PD-1. В определенных вариантах осуществления опухолеспецифичный эпитоп располагается во внеклеточном домене опухолеассоциированного полипептида.

[56] В определенных вариантах осуществления изобретение относится к T-клетке, содержащей T-клеточный рецептор или химерный антигенный рецептор, описываемый в настоящем описании. В определенных вариантах осуществления T-клетка представляет собой хелперную или цитотоксическую T-клетку.

[57] В определенных вариантах осуществления изобретение относится к нуклеиновой кислоте, содержащей промотор, функционально связанный с полинуклеотидом, кодирующим T-клеточный рецептор, описываемый в настоящем описании. В определенных вариантах осуществления TCR способен связывать по меньшей мере один неоантигенный пептид в пределах главного комплекса гистосовместимости (MHC) I класса или II класса. В другом варианте осуществления нуклеиновая кислота содержит промотор, функционально связанный с полинуклеотидом, кодирующим химерный антигенный рецептор, описываемый в настоящем описании. В другом варианте осуществления антигенраспознающий фрагмент способен связывать по меньшей мере один неоантигенный пептид в пределах главного комплекса гистосовместимости (MHC) I класса или II класса. В определенных вариантах осуществления опухолеспецифичный эпитоп располагается во внеклеточном домене опухолеассоциированного полипептида. В определенных вариантах осуществления нуклеиновая кислота содержит трансмембранную область CD3-дзета, CD28, CTLA-4, ICOS, BTLA, KIR, LAG3, CD137, OX40, CD27, CD40L, Tim-3, A2aR или PD-1.

[58] В определенных вариантах осуществления изобретение относится к антителу, способному связывать по меньшей мере один неоантигенный пептид, описываемый в настоящем описании.

[59] В определенных вариантах осуществления изобретение относится к модифицированной клетке, трансфицированной или трансдуцированной нуклеиновой кислотой, описываемой в настоящем описании. В определенных вариантах осуществления модифицированная клетка представляет собой T-клетку, проникающий в опухоль лимфоцит, NK-T-клетку, экспрессирующую TCR клетку, CD4+ T-клетку, CD8+ T-клетку или NK клетку.

[60] В определенных вариантах осуществления изобретение относится к композиции, содержащей T-клеточный рецептор или химерный антигенный рецептор, описываемый в настоящем описании. В определенных вариантах осуществления композиция содержит аутологичные T-клетки пациента, содержащие T-клеточный рецептор или химерный антигенный рецептор. В определенных вариантах осуществления композиция дополнительно содержит ингибитор иммунной контрольной точки. В определенных вариантах осуществления композиция дополнительно содержит по меньшей мере два ингибитора иммунной контрольной точки. В определенных вариантах осуществления каждый из ингибиторов иммунных контрольных точек ингибирует белок контрольных точек, выбранный из группы, состоящей из семейство лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7 или их сочетания. В определенных вариантах осуществления каждый из ингибиторов иммунных контрольных точек взаимодействует с лигандом белка контрольных точек, выбранным из группы, состоящей из семейства лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7 или их сочетания.

[61] В определенных вариантах осуществления композиция дополнительно содержит иммуномодулятор или адъювант. В другом варианте осуществления иммуномодулятор представляет собой костимулирующий лиганд, лиганд TNF, лиганд суперсемейства Ig, CD28, CD80, CD86, ICOS, CD40L, OX40, CD27, GITR, CD30, DR3, CD69 или 4-1BB. В другом варианте осуществления иммуномодулятор представляет собой по меньшей мере одну злокачественную клетку или экстракт злокачественных клеток. В другом варианте осуществления злокачественная клетка является аутологичной для индивидуума, нуждающегося в композиции. В другом варианте осуществления злокачественная клетка подвергается лизису или действию УФ-излучения. В другом варианте осуществления адъювант индуцирует гуморальный ответ при введении индивидууму. В другом варианте осуществления адъювант индуцирует 1 тип T-хелперных клеток при введении индивидууму.

[62] В определенных вариантах осуществления изобретение относится к способу ингибирования роста опухолевой клетки, экспрессирующей опухолеспецифичный неоэпитоп, описываемый в настоящем описании, включающему приведение опухолевой клетки в контакт с пептидом, полинуклеотидом, системой доставки, вектором, композицией, антителом или клетками по изобретению.

[63] В определенных вариантах осуществления изобретение относится к способу лечения злокачественной опухоли или стимуляции, усиления или продления противоопухолевого ответа у нуждающегося в этом индивидуума, включающему введение индивидууму пептида, полинуклеотида, вектора, композиция, антитела или клеток, описываемых в настоящем описании.

[64] В определенных вариантах осуществления злокачественная опухоль выбрана из рака надпочечника, рака мочевого пузыря, рака молочной железы, рака шейки матки, колоректального рака, глиобластомы, рака головы и шеи, хромофобного рака почки, светлоклеточного рака почки, папиллярного рака почки, рака печени, аденокарциномы легкого, плоскоклеточного рака легких, рака яичника, рака поджелудочной железы, меланома, рака желудка, рака эндометрия тела матки и карциносаркомы матки.

[65] В определенных вариантах осуществления злокачественная опухоль выбрана из группа из: рака предстательной железы, рака мочевого пузыря, плоскоклеточного рака легких, NSCLC, рака молочной железы, рака головы и шеи, аденокарциномы легких, GBM, глиомы, CML, AML, супратенториальной эпендимомы, острого промиелоцитарного лейкоза, солитарных фиброзных опухолей и устойчивой к кризотинибу злокачественной опухоли.

[66] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из CRC, рака головы и шеи, рака желудка, плоскоклеточного рака легких, аденокарциномы легких, рака предстательной железы, рака мочевого пузыря, рака желудка, почечноклеточной карциномы и рака матки.

[67] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из меланомы, плоскоклеточного рака легких, DLBCL, рака матки, рака головы и шеи, рака матки, рака печени и CRC.

[68] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из рака лимфатической системы; лимфомы Беркита, нейробластомы, аденокарциномы предстательной железы, колоректальной аденокарциномы; аденокарциномы матки/эндометрия; MSI+; серозной карциномы эндометрия; карциносаркомы матки - злокачественной смешанной мезодермальной опухоли; глиомы; астроцитомы; GBM, острого миелолейкоза, ассоциированного с MDS; хронического лимфоцитарного лейкоза - мелкоклеточной лимфомы; миелодиспластического синдрома; острого миелолейкоза; карциномы молочной железылюминального типа NS; хронического миелоидного лейкоза; протоковой карциномы поджелудочной железы; хронического миеломоноцитарного лейкоза; миелофиброзы; миелодиспластического синдрома; аденокарциномы предстательной железы; эссенциальной тромбоцитемии и медулломиобластомы.

[69] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из колоректального рака, рака матки, рака эндометрия и рака желудка.

[70] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из рака шейки матки, рака головы и шеи, рака анального канала, рака желудка, лимфомы Беркита и карциномы носоглотки.

[71] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из рака мочевого пузыря, колоректального рака и рака желудка.

[72] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из рака легких, CRC, меланомы, рака молочной железы, NSCLC и CLL.

[73] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из адренокортикальной карциномы (ACC), острого промиелоцитарного лейкоза, острого миелолейкоза (AML), AML, ассоциированного с миелодиспластическими синдромами (MDS), рака анального канала, астроцитомы, рака мочевого пузыря, уротелиальной карциномы мочевого пузыря (BLCA), рака молочной железы, инвазивной карциномы молочной железы (BRCA), лимфомы Беркита, кастрационно-резистентного рака предстательной железы, рака шейки матки, плоскоклеточной карциномы шейки матки и эндоцервикальной аденокарциномы (CESC), хронического лимфоцитарного лейкоза-мелкоклеточной лимфомы, хронического лимфоцитарного лейкоза (CLL), хронического миелоидного лейкоза (CML), хронического миеломоноцитарного лейкоза, колоректальной аденокарциномы, колоректального рака (CRC), устойчивого к кризотинибу немелкоклеточного рака легких (NSCLC), диффузной крупноклеточной B-клеточной лимфомы (DLBCL), протоковой карциномы поджелудочной железы, карциносаркомы матки - злокачественной смешанной мезодермальной опухоли, серозной карциномы эндометрия, эссенциальной тромбоцитемии, мультиформной глиобластомы (GBM), глиомы, рака рака головы и шеи, плоскоклеточной карциномы головы и шеи (HNSC), инвазивной дольковой карциномы (ILC) LumA молочной железы, хромофобного рака почки (KICH), почечноелкточной светлоклеточной карциномы (KIRC), папиллярно-клеточной карциномы почки (KIRP), острого миелолейкоза (LAML), печеночноклеточной карциномы (LIHC), рака печени, аденокарциномы легких (LUAD), плоскоклеточной карциномы легких (LUSC), карциномы молочной железы люминального типа NS, рака легких, рака лимфатической системы, медулломиобластомы, меланомы, колоректального рака (CRC) с нестабильностью микросателлитов (MSI)+, MSI+ эндометриоидной карциномы, MSI+ рака желудка, MSI+ рака матки/эндометрия, миелодиспластического синдрома, миелофиброза, карциномы носоглотки, нейробластомы, немелкоклеточного рака легких (NSCLC), серозной цистаденокарциномы яичника (OV), аденокарциномы поджелудочной железы (PAAD), аденокарциномы предстательной железы (PRAD), рака предстательной железы, почечноклеточной карциномы, меланомы кожи (SKCM), солитарных фиброзных опухолей, аденокарциномы желудка (STAD), рака желудка, супратенториальной эпендимомы, аденокарциномы щитовидной железы (THCA), эндометриоидной карциномы тела матки (UCEC) или карциносаркомы матки (UCS), рака матки и аденокарциномы матки/эндометрия.

[74] В определенных вариантах осуществления злокачественная опухоль выбрана из группы, состоящей из уротелиальной карциномы мочевого пузыря (BLCA), инвазивной карциномы молочной железы (BRCA), рака молочной железы, плоскоклеточной карциномы шейки матки и эндоцервикальной аденокарциномы (CESC), хронического лимфоцитарного лейкоза (CLL), колоректального рака (CRC), мультиформной глиобластомы (GBM), плоскоклеточной карциномы головы и шеи (HNSC), папиллярно-клеточной карциномы почки (KIRP), печеночноклеточной карциномы (LIHC), аденокарциномы легких (LUAD), плоскоклеточной карциномы легких (LUSC), аденокарциномы поджелудочной железы (PAAD), рака предстательной железы, меланомы кожи (SKCM), аденокарциномы желудка (STAD), аденокарциномы щитовидной железы (THCA) и эндометриоидной карциномы тела матки (UCEC).

[75] В определенных вариантах осуществления индивидуум является человеком. В другом варианте осуществления индивидуум страдает злокачественной опухолью. В другом варианте осуществления злокачественная опухоль выбрана из группы, состоящей рака мочеполовой системы, гинекологического рака, рака легких, желудочно-кишечного рака, рак рака головы и шеи, злокачественной глиобластомы, злокачественной мезотелиомы, неметастатического или метастатического рака молочной железы, злокачественной меланомы, Карциномы из клеток Меркеля или саркомы костей и мягких тканей, гематологической неоплазим, множественной миеломы, острого миелогенного лейкоза, хронического миелогенного лейкоза, миелодиспластического синдрома и острого лимфобластного лейкоза, немелкоклеточного рака легких (NSCLC), рака молочной железы, метастатического колоректального рака, гормончувствительного или гормонрезистентного рака предстательной железы, колоректального рака, рака яичника, гепатоцеллюлярного рака, печеночноклеточного рака, рака поджелудочной железы, рака желудка, рака пищевода, гепатоцеллюлярного рака, холангиогенного рака, плоскоклеточного рака головы и шеи, саркома мягких тканей и мелкоклеточного рака легких. В другом варианте осуществления индивидуум подвергался хирургическому удалению опухоли. В другом варианте осуществления пептид, полинуклеотид, вектор, композицию или клетки вводят посредством внутривенного, интраперитонеального, внутриопухолевого, внутрикожного или подкожного введения. В другом варианте осуществления пептид, полинуклеотид, вектор, композицию или клетки вводят в анатомический участок, который впадает в лимфатический коллектор. В другом варианте осуществления введение проводят в несколько лимфатических коллекторов. В другом варианте осуществления введение проводят подкожным или внутрикожным путем.

[76] В определенных вариантах осуществления способа вводят пептид. В другом варианте осуществления введение проводят внутрь опухоли. В другом варианте осуществления способа вводят полинуклеотид, необязательно РНК. В другом варианте осуществления полинуклеотид вводят внутривенно. В определенных вариантах осуществления способа вводят клетку. В другом варианте осуществления клетка представляет собой T-клетку или дендритную клетку. В другом варианте осуществления пептид или полинуклеотид содержит фрагмент, направленный на антигенпрезентирующие клетки.

[77] В другом варианте осуществления способа индивидууму также вводят по меньшей мере один ингибитор иммунных контрольных точек. В другом варианте осуществления ингибитор контрольных точек представляет собой биологическое терапевтическое или низкомолекулярное соединение. В другом варианте осуществления ингибитор контрольных точек выбран из группы, состоящей из моноклонального антитела, гуманизированного антитела, полностью принадлежащего человеку антитела и слитого белка или их сочетания. В другом варианте осуществления ингибитор контрольных точек ингибирует белок контрольных точек, выбранный из группы, состоящей из семейства лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7 или их сочетания. В другом варианте осуществления ингибитор контрольных точек взаимодействует с лигандом белка контрольных точек, выбранным из группы, состоящей из семейства лигандов CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR и B-7 или их сочетания. В другом варианте осуществления вводят два или более ингибитора контрольных точек. В другом варианте осуществления ингибиторы контрольных точек представляют собой: (i) ипилимумаб или тремелимумаба и (ii) ниволумаб. В другом варианте осуществления ингибитор контрольных точек и композицию вводят одновременно или последовательно в любом порядке. В другом варианте осуществления неоантигенный пептид, полинуклеотид, вектор, композицию или клетки вводят до ингибитора контрольных точек. В другом варианте осуществления пептид, полинуклеотид, вектор, композицию или клетки вводят после ингибитор контрольных точек. В другом варианте осуществления ингибитор контрольных точек продолжают вводить на всем протяжении терапии неоантигенным пептидом, полинуклеотидом, вектором, композицией или клетками. В другом варианте осуществления терапию неоантигенным пептидом, полинуклеотидом, вектором, композицией или клетками приводят у индивидуумов, которые частично реагировали или не реагировали на терапию ингибитором контрольных точек. В другом варианте осуществления композицию вводят внутривенно или подкожно. В другом варианте осуществления ингибитор контрольных точек вводят внутривенно или подкожно. В другом варианте осуществления ингибитор контрольных точек вводят подкожно приблизительно в 2 см от участка введения композиции. В другом варианте осуществления композицию вводят в тот же дренирующий лимфоузел, что и ингибитор контрольных точек.

[78] В определенных вариантах осуществления способа вводят дополнительное средство. В другом варианте осуществления средство представляет собой химиотерапевтическое средство, иммуномодулирующее лекарственное средство, модифицирующее иммунный метаболизм лекарственное средство, направленную терапию, облучение, антиангиогенное средство или средство, которое уменьшает подавление иммунитета. В другом варианте осуществления химиотерапевтическое средство представляет собой алкилирующее средство, ингибитор топоизомеразы, антиметаболит или антимитотическое средство. В другом варианте осуществления дополнительное средство представляет собой антитело-агонист к индуцированному глюкокортикоидом семейству рецепторов фактора некроза опухоли или фрагмент, ибрутиниб, доцетаксел, цисплатин или циклофосфамид. В другом варианте осуществления введение вызывает CD4+ T-клеточный иммунный ответ. В другом варианте осуществления введение вызывает CD4+ T-клеточный иммунный ответ и CD8+ T-клеточный иммунный ответ.

[79] В определенных вариантах осуществления изобретение относится к способу стимуляции иммунного ответа у индивидуума, включающему введение эффективного количества модифицированных клеток или композиции, описываемой в настоящем описании. В другом варианте осуществления иммунный ответ представляет собой цитотоксический и/или гуморальный иммунный ответ. В другом варианте осуществления способ стимулирует опосредованный T-клетками иммунный ответ у индивидуума. В другом варианте осуществления опосредованный T-клетками иммунный ответ направлен против клетки-мишени. В другом варианте осуществления клетка-мишень представляет собой опухолевую клетку. В другом варианте осуществления модифицированные клетки трансфицируют или трансдуцируют in vivo. В другом варианте осуществления модифицированные клетки трансфицируют или трансдуцируют ex vivo. В другом варианте осуществления модифицированные клетки являются аутологичными T-клетками пациента. В другом варианте осуществления аутологичные T-клетки пациента получают от пациента, который получал вакцину на основе неоантигенного пептида или нуклеиновой кислоты. В другом варианте осуществления вакцина на основе неоантигенного пептида или нуклеиновой кислоты содержит по меньшей мере один персонализированный неоантиген. В другом варианте осуществления вакцина на основе неоантигенного пептида или нуклеиновой кислоты содержит по меньшей мере один дополнительный неоантигенный пептид, описываемый в настоящем описании. В другом варианте осуществления пациент получал химиотерапевтическое средство, иммуномодулирующее лекарственное средство, модифицирующее иммунный метаболизм лекарственное средство, направленную терапию или облучение до и/или во время получения вакцины на основе неоантигенного пептида или нуклеиновой кислоты. В другом варианте осуществления пациент получает лечение по меньшей мере одним ингибитором контрольных точек. В другом варианте осуществления аутологичные T-клетки получают от пациента, который уже получал по меньшей мере один цикл T-клеточной терапии, включающей неоантиген. В другом варианте осуществления способ дополнительно включает адоптивную T-клеточную терапию. В другом варианте осуществления адоптивная T-клеточная терапия включает аутологичные T-клетки. В другом варианте осуществления аутологичные T-клетки направлены против опухолевых антигенов. В другом варианте осуществления адоптивная T-клеточная терапия дополнительно включает аллогенные T-клетки. В другом варианте осуществления аллогенные T-клетки направлены против опухолевых антигенов. В другом варианте осуществления адоптивную T-клеточную терапию проводят до введения ингибитора контрольных точек.

[80] В определенных вариантах осуществления изобретение относится к способу оценки эффективности лечения, включающему: (i) определение количества или концентрации клеток-мишеней в первом образце, получаемом от индивидуума до введения модифицированной клетки, (ii) определение количества или концентрации клеток-мишеней во втором образце, получаемом от индивидуума после введения модифицированной клетки, и (iii) определение увеличения или уменьшения количества или концентрации клеток-мишеней во втором образце по сравнению с количеством или концентрацией клеток-мишеней в первом образце. В другом варианте осуществления эффективность лечения определяют мониторингом клинического исхода; увеличения, усиления или пролонгирования противоопухолевой активности T-клетками; увеличения количества противоопухолевых T-клеток или активированных T-клеток по сравнению с количеством до лечения; B-клеточной активности; CD4 T-клеточной активности или их сочетания. В другом варианте осуществления эффективность лечения определяют мониторингом биомаркера. В другом варианте осуществления биомаркер выбран из группы, состоящей из CEA, Her-2/neu, антигена опухоли мочевого пузыря, тиреоглобулина, альфа-фетопротеина, PSA, CA 125, CA19.9, CA 15.3, лептина, пролактина, остеопонтина, IGF-II, CD98, фасцина, sPIgR, 14-3-3-эта, тропонина I и натрийуретического пептида типа b. В другом варианте осуществления клинический исход выбран из группы, состоящей из регрессии опухоли; уменьшения размера опухоли; некроза опухоли; противоопухолевого ответа иммунной системой; распространения, рецидива или метастазирования опухоли, или их сочетания. В другом варианте осуществления эффект лечение прогнозируют на основании присутствия T-клеток или присутствия генной сигнатуры, указывающей на Т-клеточное воспаление, или их сочетания.

[81] В определенных вариантах осуществления изобретение относится к способу лечения злокачественной опухоли или стимуляции, усиления или продления противоопухолевого ответа у нуждающегося в этом индивидуума, включающему введение индивидууму: (a) пептида, полинуклеотида, вектора, композиции, антитела или клеток, описываемых в настоящем описании, и (b) по меньшей мере одного ингибитора контрольных точек. В другом варианте осуществления способ дополнительно включает введение иммуномодулятора или адъюванта. В другом варианте осуществления иммуномодулятор или адъювант выбран из группы, состоящей из поли(I:C), поли-ICLC, агониста STING, 1018 ISS, солей алюминия, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, имихимода, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, JuvImmune, LipoVac, MF59, монофосфориллипида A, Montanide IMS 1312 VG, Montanide ISA 206 VG, Montanide ISA 50 V2, Montanide ISA 51 VG, OK-432, OM-174, OM-197-MP-EC, агониста ISA-TLR2, ONTAK, векторной системы PepTel®, микрочастиц PLG, резиквимода, SRL172, виросом и других вирусоподобных частиц, YF-17D, VEGF-Trap, R848, бета-глюкана, Pam3Cys, Pam3CSK4, акриловых или метакриловых полимеров, сополимеров малеинового ангидрида и стимунола QS21, костимулирующего лиганда, лиганда TNF, лиганда суперсемейства Ig, CD28, CD80, CD86, ICOS, CD40L, OX40, CD27, GITR, CD30, DR3, CD69 или 4-1BB. В другом варианте осуществления иммуномодулятор или адъювант представляет собой поли-ICLC. В другом варианте осуществления ингибитор контрольных точек представляет собой антитело к PDl или фрагмент. В другом варианте осуществления ингибитор пути PD-1 представляет собой ниволумаб. В другом варианте осуществления ингибитор контрольных точек представляет собой антитело к CTLA4 или фрагмент. В другом варианте осуществления антитело к CTLA4 представляет собой ипилимумаб или тремелимумаба. В другом варианте осуществления способ включает введение антитела к PD1 и антитела к CTLA4. В другом варианте осуществления введение ингибитора контрольных точек начинают после начала введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В другом варианте осуществления введение ингибитора контрольных точек начинают после начала введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В другом варианте осуществления введение ингибитора контрольных точек начинают одновременно с началом введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В другом варианте осуществления пептид, полинуклеотид, вектор, композиция, антитело или клетку вводят внутривенно или подкожно. В другом варианте осуществления ингибитор контрольных точек вводят внутривенно или подкожно. В другом варианте осуществления ингибитор контрольных точек вводят подкожно приблизительно в 2 см от участка введения пептида, полинуклеотида, вектора, композиции, антитела или клетки. В другом варианте осуществления пептид, полинуклеотид, вектор, композиция, антитело, или клетку вводят в тот же дренирующий лимфоузел, что и ингибитор контрольных точек.

[82] В определенных вариантах осуществления терапевтических способов дополнительное терапевтическое средство представляет собой, например, химиотерапевтическое или биотерапевтическое средство, облучение или иммунотерапию. Можно проводить любое подходящее терапевтическое лечение для конкретной злокачественной опухоли. Примеры химиотерапевтических и биотерапевтических средств включают, но не ограничиваются ими, ингибитор ангиогенеза, такой как гидроксиангиостатин K l-3, DL-a-дифторметилорнитин, эндостат III, фумагиллин, генистеин, миноциклин, стауроспорин и талидомид; интеркалятор/крослинкер ДНК, такой как блеомицин, карбоплатин, каррмистем, хлорамбуцил, цклофосфамид, дихлорид цис-диаминплатина (D) (цисплатин), мелфалан, митоксантрон и оксалиплатин; ингибитор синетеза ДНК, такой как (В±)-аметоптерин (метотрексат), 3-амино-1,2,4-бензотриазин-1,4-диоксид, аминоптерин, цитозин β-D-арабинофуранозид, 5-фромо-5'-дезоксиуридин, 5-фторурацил, ганцикловир, гидроксимочевину и митомицин C; регуляторы транскрипции ДНК-РНК, такие как актиномицин D, дау орубицин, доксорубицин, гомогаррингтонин и идарубицин; ингибитор οη/.γηκ, такой как S(-i-)-камптотекм, куркумин, (-)-дегуельм ((-)-Deguelm), 5,6-Дихлорбензимидазол 1-β-D-рибофуранозид, этопозид, форместан, фостриецин, гиспидин, 2-иммо-1-имидазолидинуксусная кислота (циклокреатин), мевмолин, трихостатин A, тирфостин AG 34 и тирфостин AG 879; ген-регулятор, такой как 5-аза-2'-дезоксицитидин, 5-азацитидин, холекальциферол (витамин D3), 4-гидрокситамоксифен, мелатонин, мифепристон, ралоксифен, полностью-транс-ретиналь (альдегид витамина A), полностью транс-ретиноевую кислоту (витамин A кислота), 9-цис-ретиноевую кислоту, 13-цис-ретиноевую кислоту, ретинол (витамин A), тамоксифен и троглитазон; ингибитор микротрубочек, такой как колхицин, доцетаксел, доластатирс 15, нокодазол, паклитаксел, подофиллотоксин, ризоксин, винбластин, винкристин, виндесин и винорелбин (навельбин); и неклассифицированное терапевтическое средство, такое как 17-(аллиламино)-1 7-деметоксигельдамицин, 4-амино-1,8-нафталимид, апигенин, брефелдин A, Циметидин, дихлорметилендифосфоновую кислоту, лейпролид (лейпрорелин), гормон, стимулирующий высвобождение лютеинизирующего гормона, пифитрин-a, рапамицин, глобулин, связывающий половые гормоны, тапсигаргин и фрагмент ингибитора трипсина в моче (бикунин). Терапевтическое средство может представлять собой алтретамин, амифостин, аспарагиназу, капецитабин, кладрибин, цисаприд, циларагирс, дакарбазин (DT1C), дактиномицин, дронабинол, эпоэтин альфа, филграстим, флударабин, гемцитабин, гранисетрон, ифосфамид, иринотекан, лансопразол, левамизол, лейковорин, мегестрол, месна, метохлорамид, митотан, омепразол, ондансетрон, пилокарпин, прохлорперазин или топотекангидрохлорид. Терапевтическое средство может представлять собой моноклональное антитело, такое как ритуксимаб (Rituxan®), алемтузумаб (Campath®), бевацизумаб (Avastin®), цетуксимаб (Erbitux®), панитумумаб (Vectibix®), и трастузумаб (Herceptin®), вемурафениб (Zelboraf®), иматиниба мезилат (Gleevec®), эрлотиниб (Tarceva®), гефитиниб (Iressa®), висмодегиб (Erivedge™), 90Y-ибритумомаба тиуксетан, 1311-тозитумомаб, адотрастузумаб эмтанзин, лапатиниб (Tykerb®), пертузумаб (Perjeta™), адотрастузумаб эмтанзин (adcyla™), регорафениб (Stivarga®), сунитиниб (Sutent®), деномумаб (Xgeva®), сорафениб (Nexavar®), пазопаниб (Votrient®), акситиниб (Inita®), дазатиниб (Sprycel®), нилотиниб (Tasigna®), босутиниб (Bosulif®), офатумумаб (Arzerra®), обинутузумаб (Gazyva™), ибрутиниб (Imbruvica™), иделалисиб (Zydelig®), кризотиниб (Xalkori®), эрлотиниб (Tarceva®), афатиниб дималеат (Giiotrif®), церитиниб (LDK378/зикадия), тозитумомаб и 1311-тозитумомаб (Bexxar®), ибритумомаб тиуксетан (Zevalin®), брентуксимаб ведотин (Adcetris®), бортезомиб (Velcade®), силтуксимаб (Sylvant™), траметиниб (ekinist®), дабрафениб (Tafmlar®), пембролизимиаб (Keytruda®), карфилзомиб (Kyprolis®), рамуцирумаб (Cyramza™), кабозантиниб (Cometriq™), вандетаниб (Caprelsa®). Необязательно терапевтическое средство представляет собой неоантиген. Терапевтическое средство может представлять собой цитокин, такой как интерфероны (INF), интерлейкины (IL) или гемопоэтические факторы роста. Терапевтическое средство может представлять собой INF-α, IL-2, альдеслейкин, IL-2, эритропоэтин, гранулоцитарно-моноцитарный колониестимулирующий фактор (GM-CSF) или гранулоцитарный колониестимулирующий фактор. Терапевтическое средство может представлять собой направленную терапию, такую как торемифен (Fareston®), фулвестрант (Faslodex®), анастрозол (Arimidex®), экземестан (Aromasin®), летрозол (Femara®), зив-афлиберцепт (Zaltrap®), алитретиноин (Panretin®), темсиролимус (Torisel®), третиноин (Vesanoid®), денилейкин дифтитокс (Ontak®), вориностат (Zoiinza®), ромидепсин (Istodax®), бексаротен (Targretin®), пралатрексат (Foiotyn®), леналиомид (Revlimid®), белиностат (Beleodaq™), леналиомид (Revlimid®), помалидомид (Pomalyst®), кабазитаксел (Jevtana®), энзалутамид (Xtandi®), абиратеронацетат (Zytiga®), хлорид радия 223 (Xofigo®) или эверолимус (Afiniior®). Дополнительно терапевтическое средство может представлять собой эпигенетически направленное лекарственное средство, такое как ингибиторы HDAC, ингибиторы киназ, ингибиторы ДНК-метилтрансферазы, ингибиторы гистондеметилазы или ингибиторы метилирования гистонов. Эпигенетические лекарственные средства могут представлять собой азацитидин (видаза), децитабин (дакоген), вориностат (золинза), ромидепсин (истодакс) или руксолитиниб (джакафи). Для рака предстательной железы лечение, предпочтительно химиотерапевтическое средство, с которым можно комбинировать антитело к CTLA-4, представляет собой паклитаксел (таксол).

[83] В определенных вариантах осуществления изобретение относится к набору, содержащему любое терапевтическое средство на основе неоантигена, описываемое в настоящем описании.

[84] В случае, когда аспекты или варианты осуществления изобретения описаны в отношении группы Маркуша или других групп альтернативных вариантов, настоящее изобретение относится не только к группе, приведенной как единое целое, а также к каждому члену группы отдельно и всем возможным подгруппам основной группы, а также к отсутствию в основной группе одного или более членов группы. Настоящее изобретение также предусматривает явное исключение одного или более любых членов группы в описываемом в заявке изобретении.

ВЛЮЧЕНИЕ В ОПИСАНИЕ ПОСРЕДСТВОМ ССЫЛКИ

[85] Все публикации, патенты и патентные заявки, указанные в этом описании, полностью включены в настоящее описание посредством ссылки для всех целей, в той же степени как если бы каждая отдельная публикация, патент или патентная заявка была конкретно и отдельно указана посредством ссылки. Например, все публикации и патенты, указанные в настоящем описании, полностью включены в настоящее описание посредством ссылки с целью описания и раскрытия наборов, композиций и методологий, которые описаны в публикациях, которые можно использовать по отношению к способам, наборам и композициям, описываемым в настоящем описании. Документы, обсуждаемые в настоящем описании, предоставлены только для их раскрытия до даты подачи настоящей заявки. Ничто в настоящем описании не следует рассматривать как допущение того, что авторы изобретения, описываемого в настоящем описании, не имеют права датировать такое раскрытие в силу предшествующего изобретения или по любой другой причине.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

[86] На фигуре 1 представлен иллюстративный график 562 пептидов с теоретически рассчитанной аффинностью для выбранной молекулы HLA I класса от 1 нМ до 100000 нМ (нанесено по оси x), которые синтезировали. Фактическую аффинность (IC50 (нМ)) измеряли так, как описано (ось y). Толстые вертикальные и горизонтальные линии означают порог 500 нМ между слабыми и очень слабыми теоретически рассчитанными и наблюдаемыми связывающими средствами, соответственно. Диагональная точечная линия означает линию наилучшего соответствия (Graphpad Prism) с R2 0,45.

[87] На фигуре 2 представлен иллюстративный график 275 пептидов из фигуры 1, которые тестировали на стабильность (T1/2, часы) с их соответствующими молекулами HLA I класса. Пептиды группировали в соответствии с наблюдаемой аффинностью на фигуре 1. Медиана и межквартильный диапазон представлен для каждой группы.

[88] На фигуре 3A представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарные дендритные клетки, нагруженными неоэпитопом, слитым с MPRSS2::ERG, (ALNSEALSV; HLA-A02:01) в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопу, слитому с TMPRSS2::ERG с использованием мультимеров (исходное: BV421 и PE).

[89] На фигуре 3B представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопом, слитым с TMPRSS2::ERG, (ALNSEALSV; HLA-A02:01) в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопу, слитому с TMPRSS2::ERG, с использованием мультимеров (подтверждение: APC и BUV396).

[90] На фигуре 4A представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопом со сдвигом рамки считывания GATA3 (SMLTGPPARV; HLA-A02:01), в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопу со сдвигом рамки считывания GATA3 с использованием мультимеров (исходное: APC и BUV396).

[91] На фигуре 4B представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопом со сдвигом рамки считывания GATA3 (SMLTGPPARV; HLA-A02:01), в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопу со сдвигом рамки считывания GATA3 с использованием мультимеров (подтверждение: PE и BV421).

[92] На фигуре 5A представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопом со сдвигом рамки считывания β2M (LLCVWVSSI; HLA-A02:01), в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопу со сдвигом рамки считывания β2M с использованием мультимеров (исходное: PE и APC).

[93] На фигуре 5B представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопом со сдвигом рамки считывания β2M (LLCVWVSSI; HLA-A02:01) в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопу со сдвигом рамки считывания β2M с использованием мультимеров (подтверждение: PE и BV421).

[94] На фигуре 6A представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопом KRAS G12C (KLVVVGACGV; HLA-A02:01), в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопом со сдвигом рамки считывания KRAS G12C с использованием мультимеров (исходное: BUV396 и BV421).

[95] На фигуре 6B представлен иллюстративный график HLA-A02:01+ T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопом KRAS G12C (KLVVVGACGV; HLA-A02:01), в течение 10 суток. CD8+ T-клетки анализировали на антигенную специфичность к неоэпитопу со сдвигом рамки считывания KRAS G12C с использованием мультимеров (подтверждение: APC и BUV396).

[96] На фигуре 7 представлен иллюстративный график T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неоэпитопами со сдвигом рамки считывания β2M в течение 20 суток (повторная стимуляция свежими моноцитарными дендритными клетками на сутки 20). CD4+ T-клетки анализировали на антигенную специфичность путем внутриклеточного окрашивания на цитокины после повторной стимуляции моноцитарными дендритными клетками, нагруженными пептидом со сдвигом рамки считывания β2M в течение 24 часов (справа), по сравнению с контрольными без пептида (слева).

[97] На фигуре 8 представлен иллюстративный график T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неопептидом BTK C481S в течение 20 суток (повторная стимуляция свежими моноцитарными дендритными клетками на сутки 20). CD4+ T-клетки анализировали на антигенную специфичность путем внутриклеточного окрашивания на цитокины после повторной стимуляции моноцитарными дендритными клетками, нагруженными неопептидом BTK C481S в течение 24 часов (справа), по сравнению с контрольными пептид BTK дикого типа (слева).

[98] На фигуре 9 представлен иллюстративный график T-клеток, культивированных совместно с моноцитарными дендритными клетками, нагруженными неопептидами со сдвигом рамки считывания GATA3 в течение 20 суток (повторная стимуляция свежими моноцитарными дендритными клетками на сутки 20). CD4+ T-клетки анализировали на антигенную специфичность путем внутриклеточного окрашивания на цитокины после повторной стимуляции моноцитарными дендритными клетками, нагруженными пептидом со сдвигом рамки считывания GATA3 в течение 24 часов (справа), по сравнению с контрольными без пептида (слева).

ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ

[99] В настоящем описании описаны новые иммунотерапевтические средства и их использование на основе открытия неоантигенов, возникающих в результате мутационных событий, уникальных для опухоли индивидуума. Таким образом, изобретение, описываемое в настоящем описании, относится к пептидам, полинуклеотидам, кодирующим пептиды, и связывающим пептиды средствам, которые можно использовать, например, для стимуляции иммунного ответа к опухолеассоциированному антигену, для создания иммуногенной композиции или вакцины против злокачественной опухоли для применения в лечении заболевания.

I. Определения

[100] Терминология, используемая в настоящем описании, предназначена только для целей описания конкретных случаев и не предназначена быть ограничивающей. Как используют в настоящем описании, формы единственного числа предназначены также включать формы множественного числа, если из контекста явно не следует иное. Кроме того, в той степени, в которой используют термины "включающий", "включает", "имеющий", "имеет", "с" или их варианты в любом подробном описании и/или формуле изобретения, такие термины предназначены являться включающими аналогично термину "содержащий".

[101] Термин "приблизительно" может означать в пределах допустимого диапазона ошибок для конкретного значения, как определяет специалист в данной области, который частично зависит от того, как значение измеряют или определяют, т.е. ограничений системы измерения. Например, "приблизительно" может означать в пределах 1 или более 1 стандартного отклонения, согласно практике в данной области. Альтернативно, "приблизительно" может означать диапазон до 20%, до 10%, до 5% или до 1% от данного значения. Альтернативно, в частности в отношении биологических систем или процессов термин может означать в порядке величины, изменение в 5 раз и более предпочтительно в 2 раза от значения. В случае, когда описаны конкретные значения в заявке и формуле изобретения, если не указано иное, следует предполагать, что термин "приблизительно" означает в пределах допустимого диапазона ошибок для конкретного значения.

[102] Для облегчения понимания настоящего изобретения ниже приведено определение ряда терминов и фраз.

[103] "Неоантиген" означает класс опухолевых антигенов, которые возникают в результате опухолеспецифических изменений в белках. Неоантигены включают, но не ограничиваются ими, опухолевые антигены, которые возникают в результате, например, замены в белковой последовательности, мутации сдвига рамки считывания, слитого полипептида, делеции, вставки в рамке считывания, экспрессии эндогенных ретровирусных полипептидов и опухолеспецифической сверхэкспрессии полипептидов.

[104] "Опухолеспецифический неоэпитоп" относится к эпитопу, который не присутствует в эталонной, такой как нормальная незлокачественная клетка или клетка зародышевой линии, но встречается в злокачественных клетках. Это включает в частности ситуации, где в нормальной незлокачественной клетке или клетке зародышевой линии встречается соответствующий эпитоп, однако в результате одной или более мутаций в злокачественной клетке последовательность эпитопа изменяется, что, таким образом, приводит к неоэпитопу.

[105] "Эталон" можно использовать для корреляции и сравнения результатов, получаемых в способах по изобретению, из образца опухоли. Как правило, "эталон" можно получать на основании одного или более нормальных образцов, в частности образцов, которые на поражены злокачественным заболеванием, или которые получают от пациента или один или более разных индивидуумов, например, здоровых индивидуумов, в частности от индивидуумов того же вида. "Эталон" можно определять эмпирически путем тестирования достаточно большого количества нормальных образцов.

[106] Термин "мутация" относится к изменению или отличию последовательности нуклеиновой кислоты (замене, добавлению или делеции нуклеотида) по сравнению с эталоном. "Соматическая мутация" может возникать в любой из клеток организма за исключением половых клеток (сперма и яйцеклетка) и, таким образом, не передается детям. Эти изменения могут (но не всегда) вызывать злокачественную опухоль или другие заболевания. В определенных вариантах осуществления мутация представляет собой несинонимическую мутацию. Термин "несинонимическая мутация" относится к мутации, например, замене нуклеотида, которая приводит к замене аминокислоты, такой как замена аминокислоты в продукте трансляции. "Сдвиг рамки считывания" возникает, когда мутация нарушает нормальную фазу периодичности кодона гена (также известную как "рамка считывания"), что приводит к трансляции ненативной белковой последовательности. Возможно, что различные мутации в гене приводят к одной и той же измененной рамке считывания.

[107] Как используют в настоящем описании, термин "аффинность" относится к мере силы связывания между двумя представителями пары связывания, например, связывающего HLA пептида и HLA I или II класса. KD представляет собой константу диссоциации и имеет единицы измерения молярность. Константа аффинности является противоположным константы диссоциации. Константа аффинности в некоторых случаях используют в качестве общего термина для описания этого химического соединения. Она является прямой мерой энергии связывания. Аффинность можно определять экспериментально, например, посредством поверхностного плазмонного резонанса (SPR) с использованием коммерчески доступных устройств Biacore SPR. Аффинность также можно выражать в виде ингибирующей концентрации 50 (IC50), такая концентрация, при которой 50% пептида замещается. Подобным образом, ln(IC50) относится к натуральному log IC50. Koff относится к константе скорости обратной реакции, например, для диссоциации связывающего HLA пептида и HLA I или II класса.

[108] На всем протяжении этого описания результаты "данных связывания" можно выражать в отношении "IC50". IC50 является концентрацией тестируемого пептида в анализе связывания, при которой наблюдают 50% ингибирования связывания меченого эталонного пептида. Принимая во внимание условия, в которых проводят анализы (т.е. ограничивающие концентрации белка HLA и меченого эталонного пептида), эти значения приближаются к значениям KD. Анализы по определению связывания хорошо известны в данной области и подробно описаны, например, в публикациях PCT WO 94/20127 и WO 94/03205, и других публикациях, таких как Sidney et al., Current Protocols in Immunology 18.3.1 (1998); Sidney et al., J. Immunol. 154:247 (1995); и Sette et al., Mol. Immunol. 31:813 (1994). Альтернативно, связывание можно выражать относительно связывания эталонным стандартным пептидом. Например, может быть основано на IC50 относительно IC50 эталонного стандартного пептида.

[109] Связывание также можно определять с использованием других систем анализа, включая системы анализа с использованием: живых клеток (например, Ceppellini et al., Nature 339:392 (1989); Christnick et al., Nature 352:67 (1991); Busch et al., Int. Immunol. 2:443 (1990); Hill et al., J. Immunol. 147:189 (1991); del Guercio et al., J. Immunol. 154:685 (1995)), бесклеточных систем с использованием лизатов после обработки детергентом (например, Cerundolo et al., J. Immunol. 21:2069 (1991)), иммобилизованного очищенного MHC (например, Hill et al., J. Immunol. 152, 2890 (1994); Marshall et al., J. Immunol. 152:4946 (1994)), систем ELISA (например, Reay et al., EMBO J. 11:2829 (1992)), поверхностного плазмонного резонанса (например, Khilko et al., J. Biol. Chem. 268:15425 (1993)); анализов с высокой плотностью растворимой фазы (Hammer et al., J. Exp. Med. 180:2353 (1994)) и измерения стабилизации или сборки MHC I класса (например, Ljunggren et al., Nature 346:476 (1990); Schumacher et al., Cell 62:563 (1990); Townsend et al., Cell 62:285 (1990); Parker et al., J. Immunol. 149:1896 (1992)).

[110] "Перекрестное связывание" указывает на то, что пептид связывают больше чем одна молекула HLA; синонимиям является вырожденное связывание.

[111] Термин "получаемый" при использовании для описания эпитопа является синонимом "подготовленный". Получаемый эпитоп можно выделять из природного источника, или его можно синтезировать в соответствии со стандартными протоколами в данной области. Синтетические эпитопы могут содержать искусственные аминокислотные остатки "миметики аминокислот", такие как D-изомеры природных L-аминокислотных остатков, или неприродные аминокислотные остатки, такие как циклогексилаланин. Получаемый или подготавливаемый эпитоп может являться аналогом нативного эпитопа.

[112] "Разбавитель" включает стерильные жидкости, такие как вода и масла, включая такие как нефть, животное, растительные или синтетические масла, такие как арахисов масло, соевое масло, минеральное масло, кунжутное масло и т.п. Вода также является разбавителем для фармацевтических композиций. Солевые растворы и водные растворы декстрозы и глицерина также можно применять в качестве разбавителей, например, в инъецируемых растворах.

[113] "Эпитоп" является общей характеристикой молекулы, такой как первичная, вторичная и третичная структура пептида и заряд, которые совместно образуют участок, распознаваемый, например, иммуноглобулином, T-клеточным рецептором, молекулой HLA или химерным антигенным рецептором. Альтернативно, эпитоп можно определять как набор аминокислотных остатков, который участвует в распознавании конкретным иммуноглобулином, или в отношении T-клеток, тех остатков, которые необходимы для распознавания T-клеточным рецептором белков, химерными антигенными рецепторами и/или рецепторами главного комплекса гистосовместимости (MHC). Эпитопы можно получать выделением из природного источника или их можно синтезировать в соответствии со стандартными протоколами в данной области. Синтетические эпитопы могут содержать искусственные аминокислотные остатки, "миметики аминокислот", такие как D-изомеры природных L-аминокислотных остатков или неприродные аминокислотные остатки, такие как циклогексилаланин. На всем протяжении этого описания эпитопы могут быть обозначены в некоторых случаях как пептиды или пептидные эпитопы.

[114] Следует понимать, что белки или пептиды, которые содержат эпитоп или аналог, описываемый в настоящем описании, а также дополнительную аминокислоту(ы) еще не выходят за горницы изобретения. В определенных вариантах осуществления пептид содержит фрагмент антигена.

[115] В определенных вариантах осуществления существует ограничение длины пептида по изобретению. Вариант осуществления, которые ограничен по длине, возникает тогда, когда белок или пептид, содержащий эпитоп, описываемый в настоящем описании, содержит область (т.е. смежные серии аминокислотных остатков) с 100% идентичностью нативной последовательности. Во избежание зачитывания определения эпитопа, например, целых природных молекул, существует ограничение по длине любой области, которая является на 100% идентичной нативной пептидной последовательности. Таким образом, для пептида, содержащего эпитоп, описываемый в настоящем описании, и область со 100% идентичностью нативной пептидной последовательности, длина области со 100% идентичностью нативной последовательности, как правило, составляет: менее чем или равную 600 аминокислотным остаткам, менее чем или равную 500 аминокислотным остаткам, менее чем или равную 400 аминокислотным остаткам, менее чем или равную 250 аминокислотным остаткам, менее чем или равную 100 аминокислотным остаткам, менее чем или равную 85 аминокислотным остаткам, менее чем или равную 75 аминокислотным остаткам, менее чем или равную 65 аминокислотным остаткам, и менее чем или равную 50 аминокислотным остаткам. В определенных вариантах осуществления "эпитоп", описываемый в настоящем описании, состоит из пептида, содержащего область менее чем с 51 аминокислотным остатком, которая является на 100% идентичной нативной пептидной последовательности, при любом приращении менее 5 аминокислотных остатков; например, 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 или 1 аминокислотный остаток.

[116] "Лейкоцитарный антиген человека" или "HLA" является белком главного комплекса гистосовместимости (MHC) I класса или II класса человека (см., например, Stites, et al., IMMUNOLOGY, 8TH ED., Lange Publishing, Los Altos, Calif. (1994).

[117] "Супертип HLA или семейство HLA", как используют в настоящем описании, описывает группы молекул HLA, сгруппированные на основании общей специфичности связывания пептида. Молекулы HLA I класса, которые имеют что-то, сходное с аффинностью связывания для пептидов, несущих определенные мотивы аминокислот группируют по таким супертипам HLA. Термины суперсемейство HLA, семейство супертипа HLA, семейство HLA и HLA xx-подобные молекулы (где "xx" означает конкретный тип HLA) являются синонимами.

[118] Термины "идентичный" или процент "идентичности" в отношении двух или более пептидных последовательностей или фрагментов антигена означают две или более последовательностей или подпоследовательностей, которые являются одинаковыми или имеют указанное процентное содержание аминокислотных остатков, которые являются одинаковыми при сравнении и выравнивании для максимального соответствия на всем протяжении окно сравнения, как измеряют с использованием алгоритма сравнения последовательностей или посредством выравнивания вручную и визуального наблюдения.

[119] "Иммуногенный" пептид или "иммуногенный" эпитоп, или "пептидный эпитоп" представляет собой пептид, который содержит аллель-специфический мотив, таким образом, что пептид связывается с молекулой HLA и индуцирует клеточно-опосредованный или гуморальный ответ, например, цитотоксический T-лимфоцитарный (CTL), T-лимфоцитарный хелперов (HTL) и/или B-лимфоцитарный ответ. Таким образом, иммуногенные пептиды, описываемые в настоящем описании, способны связываться с подходящей молекулой HLA и таким образом индуцировать CTL (цитотоксический) ответ, или HTL (и гуморальный) ответ на пептид.

[120] Как используют в настоящем описании, "химерный антигенный рецептор" или "CAR" относится к антигенсвязывающему белку, который содержит антигенсвязывающий домен иммуноглобулина (например, вариабельный домен иммуноглобулина) и константный домен T-клеточного рецептора (TCR). Как используют в настоящем описании, "константный домен" полипептида TCR содержит проксимальный к мембране константный домен TCR, а также может содержать трансмембранный домен TCR и/или цитоплазматический хвост TCR. Например, в определенных вариантах осуществления CAR представляет собой димер, который содержит первый полипептид, содержащий вариабельный домен тяжелой цепи иммуноглобулина связанный с константным доменом TCR.бета, и второй полипептид, содержащий вариабельный домен легкой цепи иммуноглобулина (например, вариабельный домен κ- или λ-цепи), связанный с константным доменом TCRα. В определенных вариантах осуществления CAR является димером, который содержит первый полипептид, содержащий вариабельный домен тяжелой цепи иммуноглобулина, связанный с константным доменом TCRα, и втор полипептид, содержащий вариабельный домен легкой цепи иммуноглобулина (например, вариабельный домен κ- или λ-цепи), связанный с константным доменом TCRβ.

[121] Фразы "выделенный" или "биологически чистый" относятся к веществу, которое в значительной степени или по существу не содержит компоненты, которые обычно присутствуют в веществе, в том виде, в котором оно встречается в своем нативном состоянии. Таким образом, выделенные пептиды, описываемые в настоящем описании, не содержат определенные или все вещества, обычно связанные с пептидами в их окружении in situ. "Выделенный" эпитоп относится к эпитопу, который не содержит полную последовательность антигена, из которой получали эпитоп. Как правило, к "выделенному" эпитопу не присоединяют дополнительные аминокислотные остатки, которые приводят к последовательности, которая обладает 100% идентичностью по всей длине нативной последовательности. Нативная последовательность может представлять собой последовательность, такую как опухолеассоциированный антиген, из которой получают эпитоп. Таким образом, термин "выделенный" означает, что вещество удаляют из своего первичного окружения (например, природной среды, если он является природным). Например, природный полинуклеотид или пептид, присутствующий у живого животного, не является выделенным, но тот же полинуклеотид или пептид, отделенный от определенных или всех сопутствующих веществ в природной системе, является выделенным. Такой полинуклеотид может являться частью вектора, и/или такой полинуклеотид или пептид может быть частью композиции, и все еще являться "выделенным", поскольку такой вектор или композиция не является частью его природного окружения. Выделенные молекулы РНК включают транскрипты РНК in vivo или in vitro молекул ДНК, описываемых в настоящем описании, и дополнительно включают такие молекулы, получаемые синтетически.

[122] "Главный комплекс гистосовместимости" или "MHC" представляет собой кластер генов, которые играют роль в регуляции клеточных взаимодействий, участвующих в физиологических иммунных ответах. У людей комплекс MHC также известен как комплекс лейкоцитарного антигена человека (HLA). Для подробного описания комплексов MHC и HLA см., Paul, FUNDAMENTAL IMMUNOLOGY, 3.sup.RD ED., Raven Press, New York (1993).

[123] "Нативная" последовательность или последовательность "дикого типа" относится к последовательности, встречающейся в природе. Такая последовательность может содержать более длинную последовательность в природе.

[124] Следует понимать, что "T-клеточный эпитоп" означает пептидную последовательность, которая может быть связана молекулами MHC I или II класса в форме презентирующей пептид молекулы MHC или комплекса MHC, а затем может в этой форме распознаваться и связываться цитотоксическими T-лимфоцитами или T-хелперными клетками, соответственно.

[125] Следует понимать, что "рецептор" означает биологическую молекулу или группу молекул, способных связывать лиганд. Рецептор может служить для передачи информации в клетке, образовании клетки или организма. Рецептор содержит по меньшей мере одну рецепторную единицу, например, где каждая рецепторная единица может состоять из белковой молекулы. Рецептор обладает структурой, которая является комплементарной структуре лиганда, и может образовывать комплекс с лигандом как с партнером по связыванию. Информация передается в частности в результате конформационных изменений рецептора после образования комплекса с лигандом на поверхности клетки. В определенных вариантах осуществления следует понимать, что рецептор означает конкретно белки MHC I и II классов, способные образовывать комплекс рецептор/лиганд с лигандом, в частности пептидом или фрагментом пептида подходящей длины.

[126] Следует понимать, что "лиганд" означает молекулу, которая обладает структурой, комплементарной структуре рецептора, и способна образовывать комплекс с таким рецептором. В определенных вариантах осуществления следует понимать, что лиганд означает пептид или фрагмент пептида, который обладает подходящей длиной и содержит подходящие связывающие мотивы в своей аминокислотной последовательности, таким образом, что пептид или фрагмент пептида способен образовывать комплекс с белками MHC I класса или MHC II класса.

[127] В определенных вариантах осуществления следуют также понимать, что "комплекс рецептор/лиганд" означает "комплекс рецептор/пептид" или "комплекс рецептор/фрагмент пептида", содержащий презентирующую пептид или фрагмент пептида молекулу MHC I класса или II класса.

[128] Следует понимать, что "белки или молекулы главного комплекса гистосовместимости (MHC)", "молекулы MHC", "белки MHC" или "белки HLA" означают белки, способные связывать пептиды, появляющиеся в результате протеолитического расщепления белковых антигенов и репрезентирующих возможные лимфоцитарные эпитопы, (например, T-клеточный эпитоп и B-клеточный эпитоп), транспортирующие их к клеточной поверхности и презентирующие их там специфическим клеткам, в частности цитотоксическим T-лимфоцитам, T-хелперным клеткам или B-клеткам. Главный комплекс гистосовместимости в геноме включает генетическую область, продукты генов, которой экспрессируемые на клеточной поверхности, являются важными для связывания и презентации эндогенных и/или чужеродных антигенов и, таким образом, для регуляции иммунологических процессов. Главный комплекс гистосовместимости классифицируют на две группы генов, кодирующих различные белки, а именно молекулы MHC I класса и молекулы MHC II класса. Клеточная биология и профили экспрессии двух классов MHC являются адаптированными для этих различных ролей.

[129] Термины "пептид" и "пептидный эпитоп" используют взаимозаменяемо с "олигопептидом" в настоящем описании для описания серии остатков, соединенных друг с другом, как правило, пептидными связями между аминогруппами вариабельного домена и карбоксильными группами смежных аминокислотных остатков.

[130] "Синтетический пептид" относится к пептиду, который получают из неприродного источника, например, получают искусственно. Такие пептиды можно получать с использованием таких способов, как химический синтез или технология рекомбинантных ДНК. "Синтетические пептиды" включают "слитые белки".

[131] "Связывающий PanDR" пептид, "связывающий PanDR эпитоп" является представителем семейства молекул, которые связывают более одной молекулы DR HLA II класса.

[132] "Фармацевтически приемлемый" относится в основном к нетоксическим, инертным и/или физиологически совместимой композиции или компоненту композиции.

[133] "Фармацевтический эксципиент" или "эксципиент" содержит вещество, такое как адъювант, носитель, модифицирующие pH и буферные средства, регулирующие тоничность средства, средства для смачивания, консерванты и т.п. "Фармацевтический эксципиент" представляет собой эксципиент, который является фармацевтически приемлемым.

[134] Термин "мотив" относится к паттерну остатков в аминокислотной последовательности определенной длины, например, пептиду длиной менее приблизительно 15 аминокислотных остатков или длиной менее приблизительно 13 аминокислотных остатков, например, приблизительно от 8 приблизительно до 13 аминокислотных остатков (например, 8, 9, 10, 11, 12 или 13) для мотива HLA I класса и приблизительно от 6 приблизительно до 25 аминокислотных остатков (например, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 или 25) для мотива HLA II класса, который распознается конкретной молекулой HLA. Мотивы, как правило, отличаются для каждого белка HLA, кодируемого данным аллелем HLA человека. Патерн этих мотивов отличается первичными и вторичными якорными остатками. В определенных вариантах осуществления мотив MHC I класса идентифицирует пептид длиной 9, 10 или 11 аминокислотных остатков.

[135] "Супермотив" определяет специфичность связывания пептида, разделяемую молекулами HLA, кодируемыми двумя или более аллелями HLA. В определенных вариантах осуществления несущий супермотив пептид, описываемый в настоящем описании, распознается с высокой или средней аффинностью (как определено в настоящем описании) двумя или более антигенами HLA.

[136] Термин "природный", как используют в настоящем описании, относится к тому факту, что объект можно найти в природе. Например, пептид или нуклеиновая кислота, который присутствует в организме (включая вирусы), и который можно выделять из источника в природе, и который не изменяли целенаправленно в лаборатории, является природным.

[137] По изобретению термин "вакцина" относится к фармацевтическому препарату (фармацевтической композиции) или продукту, который при введении индуцирует иммунный ответ, например, клеточный или гуморальный иммунный ответ, который распознает и атакует патогенную или пораженную клетку, таким как злокачественная клетка. Вакцину можно использовать для профилактики или лечения заболевания. Термин "персонализированная вакцина против злокачественной опухоли" или "персонализированная вакцина против злокачественной опухоли" относится к конкретному пациенту со злокачественной опухолью и означает, что вакцину против злокачественной опухоли адаптируют для потребностей или особых обстоятельств отдельного пациента со злокачественной опухолью.

[138] "Защитный иммунный ответ" или "терапевтический иммунный ответ" относится к ответу CTL и/или HTL на антиген, получаемый от патогенного антигена (например, опухолевого антигена), который в некоторых случаях предотвращает или по меньшей мере частично устраняет симптомы заболевания, побочные эффекты или прогрессирование. Иммунный ответ также может включать ответ антител, которому способствовала стимуляция хелперными T-клетками.

[139] "Процессирование антигена" или "процессирование" относится к разрушению полипептида или антигена до продуктов процессирования, которые являются фрагментами указанного полипептида или антигена (например, разрушение полипептида до пептидов), и образование ассоциации одного или более таких фрагментов (например, через связывание) с молекулами MHC для презентации клетками, например, антигенпрезентирующими клетками, специфическим T-клеткам.

[140] "Антигенпрезентирующие клетки" (APC) представляют собой клетки, которые презентируют фрагменты пептида белковых антигенов в ассоциации с молекулами MHC на своей клеточной поверхности. Определенные APC могут активировать антигенспецифические T-клетки. Профессиональные антигенпрезентирующие клетки являются очень эффективно интернализируют антиген, посредством фагоцитоза или рецепторно-посредованного эндоцитоза, а затем предоставляют фрагмент антигена, связанный с молекулой MHC II класса на своей мембране. T-клетка распознает и взаимодействует с комплексом антиген-молекула MHC II класса на мембране антигенапрезентирующей клетки. Затем антигенпрезентирующая клетка продуцирует дополнительный костимулирующий сигнал, ведущий к активации T-клетки. Экспрессия костимулирующих молекул является определяющим признаком профессиональных антигенпрезентирующих клеток.

[141] Основными типами профессиональных антигенпрезентирующих клеток являются дендритные клетки, которые имеют самый широкий диапазон презентации антигена и, вероятно, являются самыми важными антигенпрезентирующими клетками, макрофагами, B-клетками и определенными активированными эпителиальными клетками.

[142] Дендритные клетки (DC) являются популяциями лейкоцитов, которые презентируют антигены, захватываемые в периферических тканях T-клеткам обоими путями презентации антигена MHC II и I класса. Хорошо известно, что дендритные клетки являются сильнодействующими стимуляторами иммунных ответов, и активация этих клеток является критическим этапом индукции противоопухолевого иммунитета.

[143] Дендритные клетки в целях удобства разделяют на "незрелые" и "зрелые" клетки, которые можно использовать в качестве простого способа различать два хорошо охарактеризованных фенотипа. Однако эту номенклатуру не следует рассматривать как исключающую все возможные промежуточные стадии дифференцировки.

[144] Незрелые дендритные клетки характеризуют как антигенпрезентирующие клетки с высокой способностью захватывать и процессировать антиген, которая коррелирует с высокой экспрессией рецептора Fey и рецептора маннозы. Зрелый фенотип, как правило, характеризуется более низкой экспрессией этих маркеров, но высокой экспрессией молекул клеточной поверхности, ответственных за активацию T-клеток, таких как MHC I класса и II класса, молекул адгезии (например, CD54 и CD1 1) и костимулирующих молекул (например, CD40, CD80, CD86 и 4-1 BB).

[145] Термин "остаток" относится к аминокислотному остатку или остатку миметика аминокислоты, включенному в пептид или белок посредством амидной связи или миметика амидной связи, или нуклеиновой кислоты (ДНК или РНК), кодирующей аминокислоту или миметик аминокислоты.

[146] Номенклатура, используемая для описания пептидов или белков соответствует общепринятой практике, где аминогруппа представлена слева (амино- или N-конец) и карбоксильная группа справа (карбокси- или C-конец) каждого аминокислотного остатка. Когда положения аминокислотных остатков обозначают как в пептидном эпитопе, их нумеруют в направлении от амино- к карбокси-концу, где положение 1 занимает остаток, располагаемый на N-конце эпитопа или пептида или белка, частью которого он может являться.

[147] В формулах, представляющих выбранные конкретные варианты осуществления настоящего изобретения, амино- и карбоксилконцевые группы, хотя и не показаны конкретно, находятся в том виде, который они будут принимать при физиологических значениях рН, если не указано иное. В формулах структуры аминокислоты каждый остаток, как правило, представляют стандартными трехбуквенными или однобуквенными обозначениями. L-форма аминокислотного остатка предоставлена одной заглавной буквой или первой заглавной буквой трехбуквенного символа, а D-форма для таких аминокислотных остатков, имеющих D-формы, предоставлена одной строчной буквой или строчным трехбуквенным символом. Однако когда трехбуквенные символы или полные названия используют без заглавных букв, они могут относиться к L-аминокислотным остаткам. Глицин не содержит ассиметричный атом углерода, и его просто обозначают как "Gly" или "G". Аминокислотные последовательности пептидов, указанные в настоящем описании, как правило, обозначают с использованием стандартного однобуквенного символа. (A, Аланин; C, Цистеин; D, Аспарагинов кислота; E, Глутаминов кислота; F, Фенилаланин; G, Глицин; H, Гистидин; I, изолейцин; K, Лизин; L, Лейцин; M, Метионин; N, Аспарагин; P, Пролин; Q, Глутамин; R, Аргинин; S, Серин; T, Треонин; V, Валин; W, Триптофан и Y, Тирозин.)

[148] Термины "полинуклеотид" и "нуклеиновая кислота" используются взаимозаменяемо в настоящем описании и обозначают полимеры нуклеотидов любой длины, и включают ДНК и РНК, например, иРНК. Нуклеотиды могут являться дезоксирибонуклеотидами, рибонуклеотидами, модифицированными нуклеотидами или основаниями и/или их аналогами, или любым субстратом, который можно вводить в полимер ДНК- или РНК-полимеразой. В определенных вариантах осуществления полинуклеотид и нуклеиновая кислота могут являться транскрибируемой in vitro иРНК. В определенных вариантах осуществления полинуклеотид, который вводят с применением способов по изобретению представляет собой иРНК.

[149] Термины "идентичный" или процент "идентичности" в отношении двух или более нуклеиновых кислот или полипептидов относится к двум или более последовательностям или подпоследовательностям, которые являются одинаковыми или содержат определенный процент нуклеотидов или аминокислотных остатков, которые являются одинаковыми, при сравнении и выравнивании (с введением пропусков, при необходимости) для максимального соответствия, без учета каких-либо консервативных замен аминокислот в качестве части идентичности последовательностей. Процент идентичности можно измерять с использованием с программного обеспечения или алгоритмов равнения последовательностей или путем визуального анализа. В данной области хорошо известны различные алгоритмы и программное обеспечение, которые можно использовать для получения выравнивания аминокислотных или нуклеотидных последовательностей. Они включают, но не ограничиваются ими, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package и их варианты. В определенных вариантах осуществления две нуклеиновые кислоты или полипептида, описываемые в настоящем описании, являются по существу идентичными, что означает, что они обладают по меньшей мере 70%, по меньшей мере 75%, по меньшей мере 80%, по меньшей мере 85%, по меньшей мере 90% и в определенных вариантах осуществления по меньшей мере 95%, 96%, 97%, 98%, 99% идентичностью нуклеотидов или аминокислотных остатков при сравнении и выравнивании для максимального соответствия, как измеряют с использованием алгоритма сравнения последовательностей или путем визуального анализа. В определенных вариантах осуществления идентичность существует по всей длине области последовательностей, которая составляет по меньшей мере приблизительно 10, по меньшей мере приблизительно 20, по меньшей мере приблизительно 40-60 остатки, по меньшей мере приблизительно 60-80 остатков в длину или любое целочисленное значение между ними. В определенных вариантах осуществления идентичность существует в более длинной области чем 60-80 остатков, такой как по меньшей мере приблизительно 80-100 остатков, и в определенных вариантах осуществления последовательности являются по существу идентичными по всей длине последовательностей, которые сравнивают, таких как кодирующая область нуклеотидных последовательностей.

[150] "Консервативная замена аминокислот" представляет собой замену, при которой один аминокислотный остаток заменяют другим аминокислотным остатком, содержащим аналогичную боковую цепь. Семейства аминокислотных остатков, содержащих аналогичные боковые цепи, идентифицированы в данной области, включая основные боковые цепи (например, лизин, аргинин, гистидин), кислые боковые цепи (например, аспарагиновая кислота, глутаминовая кислота), незаряженные полярные боковые цепи (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин), неполярные боковые цепи (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан), бета-разветвленные боковые цепи (например, треонин, валин, изолейцин) и ароматические боковые цепи (например, тирозин, фенилаланин, триптофан, гистидин). Например, замена фенилаланина тирозином является консервативной заменой. Способы идентификации консервативных замен нуклеотидов и аминокислот, которые не нарушают функции пептида хорошо известны в данной области.

[151] Термин "вектор", как используют в настоящем описании, означает конструкцию, которая способна доставлять и, как правило, экспрессировать один или более представляющих интерес генов или последовательностей в клетке-хозяине. Примеры векторов включают, но не ограничиваются ими, вирусные векторы, экспрессирующие голую ДНК или РНК векторы, плазмиду, космиду или фаговые векторы, экспрессирующих ДНК или РНК векторы, связанные с катионными конденсирующими средствами, и экспрессирующие ДНК или РНК векторы, инкапсулированные в липосомы.

[152] Полипептид, антитело, полинуклеотид, вектор, клетка или композиция, которая является "выделенной", представляет собой полипептид, антитело, полинуклеотид, вектор, клетку или композицию, которая находится в форме, не встречающейся в природе. Выделенные полипептиды, антитела, полинуклеотиды, векторы, клетки или композиции включают такие, которые очищали до степени, таким образом, что они уже не находятся в той форме, в которой они встречаются в природе. В определенных вариантах осуществления полипептид, антитело, полинуклеотид, вектор, клетка или композиция, которая является выделенной, является по существу чистой. В определенных вариантах осуществления "выделенный полинуклеотид" включает ПЦР или количественную ПЦР реакцию, содержащую полинуклеотид, амплифицированный в ПЦР или количественной ПЦР реакции.

[153] Термин "по существу чистый", как используют в настоящем описании, относится к веществу, которое является по меньшей мере на 50% чистым (т.е. не содержит загрязнителей), по меньшей мере на 90% чистым, по меньшей мере на 95% чистым, по меньшей мере на 98% чистым или по меньшей мере на 99% чистым.

[154] Термин "индивидуум" относится к любому животному (например, млекопитающему), включая, но, не ограничиваясь ими, людей, не являющихся человеком приматов, собак, кошек, грызунов и т.п., которое будут получать конкретное лечение. Как правило, термины "индивидуум" и "пациент" используют взаимозаменяемо в настоящем описании по отношению к являющемуся человек индивидууму.

[155] Термины "эффективное количество" или "терапевтически эффективное количество", или "терапевтический эффект" относится к количеству терапевтического средства, эффективного для "лечения" заболевания или нарушения у индивидуума или млекопитающего. Терапевтически эффективное количество лекарственного средства обладает терапевтическим эффектом и, таким образом, может предотвращать развитие заболевания или нарушения; замедлять развитие заболевания или нарушения; замедлять прогрессирование заболевания или нарушения; ослаблять до некоторой степени один или более симптомов, связанных с заболеванием или нарушением; снижать заболеваемость и смертность; повышать качество жизни или комбинация таких эффектов.

[156] Термины "лечащий" или "лечение", или "лечить" или "ослабление" или "ослаблять" относится к 1) терапевтическим мерам, которыми лечат, замедляют развитие, облегчают симптомы и/или остановку прогрессирования диагностированного патологического состояния или нарушения и 2) профилактическим или превентивным мерам, которыми предупреждают или замедляют развитие представляющего интерес патологического состояния или нарушения. Таким образом, нуждающиеся в лечении включают тех, кто уже страдает нарушением; тех, кто является восприимчивым к нарушению, и тех, у кого необходимо проводить профилактику нарушения.

[157] Как используют в настоящем описании и формуле изобретения формы единственного числа включают формы множественного числа, если из контекста явно не следует иное.

[158] Следует понимать, что термины, такие как "содержит", "содержал", "содержащий" и т.п. могут иметь значение, приписываемое им в патентном законе США; например, они могут означать "включает", "включал", "включающий" и т.п.; и такие термины, так как "состоящий по существу" и "состоит по существу" имеют значение, приписанное им патентном законе США, например, они допускают явно не указанные элементы, но исключают элементы, которые встречаются в предшествующем уровне техники, или которые нарушают основные или новые характеристики изобретения. Ничто в настоящем описании не следует истолковывать как обещание.

[159] Термин "и/или", как используют во фразе, такой как "A и/или B" в настоящем описании, предназначен включать A и B; A или B; A (отдельно) и B (отдельно). Подобным образом, термин "и/или", как используют во фразе, такой как "A, B, и/или C" предназначен включать каждый из следующих вариантов осуществления: A, B и C; A, B, или C; A или C; A или B; B или C; A и C; A и B; B и C; A (отдельно); B (отдельно) и C (отдельно).

II. Неоантигены

[160] Один из критических барьеров в разработке лечебной и опухолеспецифичной иммунотерапии является идентификация и отбор высокоспецифичных и рестрицированных опухолевых антигенов для исключения аутоиммунитета. Опухолевые неоантигены, которые возникают в результате генетического изменения (например, инверсий, транслокаций, делеций, мутаций с изменением смысла, мутаций участка сплайсинга и т.д.) в злокачественных клетках, предоставляющих наиболее опухолеспецифичный класс антигенов. Неоантигены очень редко использовали в вакцинах против злокачественной опухоли или иммуногенных композициях вследствие технических трудностей при их идентификации, селекции оптимизированных антигенов и получения неоантигенов для применения в вакцине или иммуногенной композиции. Эти проблемы можно решить путем: идентификации мутаций в неоплазии/опухолях, которые присутствуют на уровне ДНК в опухоли, но не в сопоставимых образцах зародышевой линии у значительной части индивидуумов, страдающих злокачественной опухолью; анализ идентифицированных мутаций с использованием одного или более алгоритмов прогнозирования связывания пептид-MHC для получения совокупности T-клеточных эпитопов неоантигенов, которые экспрессируются в неоплазии/опухоли, и которые связываются с высокой долей аллелей HLA пациентов, и синтез совокупности неоантигенных пептидов, выбранных из набора всех неоантигенных пептидов и теоретически рассчитанных связывающих пептидов, для применения в вакцине против злокачественной опухоли или иммуногенной композиции, подходящей для лечения значительной части индивидуумов, страдающих злокачественной опухолью.

[161] Например, перевод информации секвенирования пептидов на уровень терапевтической вакцины может включать прогнозирование мутантных пептидов, которые могут связываться с молекулами HLA у значительной части индивидуумов. Для эффективного выбора, какие конкретные мутации использовать в качестве иммуногена, необходимым является способность прогнозировать, какие мутантные пептиды будут эффективно связываться с высокой долей аллелей HLA пациентов. В последнее время подходы, основанные на нейронных сетях, с проверенными связующими и несвязывающими пептидами повысили точность алгоритмов прогнозирования для основных аллелей HLA-A и -B. Однако даже с использованием современных алгоритмов на основе нейрональных сетей для кодирования правил связывания HLA-пептида несколько факторов ограничивают способность прогнозировать пептиды, представленные на аллелях HLA.

[162] Например, перевод информации секвенирования пептидов на уровень терапевтической вакцины может включать формулирование лекарственного средства в виде многоэпитопной вакцины длинных пептидов. Направленность на многие мутантные эпитопы, на сколько это практически возможно, использует преимущество огромных возможностей иммунной системы, предотвращает возможность ускользание от иммунного ответа путем снижения экспрессии продукта гена, на который направлен иммунный ответ, и компенсирует известную погрешность подходов прогнозирования эпитопов. Синтетические пептиды обеспечивают пригодные средства для эффективного получения многих иммуногенов и для быстрого перевода идентификации мутантных эпитопов в эффективную вакцину. Пептиды можно легко синтезировать химически и легко очищать с использованием реагентов, не содержащих загрязняющих бактерий или веществ животного происхождения. Небольшой размер позволяет четко фокусироваться на мутантной области белка, а также снижает конкуренцию нерелевантных антигенов с другими компонентами (немутантным белком или вирусными векторными антигенами).

[163] Например, перевод информации секвенирования пептида на уровень терапевтической вакцины может включать комбинацию с сильным вакцинным адъювантом. Для эффективных вакцин может требоваться сильный адъювант для возбуждения иммунного ответа. Например, поли-ICLC, агонист TLR3 и домены РНК геликазы MDA5 и RIG3 демонстрировали некоторые требуемые свойства для вакцинного адъюванта. Эти свойства включают индукцию местной и системной активации иммунных клеток in vivo, продукцию стимуляторных хемокинов и цитокинов и стимуляцию презентации антигена DC. Кроме того, поли-ICLC могут индуцировать устойчивые ответы CD4+ и CD8+ у людей. Следует отметить, что, выраженные сходства положительной регуляции транскрипционного пути и пути передачи сигнала наблюдали у индивидуумов, вакцинированных поли-ICLC, и у добровольцев, которые получали высокоэффективную вакцину на основе компетентного по репликации вируса желтой лихорадки. Кроме того, у >90% пациентов с карциномой яичника, иммунизированных вакциной с поли-ICLC в комбинации с пептидом NYESO-1 (в дополнение к монтаниду), выявляли индукцию CD4+ и CD8+ T-клеток, а также ответы антитела на пептид в недавнем исследовании 1 фазы. В тоже время поли-ICLC прошел всесторонние испытания более чем в 25 клинических испытаниях на настоящее время и обладает относительно слабым профилем токсичности.

[164] Заявители обнаружили мутационные события в следующих ниже генах:

[165] ABL1, AC011997, ACVR2A, AFP, AKT1, ALK, ALPPL2, ANAPC1, APC, ARID1A, AR, AR-v7, ASCL2, β2M, BRAF, BTK, C15ORF40, CDH1, CLDN6, CNOT1, CT45A5, CTAG1B, DCT, DKK4, EEF1B2, EEF1DP3, EGFR, EIF2B3, env, EPHB2, ERBB3, ESR1, ESRP1, FAM111B, FGFR3, FRG1B, GAGE1, GAGE10, GATA3, GBP3, HER2, IDH1, JAK1, НАБОР, KRAS, LMAN1, MABEB16, MAGEA1, MAGEA10, MAGEA4, MAGEA8, MAGEB17, MAGEB4, MAGEC1, MEK, MLANA, MLL2, MMP13, MSH3, MSH6, MYC, NDUFC2, NRAS, PAGE2, PAGE5, PDGFRa, PIK3CA, PMEL, pol белок, POLE, PTEN, RAC1, RBM27, RNF43, RPL22, RUNX1, SEC31A, SEC63, SF3B1, SLC35F5, SLC45A2, SMAP1, SMAP1, SPOP, TFAM, TGFBR2, THAP5, TP53, TTK, TYR, UBR5, VHL, XPOT слитый полипептид EEF1DP3:FRY, слитый полипептид EGFR:SEPT14, полипептид с делецией EGFRVIII, слитый полипептид EML4:ALK, слитый полипептид NDRG1:ERG, слитый полипептид AC011997.1:LRRC69, слитый полипептид RUNX1(ex5)-RUNX1T1, слитый полипептид TMPRSS2:ERG, слитый полипептид NAB:STAT6, слитый полипептид NDRG1:ERG, слитый полипептид PML:RARA, слитый полипептид PPP1R1B:STARD3, слитый полипептид MAD1L1:MAFK, слитый полипептид FGFR3:TAC, слитый полипептид FGFR3:TACC3, слитый полипептид BCR:ABL, слитый полипептид C11orf95:RELA, слитый полипептид CBFB:MYH11, слитый полипептид CBFB:MYH11, слитый полипептид CD74:ROS1, слитый полипептид CD74:ROS1, ERVE-4: протеаза, ERVE-4: обратная транскриптаза, ERVE-4: обратная транскриптаза, ERVE-4: неизвестный, ERVH-2 матриксный белок, ERVH-2: gag, ERVH-2: ретровиральный матрикс, ERVH48-1: белок оболочки, ERVH48-1: синцитин, ERVI-1 белок оболочки, ERVK-5 gag, ERVK-5 env, ERVK-5 pol, EBV A73, EBV BALF3, EBV BALF4, EBV BALF5, EBV BARF0, EBV LF2, EBV RPMS1, HPV-16, HPV-16 E7 и HPV-16 E6.

[166] В определенных вариантах осуществления неоантиген, описываемый в настоящем описании, является результатом мутационного события в β2M, BTK, EGFR, GATA3, KRAS, MLL2, слитом полипептиде TMPRSS2:ERG или TP53.

Неоантигеные полипептиды

[167] В некоторых аспектах изобретение относится к выделенным пептидам, которые содержат опухолеспецифическую мутацию из таблицы 1 или 2. Эти пептиды и полипептиды обозначают в настоящем описании как "неоантигенные пептиды" или "неоантигенн полипептиды". Термин "пептид" используют в настоящем описании взаимозаменяемо с "мутантный пептид" и "неоантигенным пептидом" для обозначения серии остатков, как правило, L-аминокислот, соединенных друг с другом, как правило, пептидными связями между α-амино- и карбоксильными группами смежных аминокислот. Подобным образом, термин "полипептид" используют в настоящем описании взаимозаменяемо с "мутантным полипептидом" и "неоантигенным полипептидом" для обозначения серии остатков, например, L-аминокислот, соединенных друг с другом, как правило, пептидными связями между α-амино- и карбоксильными группами смежных аминокислот. Полипептиды или пептиды могут являться различной длины, находиться в нейтральных (незаряженных) формах или в формах, которые представляют собой соли, и не содержать модификаций, таких как гликозилирование, окисление боковой цепи или фосфорилирование, или содержать такие модификации, при условии, что модификация не нарушает биологическую активность полипептидов, как описано в настоящем описании.

[168] В определенных вариантах осуществления используют способы секвенирования для идентификации опухолеспецифических мутаций. Любой подходящий способ секвенирования можно использовать по изобретению, например, технологии секвенирования нового поколения (NGS). Способы секвенирования третьего поколения могут быть замещены в будущем технологией NGS, что повысит скорость на этапе секвенирования способа. С целью уточнения: термины "секвенирование нового поколения" или "NGS" в контексте настоящего изобретения все новые технологии высокопроизводительного секвенирования, которые в отличие от "общепринятой" методологии секвенирования, известной как химия Сэнгера, параллельно считывают матрицы нуклеиновых кислот в случайном порядке по всему геному путем разбивания генома на небольшие кусочки. Такие технологии NGS (также известные как технологии массового параллельного секвенирования) способны доставлять информацию последовательности нуклеиновой кислоты полного генома, экзома, транскриптома (всех транскрибируемых последовательностей генома) или метилома (всех метилированных последовательностей генома) в очень короткие периоды времени, например, в течение 1-2 недель, например, в течение 1-7 суток или менее чем за 24 часа и обеспечивают в целом подходы секвенирование одиночной клетки. В рамках изобретения можно использовать многие платформы NGS, которые является коммерчески доступными или которые упомянуты в литературе, например, такие как подробно описанные в WO 2012/159643.

[169] В определенных вариантах осуществления неоантигенного пептида, описываемого в настоящем описании, молекула может содержать, но не ограничивается ими, приблизительно 5, приблизительно 6, приблизительно 7, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11, приблизительно 12, приблизительно 13, приблизительно 14, приблизительно 15, приблизительно 16, приблизительно 17, приблизительно 18, приблизительно 19, приблизительно 20, приблизительно 21, приблизительно 22, приблизительно 23, приблизительно 24, приблизительно 25, приблизительно 26, приблизительно 27, приблизительно 28, приблизительно 29, приблизительно 30, приблизительно 31, приблизительно 32, приблизительно 33, приблизительно 34, приблизительно 35, приблизительно 36, приблизительно 37, приблизительно 38, приблизительно 39, приблизительно 40, приблизительно 41, приблизительно 42, приблизительно 43, приблизительно 44, приблизительно 45, приблизительно 46, приблизительно 47, приблизительно 48, приблизительно 49, приблизительно 50, приблизительно 60, приблизительно 70, приблизительно 80, приблизительно 90, приблизительно 100, приблизительно 110, приблизительно 120 или более аминокислотных остатков, и любой диапазон, который можно вывести из них. В конкретных вариантах осуществления неоантигенного пептида молекула является равной или меньше чем 100 аминокислот.

[170] В определенных вариантах осуществления длина неоантигенных пептидов и полипептидов, описываемых в настоящем описании, для MHC I класса составляет 13 остатков или менее, и, как правило, они состоят из приблизительно от 8 приблизительно до 11 остатков, в частности, 9 или 10 остатков. В определенных вариантах осуществления длина неоантигенных пептидов и полипептидов, описываемых в настоящем описании, для MHC II класса составляет 9-24 остатка.

[171] Более длинный неоантигенный пептид можно конструировать несколькими способами. В определенных вариантах осуществления, когда связывающие HLA пептиды теоретически рассчитаны или известны, более длинный неоантигенный пептид может состоять из (1) отдельных связывающих пептидов с удлинениями из 2-5 аминокислот в направлении к N- и C-концу каждого соответствующего продукта гена; или (2) соединения в виде цепочки некоторых или всех связывающих пептидов с удлиненными последовательностями для каждого. В других вариантах осуществления, когда секвенированием выявляют длинную (>10 остатков) последовательность неоэпитопа, присутствующую в опухоли (например, вследствие сдвига рамки считывания, сквозного прохождения или включения интронов, что приводит к новой пептидной последовательности), более длинный неоантигенный пептид может состоять из целого участка новых опухолеспецифических аминокислот в виде одного более длинного пептида или нескольких перекрывающихся более длинных пептидов. В определенных вариантах осуществления предполагают, что использование более длинного пептида обеспечивает возможность эндогенного процессинга клетками пациента и может приводить к более эффективной презентации антигена и индукции T-клеточных ответов. В определенных вариантах осуществления можно использовать два или более пептида, где пептиды прикрываются и следуют друг за другом по всей длине длинного неоантигенного пептида.

[172] В определенных вариантах осуществления неоантигенные пептиды и полипептиды связываются с белком HLA (например, HLA I класса или HLA II класса). В конкретных вариантах осуществления неоантигенные пептиды и полипептиды связываются с белком HLA с большей аффинностью чем соответствующий пептид дикого типа. В конкретных вариантах осуществления неоантигенный пептид или полипептид имеет IC50 по меньшей мере менее 5000 нМ, по меньшей мере менее500 нМ, по меньшей мере менее 100 нМ, по меньшей мере менее 50 нМ или менее.

[173] В определенных вариантах осуществления длина неоантигенных пептидов может составлять приблизительно от 8 приблизительно до 50 аминокислотных остатков или приблизительно от 8 приблизительно до 30, приблизительно от 8 приблизительно до 20, приблизительно от 8 приблизительно до 18, приблизительно от 8 приблизительно до 15, или приблизительно от 8 приблизительно до 12 аминокислотных остатков. В определенных вариантах осуществления длина неоантигенных пептидов может составлять приблизительно от 8 приблизительно до 500 аминокислотных остатков или приблизительно от 8 приблизительно до 450, приблизительно от 8 приблизительно до 400, приблизительно от 8 приблизительно до 350, приблизительно от 8 приблизительно до 300, приблизительно от 8 приблизительно до 250, приблизительно от 8 приблизительно до 200, приблизительно от 8 приблизительно до 150, приблизительно от 8 приблизительно до 100, приблизительно от 8 приблизительно до 50 или приблизительно от 8 приблизительно до 30 аминокислотных остатков.

[174] В определенных вариантах осуществления длина неоантигенных пептидов может составлять по меньшей мере 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 или более аминокислотных остатков. В определенных вариантах осуществления длина неоантигенных пептидов может составлять по меньшей мере 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500 или более аминокислотных остатков. В определенных вариантах осуществления длина неоантигенных пептидов может составлять не более 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 или менее аминокислотных остатков. В определенных вариантах осуществления длина неоантигенных пептидов может составлять не более 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500 или менее аминокислотных остатков.

[175] В определенных вариантах осуществления общая длина неоантигенных пептидов составляет по меньшей мере 8, по меньшей мере 9, по меньшей мере 10, по меньшей мере 11, по меньшей мере 12, по меньшей мере 13, по меньшей мере 14, по меньшей мере 15, по меньшей мере 16, по меньшей мере 17, по меньшей мере 18, по меньшей мере 19, по меньшей мере 20, по меньшей мере 21, по меньшей мере 22, по меньшей мере 23, по меньшей мере 24, по меньшей мере 25, по меньшей мере 26, по меньшей мере 27, по меньшей мере 28, по меньшей мере 29, по меньшей мере 30, по меньшей мере 40, по меньшей мере 50, по меньшей мере 60, по меньшей мере 70, по меньшей мере 80, по меньшей мере 90, по меньшей мере 100, по меньшей мере 150, по меньшей мере 200, по меньшей мере 250, по меньшей мере 300, по меньшей мере 350, по меньшей мере 400, по меньшей мере 450 или по меньшей мере 500 аминокислот.

[176] В определенных вариантах осуществления общая длина неоантигенных пептидов составляет не более 8, не более 9, не более 10, не более 11, не более 12, не более 13, не более 14, не более 15, не более 16, не более 17, не более 18, не более 19, не более 20, не более 21, не более 22, не более 23, не более 24, не более 25, не более 26, не более 27, не более 28, не более 29, не более 30, не более 40, не более 50, не более 60, не более 70, не более 80, не более 90, не более 100, не более 150, не более 200, не более 250, не более 300, не более 350, не более 400, не более 450 или не более 500 аминокислот.

[177] В определенных вариантах осуществления значение pI неоантигенных пептидов составляет приблизительно 0,5 и приблизительно 12, приблизительно 2 и приблизительно 10, или приблизительно 4 и приблизительно 8. В определенных вариантах осуществления значение pI неоантигенных пептидов составляет по меньшей мере 4,5, 5, 5,5, 6, 6,5, 7, 7,5 или более. В определенных вариантах осуществления значение pI неоантигенных пептидов составляет не более 4,5, 5, 5,5, 6, 6,5, 7, 7,5 или менее.

[178] В определенных вариантах осуществления аффинность связывания с HLA неоантигенных пептидов может составлять приблизительно от 1 пМ и приблизительно до 1 мМ, приблизительно 100 пМ и приблизительно до 500 мкМ, приблизительно 500 пМ и приблизительно до 10 мкМ, приблизительно 1 нМ и приблизительно до 1 мкМ, или приблизительно до 10 нМ и приблизительно до 1 мкМ. В определенных вариантах осуществления аффинность связывания с HLA неоантигенных пептидов может составлять по меньшей мере 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 700, 800, 900 мкМ или более. В определенных вариантах осуществления аффинность связывания с HLA неоантигенных пептидов может составлять не более 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 700, 800, 900 мкМ.

[179] В определенных вариантах осуществления неоантигенного пептида, описываемый в настоящем описании, может содержать носители, такие как носители, хорошо известные в данной области, например, тиреоглобулин, альбумины, такие как сывороточный альбумин человека, столбнячный токсин, полиаминокислотный остатки, такие как поли L-лизин, поли-L-глутаминовая кислота, белки вируса гриппа, коровый белок вируса гепатита B и т.п.

[180] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, можно модифицировать ацилированием NH2-конца, например, посредством алканоила (C1-C20) или тиогликольильного ацетилирования, амидированием карбоксильного конца, например, аммиаком, метиламином и т.д. В определенных вариантах осуществления эти модификации могут обеспечивать участки для связывания с подложкой или другой молекулой.

[181] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, может содержать модификации, такие как, но, не ограничиваясь ими, гликозилирование, окисление боковой цепи, биотинилирование, фосфорилирование, добавление поверхностно-активного вещества, например, липида, или его можно химически модифицировать, например, ацетилированием и т.д. Кроме того, связи в пептиде могут является отличными от пептидных связей, например, ковалентными связями, сложноэфирными или эфирными связями, дисульфидными связями, водородными связями, ионными связями и т.д.

[182] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, может содержать замены для модификации физического свойства (например, стабильности или растворимости) получаемого пептида. Например, неоантигенные пептиды можно модифицировать заменой цистеина (C) α-аминомасляной кислотой ("B"). Вследствие своей химической структуры, цистеин, как правило, образует дисульфидные мостики и в достаточной степени изменяет структуру пептида, таким образом, снижая способность связывания. Замена α-аминомасляной кислоты C не только ослабляет эту проблему, но и фактически улучшает способность связывания и перекрестного связывания при определенных обстоятельствах. Замена цистеина α-аминомасляной кислотой может происходить по любому остатку неоантигенного пептида, например, в якорных или неякорных положениях эпитопа или аналога в пептиде или в других положениях пептида.

[183] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, может содержать миметики аминокислот или неприродные аминокислотные остатки, например, D- или L-нафилаланин; D- или L-фенилглицин; D- или L-2-тиенилаланин; D- или L-1, -2, 3- или 4-пиренилаланин; D- или L-3 тиенилаланин; D- или L-(2-пиридинил)аланин; D- или L-(3-пиридинил)аланин; D- или L-(2-пиразинил)аланин; D- или L-(4-изопропил)фенилглицин; D-(трифторметил)фенилглицин; D-(трифторметил)фенилаланин; D-.rho.-фторфенилаланин; D- или L-.rho.-бифенилфенилаланин; D- или L-.rho.-метоксибифенилфенилаланин; D- или L-2-индол(аллил)аланины и D- или L-алкилаланины, где алкильная группа может являться замещенной или незамещенной метилом, этилом, пропилом, гексилом, бутилом, пентилом, изопропилом, изобутилом, втор-изотилом, изопентилом или некислыми аминокислотными остатками. Ароматические кольца неприродной аминокислоты включают, например, ароматические кольца тиазолила, тиофенила, пиразолила, бензимидазолила, нафтила, фуранила, пирролила и пиридила. Модифицированные пептиды, которые содержат различные миметики аминокислот или неприродные аминокислотные остатки, являются особенно пригодными, т.к. они, как правило, проявляют повышенную стабильность in vivo. Такие пептиды также могут обладать улучшенными свойствами хранения или производства.

[184] Стабильность пептида можно оценивать различными способами. Например, для тестирования стабильности использовали пептидазы и различные биологические среды, такие как плазма и сыворотка человека. См., например, Verhoef et al., Eur. J. Drug Metab. Pharmacokinetics 11:291 (1986). Время полужизни пептидов, описываемых в настоящем описании, в целях удобства определяют с использованием анализа с 25% сывороткой человека (об./об.). Протокол является таким, как следует ниже: объединенную сыворотку человека (тип AB, неинактивированную нагреванием) разрушают центрифугированием перед использованием. Затем сыворотку разбавляют до 25% с использованием RPMI-1640 или другой подходящей для культивирования тканей среды. В определенные интервалы времени небольшое количество реакционного раствора удаляют и добавляют 6% водную трихлоруксусную кислоту (TCA) или этанол. Мутный образец реакции охлаждают (4°C) в течение 15 минут, а затем центрифугируют для осаждения осевших сывороточных белков. Затем определяют содержание пептидов посредством обращенно-фазовой ВЭЖХ с использованием условий хроматографической стабильности.

[185] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, может находиться в растворе, в лиофилизированной форме или может находится в кристаллической форме.

[186] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, можно получать синтетически, технологией рекомбинантных ДНК или химическим синтезом или можно выделять из природных источников, таких как нативные опухоли или патогенные организмы. Эпитопы можно синтезировать индивидуально или присоединять непосредственно или опосредованно в пептиде. Хотя неоантигенный пептид, описываемый в настоящем описании, по существу не содержит другие природные белки клетки-хозяина и их фрагменты, в определенных вариантах осуществления пептид можно синтетически конъюгировать так, чтобы присоединять к нативным фрагментам или частицам.

[187] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, можно получать широким спектром способов. В определенных вариантах осуществления пептиды можно синтезировать в растворе или на твердой подложке в соответствии с общепринятыми способами. Различные автоматические синтезаторы являются коммерчески доступными, и их можно использовать в соответствии с известными протоколами. (См., например, Stewart & Young, SOLID PHASE PEPTIDE SYNTHESIS, 2D. ED., Pierce Chemical Co., 1984). Кроме того, индивидуальные пептиды можно присоединять с использованием химического лигирования с получением пептидов большего размера, которые все еще не выходят за границы изобретения.

[188] Альтернативно, можно применять технологию рекомбинантных ДНК, где нуклеотидная последовательность, которая кодирует пептид, вводят в экспрессирующий вектор, трансформируют или трансфицируют в подходящую клетку-хозяина и культивируют в подходящих для экспрессии условиях. Эти способы в основном известны в данной области, как описано в основном в Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989). Таким образом, рекомбинантные пептиды, которые содержат или состоят из одного или более эпитопов, описываемых в настоящем описании, можно использовать для предоставления подходящего T-клеточного эпитопа.

[189] В одном из аспектов изобретение, описываемое в настоящем описании, также относится к композициям, содержащим один, по меньшей мере два или более чем два неоантигенных пептида. В определенных вариантах осуществления композиция, описываемая в настоящем описании, содержит по меньшей мере два различных пептида. В определенных вариантах осуществления по меньшей мере два различных пептида получают из одного и того же полипептида. Под различными полипептидами подразумевают, что пептид различается по длине, аминокислотной последовательности или тем и другим. Пептиды получают из любого полипептида, известного или для которого обнаружили, что она несет опухолеспецифическую мутацию.

[190] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном с точечной мутацией, приводящей к замене аминокислоты нативного пептида.

[191] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном ABL. В родственных вариантах осуществления AxByCz представляет собой VADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGKVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVC, VADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGVVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVC, LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSATEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF, SLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLA или STVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQHGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLG.

[192] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном ALK. В родственных вариантах осуществления AxByCz представляет собой SSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIADFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLL или QVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFI.

[193] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном BRAF. В родственных вариантах осуществления AxByCz представляет собой MIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELM. В некоторых родственных вариантах осуществления неоантигенный пептид не является DFGLATEKSR или FGLATEKSRW.

[194] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном BTK. В родственных вариантах осуществления AxByCz представляет собой MIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGSLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVND.

[195] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EEF1B2. В родственных вариантах осуществления AxByCz представляет собой MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGAT. В некоторых родственных вариантах осуществления неоантигенный пептид не является EAVSGPPPA, FEAVSGPPP или FEAVSGPPPA.

[196] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EGFR. В родственных вариантах осуществления AxByCz представляет собой MSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIRNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLL или IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA.

[197] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном ERBB3. В родственных вариантах осуществления AxByCz представляет собой EFSTLPLPNLRMVRGTQVYDGKF. В некоторых родственных вариантах осуществления неоантигенный пептид не является RMVRGTQVY, LPLPNLRMV, LRMVRGTQV, TLPLPNLRMV, NLRMVRGTQV или LRMVRGTQVY.

[198] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном ESR1. В родственных вариантах осуществления AxByCz представляет собой HLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEA, NQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLPSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSH, IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLCDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE, IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLNDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE или IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE.

[199] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном FGFR3. В родственных вариантах осуществления AxByCz представляет собой HRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERCPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVG. В некоторых родственных вариантах осуществления неоантигенный пептид не является DVLERCPHR, LERCPHRPI, CPHRPILQA или LERCPHRPIL.

[200] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном FRG1B. В родственных вариантах осуществления AxByCz представляет собой AVKLSDSRIALKSGYGKYLGINSDELVGHSDAIGPREQWEPVFQNGKMALSASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAEKETKKKDDIPEEDKG. В некоторых родственных вариантах осуществления неоантигенный пептид не является SASNSCFIR, LSASNSCFI, ALSASNSCF или FQNGKMALSA.

[201] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном HER2. В родственных вариантах осуществления AxByCz представляет собой GSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGLGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCM.

[202] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном IDH1. В родственных вариантах осуществления AxByCz представляет собой RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM, RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGCHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM, RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGGHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM или RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGSHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM. В некоторых родственных вариантах осуществления неоантигенный пептид не является PIIIGHHAY, GHHAYGDQY, KPIIIGHHAY, IGHHAYGDQY, PIIIGCHAY, GCHAYGDQY, KPIIIGCHAY, IGCHAYGDQY, PIIIGGHAY, GGHAYGDQY, KPIIIGGHAY или IGGHAYGDQY.

[203] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном KIT. В родственных вариантах осуществления AxByCz представляет собой VEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIANLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYK или VEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIANLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYK.

[204] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном MEK. В родственных вариантах осуществления AxByCz представляет собой ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHESNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI или LGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSLYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVI.

[205] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном MYC. В родственных вариантах осуществления AxByCz представляет собой MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSDLQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGG, FTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLSTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLG или TNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPIPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGG.

[206] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном PDGFRa. В родственных вариантах осуществления AxByCz представляет собой VAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIIIEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSYVILS.

[207] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном PIK3CA. В родственных вариантах осуществления AxByCz представляет собой IEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSKITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPP, HANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITKQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKP или LFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDARHGGWTTKMDWIFHTIKQHALN. В некоторых родственных вариантах осуществления неоантигенный пептид не является ISTRDPLSK, STRDPLSKI, LSKITEQEK, AISTRDPLSK, SKITEQEKDF, SEITKQEKDF, KQEKDFLWSH, FMKQMNDAR, KQMNDARHG, RHGGWTTKM, YFMKQMNDAR, FMKQMNDARH, KQMNDARHGG, QMNDARHGGW или ARHGGWTTKM.

[208] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном POLE. В родственных вариантах осуществления AxByCz представляет собой QRGGVITDEEETSKKIADQLDNIVDMREYDVPYHIRLSIDIETTKLPLKFRDAETDQIMMISYMIDGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFN. В некоторых родственных вариантах осуществления неоантигенный пептид не является TTKLPLKFR, RDAETDQIM, KFRDAETDQI, ETTKLPLKFR или RDAETDQIMM.

[209] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном PTEN. В родственных вариантах осуществления AxByCz представляет собой KFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGQTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY. В некоторых родственных вариантах осуществления неоантигенный пептид не является QTGVMICAY, GKGQTGVMI, GQTGVMICAY или KAGKGQTGVM.

[210] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном RAC1. В родственных вариантах осуществления AxByCz представляет собой MQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGET. В некоторых родственных вариантах осуществления неоантигенный пептид не является TTNAFSGEY, FSGEYIPTV, SGEYIPTVF, YTTNAFSGEY, TTNAFSGEYI или FSGEYIPTVF.

[211] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном TP53. В родственных вариантах осуществления AxByCz представляет собой IRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGSMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEP, TYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRHCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEV, EGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNQRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHE, EGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNWRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHE или PEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPL. В некоторых родственных вариантах осуществления неоантигенный пептид не является SSCMGSMNR, GSMNRRPIL, MGSMNRRPI, CNSSCMGSM, SMNRRPILTI, SSCMGSMNRR, NSSCMGSMNR, MGSMNRRPIL, MCNSSCMGSM, CMGSMNRRPI, TEVVRHCPH, VVRHCPHHER, SQHMTEVVRH, MNQRPILTI, NQRPILTII, CMGGMNQRPI, GMNQRPILTI, SSCMGGMNQR, NQRPILTIIT, NWRPILTII, SSCMGGMNW, MGGMNWRPI, MNWRPILTI, CMGGMNWRPI, GMNWRPILTI, SSCMGGMNWR, MNWRPILTII, NSSCMGGMNW, NSFEVCVCA, EVCVCACPGR или FEVCVCACPG.

[212] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном с мутацией сдвига рамки считывания.

[213] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном ACVR2A. В родственных вариантах осуществления AxByCz представляет собой GVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKRQP или GVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKTALKYIFVAVRAICVMKSFLIFRRWKSHSPLQIQLHLSHPITTSCSIPWCHLC.

[214] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном C15ORF40. В родственных вариантах осуществления AxByCz представляет собой TAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKVGLALFFFFFETKSCSVAQAGVQWRSLGSLQPPPPGFKLFSCLSFLSSWDYRRMPPCLANFCIFNRDGVSPCWSGWS.

[215] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном CNOT1. В родственных вариантах осуществления AxByCz представляет собой LSVIIFFFVYIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFSVIFSTRCLTDSRYPNICWFK или LSVIIFFFVYIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFCYILNTMFDR.

[216] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EIF2B3. В родственных вариантах осуществления AxByCz представляет собой VLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKQWSSVTSLEWTAQERGCSSWLMKQTWMKSWSLRDPSYRSILEYVSTRVLWMPTSTV.

[217] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EPHB2. В родственных вариантах осуществления AxByCz представляет собой SIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKREWEKRKQILGGGGKYKEYFLKRILIRKAMTVLAGDKKGLGRFMRCVQSETKAVSLQLPLGR.

[218] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном ESRP1. В родственных вариантах осуществления AxByCz представляет собой LDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKKHEGQIC или LDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKT.

[219] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном FAM11B. В родственных вариантах осуществления AxByCz представляет собой GALCKDGRFRSDIGEFEWKLKEGHKKIYGKQSMVDEVSGKVLEMDISKKKHYNRKISIKKLNRMKVPLMKLITRV. В некоторых родственных вариантах осуществления неоантигенный пептид не является KLNRMKVPL, PLMKLITRV, RMKVPLMKL, ISKKKHYNR, SKKKHYNRK, KHYNRKISI, HYNRKISIK, YNRKISIKK, KISIKKLNR, SIKKLNRMK, LNRMKVPLM, ISIKKLNRM, MKVPLMKLI, KLNRMKVPLM, RMKVPLMKLI, ISIKKLNRMK, ISKKKHYNRK, KHYNRKISIK, HYNRKISIKK, KISIKKLNRM, SIKKLNRMKV, LNRMKVPLMK, KVPLMKLITR, DISKKKHYNR, KKHYNRKISI, KKLNRMKVPL или VPLMKLITRV.

[220] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном GBP3. В родственных вариантах осуществления AxByCz представляет собой RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKPRDICRIS.

[221] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном JAK1. В родственных вариантах осуществления AxByCz представляет собой VNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLKTSN или CRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKNQQLKWTPHILKSAS.

[222] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном LMAN1. В родственных вариантах осуществления AxByCz представляет собой DDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKRGIPEGPPRPPRAACGGNI или DDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKRNSRRATPTSKGSLRRKYLRV.

[223] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном MSH3. В родственных вариантах осуществления AxByCz представляет собой TKSTLIGEDVNPLIKLDDAVNVDEIMTDTSTSYLLCISENKENVRDKKKGQHFYWHCGSAACHRRGCV или LYTKSTLIGEDVNPLIKLDDAVNVDEIMTDTSTSYLLCISENKENVRDKKRATFLLALWECSLPQARLCLIVSRTLLLVQS.

[224] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном NDUFC2. В родственных вариантах осуществления AxByCz представляет собой LPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFCWILSCKT или SLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFLLDIIL.

[225] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном RBM27. В родственных вариантах осуществления AxByCz представляет собой NQSGGAGEDCQIFSTPGHPKMIYSSSNLKTPSKLCSGSKSHDVQEVLKKKTGSNEVTTRYEEKKTGSVRKANRMPKDVNIQVRKKQKHETRRKSKYNEDFERAWREDLTIKR.

[226] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном RPL22. В родственных вариантах осуществления AxByCz представляет собой MAPVKKLVVKGGKKKEASSEVHS или MAPVKKLVVKGGKKRSKF. В некоторых родственных вариантах осуществления неоантигенный пептид не является VVKGGKKRSK или VKGGKKRSK

[227] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном SEC31A. В родственных вариантах осуществления AxByCz представляет собой MPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKN или MPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKLMLLRLNLRKMCGPF.

[228] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном SEC63. В родственных вариантах осуществления AxByCz представляет собой AEVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKETFKKKTYTCAITTVKATETKAGKWSRWE или MAEVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKRNL.

[229] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном SLC35F5. В родственных вариантах осуществления AxByCz представляет собой NIMEIRQLPSSHALEAKLSRMSYPVKEQESILKTVGKLTATQVAKISFFFALCGFWQICHIKKHFQTHKLL.

[230] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном SMAP1. В родственных вариантах осуществления AxByCz представляет собой YEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKGREKERKGARKAGKTTYS или KYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKRKRKREKRSQKSRQNHLQLKSCRRKISNWSLKKVPALKKLRSPLWIF. В некоторых родственных вариантах осуществления неоантигенный пептид не является ALKKLRSPL, KISNWSLKK, SLKKVPALK, KLRSPLWIF, KKRKRKREK, RKREKRSQK, RSQKSRQNH, SQKSRQNHL, KSRQNHLQL, RRKISNWSL, RKISNWSLK, KVPALKKLR, HLQLKSCRR, WSLKKVPAL, RQNHLQLKS, KKVPALKKL, LKKLRSPLW, KKLRSPLWI, KISNWSLKKV, KSRQNHLQLK, SLKKVPALKK, WSLKKVPALK, KRKREKRSQK, RSQKSRQNHL, HLQLKSCRRK, RRKISNWSLK, CRRKISNWSL, NWSLKKVPAL, QKSRQNHLQL, RQNHLQLKSC, LQLKSCRRKI, ALKKLRSPLW или KKLRSPLWI

[231] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном TFAM. В родственных вариантах осуществления AxByCz представляет собой IYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKRVNTAWKTKKTSFSL или IYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKS.

[232] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном TGFBR2. В родственных вариантах осуществления AxByCz представляет собой KPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKAW или EKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKNITPAILTCC.

[233] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном THAP5. В родственных вариантах осуществления AxByCz представляет собой VPSKYQFLCSDHFTPDSLDIRWGIRYLKQTAVPTIFSLPEDNQGKDPSKKNPRRKTWKMRKKYAQKPSQKNHLY.

[234] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном TTK. В родственных вариантах осуществления AxByCz представляет собой GTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGESHNSSSSKTFEKKGEKNDLQLFVMSDTTYKIYWTVILLNPCGNLHLKTTSL

[235] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном XPOT. В родственных вариантах осуществления AxByCz представляет собой QQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFLTFSQ.

[236] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном APC. В родственных вариантах осуществления Cz представляет собой AKFQQCHSTLEPNPADCRVLVYLQNQPGTKLLNFLQERNLPPKVVLRHPKVHLNTMFRRPHSCLADVLLSVHLIVLRVVRLPAPFRVNHAVEW, APVIFQIALDKPCHQAEVKHLHHLLKQLKPSEKYLKIKHLLLKRERVDLSKLQ или MLQFRGSRFFQMLILYYILPRKVLQMDFLVHPA. В некоторых родственных вариантах осуществления неоантигенный пептид не является ADVLLSVHL, ADVLLSVHLI, APFRVNHAV, ARHKAVEFL, CLADVLLSV, CLADVLLSVH, DVLLSVHLI, DVLLSVHLIV, FLQERNLPPK, FRVNHAVEW, HLIVLRVVR, HLIVLRVVRL, HLNTMFRRPH, HPKVHLNTM, HPKVHLNTMF, KAVEFLQER, KVHLNTMFR, KVHLNTMFRR, KVVLRHPKV, LLSVHLIVL, LLSVHLIVLR, LPAPFRVNH, LPAPFRVNHA, LQERNLPPKV, LRVVRLPAPF, LSVHLIVLR, LSVHLIVLRV, MFRRPHSCL, MFRRPHSCLA, NLPPKVVLR, NTMFRRPHSC, QERNLPPKV, RHPKVHLNTM, RNLPPKVVL, RNLPPKVVLR, RPHSCLADV, RPHSCLADVL, RVVRLPAPF, RVVRLPAPFR, SARHKAVEFL, SVHLIVLRV, SVHLIVLRVV, TMFRRPHSC, TMFRRPHSCL, VEFLQERNL, VLLSVHLIV, VLLSVHLIVL, VLRHPKVHL, VLRVVRLPA, VVRLPAPFR или VVRLPAPFRV.

[237] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном ARID1A. В родственных вариантах осуществления Cz представляет собой ALGPHSRISCLPTQTRGCILLAATPRSSSSSSSNDMIPMAISSPPKAPLLAAPSPASRLQCINSNSRITSGQWMAHMALLPSGTKGRCTACHTALGRGSLSSSSCPQPSPSLPASNKLPSLPLSKMYTTSMAMPILPLPQLLLSADQQAAPRTNFHSSLAETVSLHPLAPMPSKTCHHK, AHQGFPAAKESRVIQLSLLSLLIPPLTCLASEALPRPLLALPPVLLSLAQDHSRLLQCQATRCHLGHPVASRTASCILP, PILAATGTSVRTAARTWVPRAAIRVPDPAAVPDDHAGPGAECHGRPLLYTADSSLWTTRPQRVWSTGPDSILQPAKSSPSAAAATLLPATTVPDPSCPTFVSAAATVSTTTAPVLSASILPAAIPASTSAVPGSIPLPAVDDTAAPPEPAPLLTATGSVSLPAAATSAASTLDALPAGCVSSAPVSAVPANCLFPAALPSTAGAISRFIWVSGILSPLNDLQ, PCRAGRRVPWAASLIHSRFLLMDNKAPAGMVNRARLHITTSKVLTLSSSSHPTPSNHRPRPLMPNLRISSSHSLNHHSSSPLSLHTPSSHPSLHISSPRLHTPPSSRRHSSTPRASPPTHSHRLSLLTSSSNLSSQHPRRSPSRLRILSPSLSSPSKLPIPSSASLHRRSYLKIHLGLRHPQPPQ, RTNPTVRMRPHCVPFWTGRILLPSAASVCPIPFEACHLCQAMTLRCPNTQGCCSSWAS или TNQALPKIEVICRGTPRCPSTVPPSPAQPYLRVSLPEDRYTQAWAPTSRTPWGAMVPRGVSMAHKVATPGSQTIMPCPMPTTPVQAWLEA. В некоторых родственных вариантах осуществления неоантигенный пептид не является AAWRSCIAL, AAWRSCIALW, AETVSLHPL, AETVSLHPLA, AHMALLPSG, ALWCASSVT, AMPILPLPQL, APLLAAPSPA, APRTNFHSS, APRTNFHSSL, ASNKLPSLPL, AWRSCIALW, CAGRWLWYCW, CIALWCASSV, CPQPSPSLPA, CRRAVSATSW, CTACHTALGR, DQQAAPRTNF, ETVSLHPLA, FHSSLAETV, GMYSPSRYPR, GQWMAHMAL, GQWMAHMALL, GRCTACHTAL, GTAWQLVPL, HMALLPSGT, HMALLPSGTK, HPLAPMPSK, HSSLAETVSL, HTALGRGSL, IALWCASSV, ILATPPSAA, ILATPPSAAW, IPMAISSPP, IPMAISSPPK, ISSPPKAPL, ISSPPKAPLL, ITSGQWMAHM, KGRCTACHT, KGRCTACHTA, KLPSLPLSK, KLPSLPLSKM, KMYTTSMAM, KMYTTSMAMP, LAAPSPASR, LAAPSPASRL, LAETVSLHPL, LATPPSAAW, LATPPSAAWR, LLAAPSPASR, LLLSADQQAA, LLSADQQAA, LPASNKLPS, LPASNKLPSL, LPLPQLLLS, LPLPQLLLSA, LPSLPLSKM, LPSLPLSKMY, LQCINSNSRI, LQCRRAVSA, LQCRRAVSAT, LSADQQAAPR, LSKMYTTSM, LSKMYTTSMA, LWCASSVTER, LWYCWPTWL, LWYCWPTWLR, MAHMALLPS, MALLPSGTK, MPILPLPQL, MPILPLPQLL, MYSPSRYPR, MYTTSMAMPI, PMAISSPPK, QLVPLQCRR, QQAAPRTNF, QQAAPRTNFH, QWMAHMALL, RAVSATSWA, RAVSATSWAS, RCAGRWLWY, RCTACHTAL, RGTAWQLVPL, RLQCINSNSR, RRAVSATSW, RTNFHSSLA, RTNFHSSLAE, RTRCAGRWL, RTRCAGRWLW, RWLWYCWPT, RWLWYCWPTW, SAAWRSCIA, SAAWRSCIAL, SGQWMAHMAL, SKMYTTSMA, SKMYTTSMAM, SMAMPILPL, SNKLPSLPL, SPASRLQCI, SPPKAPLLAA, SPSLPASNKL, SRITSGQWM, SSCPQPSPSL, SSLAETVSL, SSNDMIPMAI, SSSNDMIPM, SSSSNDMIPM, SSSSSSNDM, SSSSSSSNDM, TACHTALGR, TERTRCAGRW, TSMAMPILPL, TTSMAMPIL, TVSLHPLAPM, TWLRGTAWQL, VPLQCRRAV, VSLHPLAPM, VTERTRCAGR, WLRGTAWQL, WLRGTAWQLV, WLWYCWPTW, WLWYCWPTWL, WMAHMALLPS, WPTWLRGTA, WPTWLRGTAW, WYCWPTWLR, YPRSSSSSS, YPRSSSSSSS, YTTSMAMPI или YTTSMAMPIL.

[238] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном β2M. В родственных вариантах осуществления Cz представляет собой RMERELKKWSIQTCLSARTGLSISCTTLNSPPLKKMSMPAV или LCSRYSLFLAWRLSSVLQRFRFTHVIQQRMESQIS. В некоторых родственных вариантах осуществления неоантигенный пептид не является ALAVLALLSF, ALLSFWPGGY, DSGLLTSSSR, ELLCVWVSSI, EWKVKFPEL, FPELLCVWV, FWPGGYPAY, GLLTSSSREW, KFPELLCVW, KFPELLCVWV, KVKFPELLC, KVKFPELLCV, LAVLALLSF, LAVLALLSFW, LLCVWVSSI, LLCVWVSSIR, LLSFWPGGY, LLTSSSREW, LLTSSSREWK, LSFWPGGYPA, LTSSSREWK, LTSSSREWKV, REWKVKFPE, REWKVKFPEL, SFWPGGYPA, SFWPGGYPAY, SSREWKVKF, SSSREWKVK, SSSREWKVKF, TSSSREWKV, TSSSREWKVK, VKFPELLCV, VKFPELLCVW, WKVKFPELL ли YPAYSKDSGL.

[239] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном CDH1. В родственных вариантах осуществления Cz представляет собой RSACVTVKGPLASVGRHSLSKQDCKFLPFWGFLEEFLLC, IQWGTTTAPRPIRPPFLESKQNCSHFPTPLLASEDRRETGLFLPSAAQKMKKAHFLKTWFRSNPTKTKKARFSTASLAKELTHPLLVSLLLKEKQDG, PTDPFLGLRLGLHLQKVFHQSHAEYSGAPPPPPAPSGLRFWNPSRIAHISQLLSWPQKTEERLGYSSHQLPRK, FCCSCCFFGGERWSKSPYCPQRMTPGTTFITMMKKEAEKRTRTLT или WRRNCKAPVSLRKSVQTPARSSPARPDRTRRLPSLGVPGQPWALGAAASRRCCCCCRSPLGSARSRSPATLALTPRATRSRCPGATWREAASWAE.

[240] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном GATA3. В родственных вариантах осуществления Cz представляет собой PGRPLQTHVLPEPHLALQPLQPHADHAHADAPAIQPVLWTTPPLQHGHRHGLEPCSMLTGPPARVPAVPFDLHFCRSSIMKPKRDGYMFLKAESKIMFATLQRSSLWCLCSNH или PRPRRCTRHPACPLDHTTPPAWSPPWVRALLDAHRAPSESPCSPFRLAFLQEQYHEA. В некоторых родственных вариантах осуществления неоантигенный пептид не является AALSRHNVL, ADAPAIQPV, ADAPAIQPVL, AESKIMFAT, AESKIMFATL, AIQPVLWTT, ALQPLQPHA, APAIQPVLW, ARVPAVPFDL, ATLQRSSLW, AVPFDLHFCR, CSMLTGPPA, CSMLTGPPAR, DLHFCRSSI, DLHFCRSSIM, EPHLALQPL, ESKIMFATL, FATLQRSSL, FATLQRSSLW, FCRSSIMKPK, FDLHFCRSSI, FLKAESKIM, FLKAESKIMF, GPPARVPAV, GYMFLKAESK, HADAPAIQPV, HAHADAPAI, HFCRSSIMK, HLALQPLQPH, HMSSLSHISA, HPLQHGHRH, HPPSSLSFW, HRHGLEPCSM, IMFATLQRS, IMFATLQRSS, IMKPKRDGY, IMKPKRDGYM, KAESKIMFA, KIMFATLQR, KPKRDGYMF, KPKRDGYMFL, LALQPLQPH, LHFCRSSIM, LHFCRSSIMK, LKAESKIMF, LQHGHRHGL, LQPHADHAH, LQRSSLWCL, LQRSSLWCLC, LSFGPHHPL, LSFGPHPPL, LSFWTTPPL, LSHISALQPL, MFATLQRSSL, MFLKAESKI, MFLKAESKIM, MHPPSSLSFW, MKPKRDGYMF, MLTGPPARV, MSSLSHISA, MSSLSHISAL, NPAALSRHNV, PARVPAVPF, PAVPFDLHF, PEPHLALQPL, PPARVPAVPF, QPVLWTTPPL, RHGLEPCSM, RHNVLPEPHL, RSSIMKPKR, SALQPLQPH, SHISALQPL, SIMKPKRDGY, SLSFGPHHPL, SLSFGPHPPL, SLSFWTTPPL, SMLTGPPAR, SMLTGPPARV, SSLSHISAL, TLQRSSLWCL, TTPPLQHGHR, VLPEPHLAL, VPAVPFDLHF, VPFDLHFCR, YMFLKAESK или YMFLKAESKI.

[241] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном MLL2. В родственных вариантах осуществления Cz представляет собой TRRCHCCPHLRSHPCPHHLRNHPRPHHLRHHACHHHLRNCPHPHFLRHCTCPGRWRNRPSLRRLRSLLCLPHLNHHLFLHWRSRPCLHRKSHPHLLHLRRLYPHHLKHRPCPHHLKNLLCPRHLRNCPLPRHLKHLACLHHLRSHPCPLHLKSHPCLHHRRHLVCSHHLKSLLCPLHLRSLPFPHHLRHHACPHHLRTRLCPHHLKNHLCPPHLRYRAYPPCLWCHACLHRLRNLPCPHRLRSLPRPLHLRLHASPHHLRTPPHPHHLRTHLLPHHRRTRSCPCRWRSHPCCHYLRSRNSAPGPRGRTCHPGLRSRTCPPGLRSHTYLRRLRSHTCPPSLRSHAYALCLRSHTCPPRLRDHICPLSLRNCTCPPRLRSRTCLLCLRSHACPPNLRNHTCPPSLRSHACPPGLRNRICPLSLRSHPCPLGLKSPLRSQANALHLRSCPCSLPLGNHPYLPCLESQPCLSLGNHLCPLCPRSCRCPHLGSHPCRLS. В некоторых родственных вариантах осуществления неоантигенный пептид не является APGPRGRTC, CHYLRSRNSA, CLRSHTCPPR, CLWCHACLHR, CPHLGSHPC, CPHRLRSLPR, CPLGLKSPL, CPPGLRNRI, CPPGLRSHTY, CPPRLRDHI, CPPSLRSHAY, CPRSCRCPH, CPRSCRCPHL, CSLPLGNHPY, CTCPPRLRSR, DHICPLSLR, EESPMSPHL, ESPMSPHLR, ESPMSPHLRY, EVSRLSPCL, GLKSPLRSQA, GLRNRICPL, GLRNRICPLS, GLRSHTYLR, GLRSHTYLRR, GLRSRTCPPG, HACPPGLRNR, HAYALCLRSH, HHLRTHLLPH, HLGSHPCRL, HLLPHHRRTR, HLRLHASPH, HLRLHASPHH, HLRSCPCSL, HLRTHLLPH, HLRTHLLPHH, HLRTPPHPH, HLRTPPHPHH, HLRYRAYPP, HLRYRAYPPC, HPCCHYLRSR, HPHHLRTHL, HPHHLRTHLL, HRLRSLPRPL, HTYLRRLRS, HTYLRRLRSH, HYLRSRNSA, KSPLRSQANA, LESQPCLSL, LHLRLHASPH, LHLRSCPCSL, LLPHHRRTR, LPCPHRLRSL, LPHHRRTRS, LPHHRRTRSC, LPLGNHPYL, LPRPLHLRL, LRLHASPHHL, LRNCTCPPRL, LRNHTCPPSL, LRNRICPLSL, LRSCPCSLPL, LRSHACPPGL, LRSHACPPNL, LRSHAYALCL, LRSHTCPPRL, LRSHTCPPSL, LRSHTYLRRL, LRSLPRPLHL, LRSQANALHL, LRTPPHPHHL, LRYRAYPPCL, LSLGNHLCPL, LSLRSHPCPL, LWCHACLHRL, MSPHLRYRA, MSPHLRYRAY, NLPCPHRLR, NLRNHTCPP, PMSPHLRYR, PPRLRSRTCL, PPSLRSHAY, RAYPPCLWCH, RDHICPLSL, RGRTCHPGL, RGRTCHPGLR, RLHASPHHL, RLHASPHHLR, RLRDHICPL, RLRDHICPLS, RLRNLPCPH, RLRNLPCPHR, RLRSHTCPP, RLRSHTCPPS, RLRSLPRPL, RLRSLPRPLH, RLRSRTCLL, RLRSRTCLLC, RLSPCLWCHA, RNHTCPPSL, RNHTCPPSLR, RNLPCPHRLR, RNRICPLSL, RNRICPLSLR, RPLHLRLHA, RPLHLRLHAS, RSCPCRWRSH, RSCPCSLPL, RSHACPPGL, RSHACPPGLR, RSHACPPNL, RSHACPPNLR, RSHAYALCL, RSHAYALCLR, RSHPCCHYL, RSHPCCHYLR, RSHPCPLGL, RSHPCPLGLK, RSHTCPPRL, RSHTCPPRLR, RSHTCPPSL, RSHTCPPSLR, RSHTYLRRL, RSHTYLRRLR, RSLPRPLHL, RSLPRPLHLR, RSQANALHL, RSQANALHLR, RSRNSAPGP, RSRNSAPGPR, RSRTCLLCL, RSRTCLLCLR, RSRTCPPGL, RSRTCPPGLR, RTCHPGLRSR, RTHLLPHHR, RTHLLPHHRR, RTPPHPHHL, RTPPHPHHLR, RTRSCPCRW, RTRSCPCRWR, RWRSHPCCH, RWRSHPCCHY, RYRAYPPCL, RYRAYPPCLW, SHAYALCLR, SLGNHLCPL, SLPLGNHPY, SLPLGNHPYL, SLPRPLHLR, SLPRPLHLRL, SLRNCTCPPR, SLRSHACPPG, SLRSHAYAL, SLRSHAYALC, SLRSHPCPL, SLRSHPCPLG, SPHHLRTPP, SPHHLRTPPH, SPHLRYRAY, SPLRSQANAL, SPMSPHLRY, SPMSPHLRYR, SQANALHLR, SQANALHLRS, VSRLSPCLW, WRSHPCCHY, WRSHPCCHYL, YLPCLESQPC, YLRRLRSHTC, YLRSRNSAP или YLRSRNSAPG.

[242] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном PTEN. В родственных вариантах осуществления Cz представляет собой SWKGTNWCNDMCIFITSGQIFKGTRGPRFLWGSKDQRQKGSNYSQSEALCVLL, KRTKCFTFG, PIFIQTLLLWDFLQKDLKAYTGTILMM, QKMILTKQIKTKPTDTFLQILR, GFWIQSIKTITRYTIFVLKDIMTPPNLIAELHNILLKTITHHS, NYSNVQWRNLQSSVCGLPAKGEDIFLQFRTHTTGRQVHVL или YQSRVLPQTEQDAKKGQNVSLLGKYILHTRTRGNLRKSRKWKSM. В некоторых родственных вариантах осуществления неоантигенный пептид не является KMLKRTKCF, MLKRTKCFT, LKRTKCFTF, MLKRTKCFTF, KQNKMLKRTK, KMLKRTKCFT или NKMLKRTKCM.

[243] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном TP53. В родственных вариантах осуществления Cz представляет собой SSQNARGCSPRGPCTSSSYTGGPCTSPLLAPVIFCPFPENLPGQLRFPSGLLAFWDSQVCDLHVLPCPQQDVLPTGQDLPCAAVG, GAAPTMSAAQIAMVWPLLSILSEWKEICVWSIWMTETLFDIVWWCPMSRLRLALTVPPSTTTTCVTVPAWAA, TGGPSSPSSHWKTPVVIYWDGTALRCVFVPVLGETGAQRKRISARKGSLTTSCPQGALSEHCPTTPAPLPSQRRNHWMENISPFRSVGVSASRCSES, FHTPARHPRPRHGHLQAVTAHDGGCEALPPP, CCPRTILNNGSLKTQVQMKLPECQRLLPPWPLHQQLLHRRPLHQPPPGPCHLLSLPRKPTRAATVSVWASCILGQPSL, VRKHFQTYGNYFLKTTFCPPCRPKQWMI или LARTPLPSTRCFANWPRPALCSCGLIPHPRPAPASAPWPSTSSHST. В некоторых родственных вариантах осуществления неоантигенный пептид не является APASAPWPST, APPWPLHQQL, APWPSTSSH, ASCILGQPSL, ATVSVWASCI, CQRLLPPWPL, HQPPPGPCHL, HQQLLHRRPL, IEQWFTEDQV, KLPECQRLL, KPTRAATVSV, KTYQGSYGFV, KTYQGSYVS, KTYQGSYVSV, LLSLPRKPTR, LPPWPLHQQL, LPRKPTRAA, LPRKPTRAAT, LSLPRKPTR, MKLPECQRL, MKLPECQRLL, MPEAAPPWPL, PEAAPPWPL, PTRAATVSV, QMKLPECQR, QQLLHRRPL, QQLLHRRPLH, QRLLPPWPL, QWFTEDQVQM, RAATVSVWA, RLLPPWPLH, RMPEAAPPW, RPAPASAPW, SLPRKPTRA, SLPRKPTRAA, SQKTYQGSYV, STPRPAPASA, SYGFVWASC, SYGFVWASCI, SYVSVWASC, SYVSVWASCI, TEDQVQMKL, TPRPAPASA, TPRPAPASAP, TRAATVSVW, TVSVWASCI, TVSVWASCIL, TYQGSYGFV, TYQGSYGFVW, TYQGSYVSV, TYQGSYVSVW, VSVWASCIL, WPLHQQLLH, WPSTSSHST, YGFVWASCI, YGFVWASCIL, YQGSYGFVW, YQGSYGFVWA, YQGSYVSVW, YQGSYVSVWA, YVSVWASCI или YVSVWASCIL.

[244] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном VHL. В родственных вариантах осуществления Cz представляет собой ELQETGHRQVALRRSGRPPKCAERPGAADTGAHCTSTDGRLKISVETYTVSSQLLMVLMSLDLDTGLVPSLVSKCLILRVK, KSDASRLSGA, RTAYFCQYHTASVYSERAMPPGCPEPSQA, TRASPPRSSSAIAVRASCCPYGSTSTASRSPTQRCRLARAAASTATEVTFGSSEMQGHTMGFWLTKLNYLCHLSMLTDSLFLPISHCQCIL, SSLRITGDWTSSGRSTKIWKTTQMCRKTWSG или RRRRGGVGRRGVRPGRVRPGGTGRRGGDGGRAAAARAALGELARALPGHLLQSQSARRAARMAQLRRRAAALPNAAAWHGPPHPQLPRSPLALQRCRDTRWASG. В некоторых родственных вариантах осуществления неоантигенный пептид не является CHLSMLTDSL, EMQGHTMGF, FLPISHCQC, FLPISHCQCI, FRDAGHTMGF, FWLTKLNYL, GFWLTKLNY, GFWLTKLNYL, GSSEMQGHTM, HLSMLTDSL, HLSMLTDSLF, HSYRGHLGSS, HTMGFWLTK, HTMGFWLTKL, KERCLQLSGA, KLNYLCHLSM, LFRDAGHTM, LNYLCHLSM, LNYLCHLSML, LPISHCQCI, LPISHCQCIL, LSMLTDSLF, LSMLTDSLFL, LTDSLFLPI, LTKLNYLCHL, MGFWLTKLNY, MLTDSLFLPI, MQGHTMGFW, MQGHTMGFWL, NYLCHLSML, RDAGHTMGF, RDAGHTMGFW, RGHLGSSEM, RIHSYRGHLG, SEMQGHTMG, SEMQGHTMGF, SLFLPISHC, SMLTDSLFL, SSEMQGHTM, TKLNYLCHL, TLKERCLQL, TMGFWLTKL, WLFRDAGHT, WLFRDAGHTM, YLCHLSMLT или YRGHLGSSEM.

[245] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется слиянием первого гена со вторым геном. В определенных вариантах осуществления выделенный неоантигенный пептид кодируется слиянием в рамке считывания первого гена со вторым геном.

[246] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном BCR и геном ABL. В родственных вариантах осуществления AxByCz представляет собой ERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASG или ELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNVIVHSATGFKQSSKALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGD.

[247] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном C11orf95 и геном RELA. В родственных вариантах осуществления AxByCz представляет собой ISNSWDAHLGLGACGEAEGLGVQGAEEEEEEEEEEEEEGAGVPACPPKGPELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTD.

[248] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном CBFB и геном MYH11. LQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQF.

[249] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном CD74 и геном ROS1. В родственных вариантах осуществления AxByCz представляет собой KGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGCRITYYILEIRKSTSNNLQNQ.

[250] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EGFR и геном SEPT14. В родственных вариантах осуществления AxByCz представляет собой первый нативный полипептид, кодируемый геном, и второй нативный полипептид кодируется LPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQLQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTD.

[251] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EGFR и геном EGFR. В родственных вариантах осуществления AxByCz представляет собой MRPSGTAGAALLALLAALCPASRALEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKD.

[252] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EML4 и геном ALK. В родственных вариантах осуществления AxByCz представляет собой SWENSDDSRNKLSKIPSTPKLIPKVTKTADKHKDVIINQAKMSTREKNSQVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDL.

[253] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном FGFR3 и геном TACC3. В родственных вариантах осуществления AxByCz представляет собой EGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDVKATQEENRELRSRCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELS,

[254] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном NAB и геном STAT6. В родственных вариантах осуществления AxByCz представляет собой RDNTLLLRRVELFSLSRQVARESTYLSSLKGSRLHPEELGGPPLKKLKQEATSKSQIMSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCC.

[255] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном NDRG1 и геном ERG. В родственных вариантах осуществления AxByCz представляет собой MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDW.

[256] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном TMPRSS2 и геном ERG. В родственных вариантах осуществления AxByCz представляет собой MALNSEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDW.

[257] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном PML и геном RARA. В родственных вариантах осуществления AxByCz представляет собой VLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKG или RSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKG.

[258] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном RUNX1 и геном CBFA2T1 (RUNX1T1). В родственных вариантах осуществления AxByCz представляет собой VARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGT

[259] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется слиянием первого гена с экзоным вариантом сплайсинга первого гена. В определенных вариантах осуществления выделенный неоантигенный пептид кодируется слиянием первого гена с криптическим экзоном первого гена.

[260] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном AR-v7 и криптический экзон, кодируемый геном AR-v7. В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном AR-v7, содержащим экзонный вариант сплайсинга гена AR. В родственных вариантах осуществления AxByCz представляет собой SCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGEKFRVGNCKHLKMTRP.

[261] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется слиянием первого гена со вторым геном, где пептид содержит аминокислотную последовательность, кодируемую последовательностью вне рамки считывания, являющуюся результатом слияния.

[262] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном AC011997.1 и геном LRRC69. В родственных вариантах осуществления y представляет собой 1. В родственных вариантах осуществления AxByCz представляет собой MAGAPPPASLPPCSLISDCCASNQRDSVGVGPSEPGNNIKICNESASRK.

[263] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном EEF1DP3 и геном FRY. В родственных вариантах осуществления y представляет собой 1. В родственных вариантах осуществления AxByCz представляет собой HGWRPFLPVRARSRWNRRLDVTVANGRSWKYGWSLLRVPQVNGIQVLNVSLKSSSNVISY.

[264] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном MAD1L1 и геном MAFK. В родственных вариантах осуществления y представляет собой 0. В родственных вариантах осуществления AxByCz представляет собой RLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKLRVPGSSVLVTVPGL.

[265] В определенных вариантах осуществления выделенный неоантигенный пептид кодируется геном PPP1R1B и геном STARD3. В родственных вариантах осуществления y представляет собой 1. В родственных вариантах осуществления AxByCz представляет собой AEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSALLLRPRPPRPEVGAHQDEQAAQGADPRLGAQPACRGLPGLLTVPQPEPLLAPPSAA.

[266] В определенных вариантах осуществления выделенный неоантигенный пептид содержит одну или более пептидных последовательностей, проиллюстрированных в таблице 1. В определенных вариантах осуществления выделенный неоантигенный пептид содержит одну или более пептидных последовательностей, проиллюстрированных в таблице 1A, таблице 1B, таблице 1C, таблице 1D, таблице 1E и/или таблице 1F. В определенных вариантах осуществления выделенный неоантигенный пептид не содержит одну или более пептидных последовательностей, проиллюстрированных в таблице 2. В определенных вариантах осуществления выделенный неоантигенный пептид не содержит одну или более пептидных последовательностей, проиллюстрированных в таблице 2A, таблице 2B, таблице 2C и/или таблице 2D.

Неоантигеные полинуклеотиды

[267] Полинуклеотиды, кодирующие каждый из пептидов, описываемых в настоящем описании, также являются частью изобретения. Как понятно специалисту в данной области, различные последовательности нуклеиновых кислот могут кодировать один и тот же пептид вследствие вырожденности генетического кода. Каждая из этих нуклеиновых кислот входит в объем настоящего изобретения. Нуклеинов кислоты, кодирующие пептиды, могут представлять собой ДНК или РНК, например, иРНК, или комбинация ДНК и РНК. В определенных вариантах осуществления нуклеиновая кислота, кодирующая пептид представляет собой самоамплифицирующуюся иРНК. (Brito et al., Adv. Genet. 2015; 89:179-233). Любой подходящий полинуклеотид, кодирующий пептид, описываемый в настоящем описании, входит в объем настоящего изобретения.

[268] Термин "РНК" включает и в определенных вариантах осуществления относится к "иРНК". Термин "иРНК" означает "информационную РНК" и относится к "транскрипту", который получают с использованием матрицы ДНК, и который кодирует пептид или полипептид. Как правило, иРНК содержит 5'-UTR, кодирующую белок область и 3'-UTR. иРНК обладают только ограниченным временем полужизни в клетках и in vitro. В определенных вариантах осуществления иРНК представляет собой самоамплифицирующуюся иРНК. В контексте настоящего изобретения иРНК можно получать транскрипцией in vitro из матрицы ДНК. Способ транскрипции in vitro известен специалисту. Например, существует ряд коммерчески доступных наборы для транскрипции in vitro.

[269] Стабильность и эффективность трансляции РНК можно модифицировать по мере небходимости. Например, РНК можно стабилизировать и ее трансляция может быть увеличена в результате одной или более модификаций, обладающих стабилизирующими эффектами и/или повышением эффективности трансляции РНК. Такие модификации описаны, например, В PCT/EP2006/009448, включенной в настоящее описание посредством ссылки. Для увеличения экспрессии РНК, используемой по настоящему изобретению, ее можно модифицировать в кодирующей области, т.е. последовательности, кодирующей экспрессируемый пептид или белок, без изменения последовательности экспрессируемого пептида или белка, таким образом, можно увеличивать содержание GC для увеличения стабильности иРНК и проводить оптимизацию кодона и, таким образом, усиливать трансляцию в клетках.

[270] Термин "модификация" в отношении РНК, используемой в настоящем изобретении, относится к любой модификации РНК, которая не встречается в природе в указанной РНК. В определенных вариантах осуществления изобретения РНК, используемая по изобретению, не содержит некэпированные 5'-трифосфаты. Удаление таких некэпированных 5'-трифосфатов можно получать обработкой РНК фосфатазой. РНК по изобретению может содержать модифицированные рибонуклеотиды для увеличения ее стабильности и/или уменьшения цитотоксичности. Например, в определенных вариантах осуществления в РНК, используемой по изобретению, 5-метилцитидин частично или полностью заменяют, например, полностью цитидином. Альтернативно или дополнительно, в определенных вариантах осуществления в РНК, используемую по изобретению, псевдоуридин частично или полностью заменяют, например, полностью уридином.

[271] В определенных вариантах осуществления термин "модификация" относится к предоставлению РНК с аналогом 5'-кэпа или 5'-кэпа. Термин "5'-кэп" относится к структуре кэпа, встречающегося на 5'-конце молекулы иРНК и, как правило, состоит из нуклеотида гуанозина, соединенного с иРНК обычной 5'-5'-трифосфатной связью. В определенных вариантах осуществления такой гуанозин является метилированным в 7-положении. Термин "общепринятый 5'-кэп" относится к природному 5'-кэпу РНК, к 7-метилгуанозиновому кэпу (mG). В контексте настоящего изобретения термин "5'-кэп" указывает на аналог 5'-кэпа, который является похожим на структуру кэпа РНК и является модифицированным так, чтобы обладать способностью стабилизировать РНК и/или усиливать трансляцию РНК, если является присоединенным, in vivo и/или в клетке.

[272] В определенных вариантах осуществления иРНК, кодирующую неоантигенный пептид по изобретению, вводят нуждающемуся в этом индивидууму. В определенных вариантах осуществления изобретение относится к РНК, олигорибонуклеотидным и полирибонуклеотидным молекулам, содержащим модифицированный нуклеозид, генотерапевтическим векторам, содержащим неоантигенный пептид по изобретению, генотерапивтическим способам и способамтранскрипцинного умолкания генов, содержащих неоантигенный пептид по изобретению. В определенных вариантах осуществления предназначенная для введения иРНК содержит по меньшей мере один модифицированный нуклеозид.

[273] Полинуклеотиды, кодирующие пептиды, описываемые в настоящем описании, можно синтезировать химическими способами, например, фосфотриэфирным способом по Matteucci, et al., J. Am. Chem. Soc. 103:3185 (1981). Полинуклеотиды, кодирующие пептиды, содержащие или состоящие из аналога, можно просто легко получать замещением подходящего и желаемого основания(й) нуклеиновой кислоты основанием, которое кодирует нативный эпитоп.

[274] Большое число векторов и систем-хозяев, подходящих для получения и введения неоантигенного пептида, описываемого в настоящем описании, являются известными специалистам в данной области и являются коммерчески доступными. Следующие ниже векторы приведены в качестве примера. Бактериальные: pQE70, pQE60, pQE-9 (Qiagen), pBS, pD10, PhageScript, psiX174, pBlueScript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene); ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia); pCR (Invitrogen). Эукариотические: pWLNEO, pSV2CAT, pOG44, pXT1, pSG (Stratagene) pSVK3, pBPV, pMSG, pSVL (Pharmacia); p75,6 (Valentis); pCEP (Invitrogen); pCEI (Epimmune). Однако можно использовать любую другую плазмиду или вектор при условии, что он способен реплицироваться и является жизнеспособным в хозяине.

[275] В качестве характерных примеров подходящих хозяев можно упомянуть: бактериальные клетки, такие как E. coli, Bacillus subtilis, Salmonella typhimurium и различные виды рода Pseudomonas, Streptomyces и Staphylococcus; клетки грибов, такие как дрожжи; клетки насекомых, такие как Drosophila и Sf9; клетки животных, такие как линия COS-7 фибробластов почки обезьяны, описанные Gluzman, Cell 23:175 (1981), и другие линии клеток, способные экспрессировать совместимый вектор, например, линии клеток C127, 3T3, CHO, HeLa и BHK или меланомы Боуэса; клетки растений и т.д. На основании указаний в настоящем описании специалисты в данной области способны выбирать подходящего хозяина.

[276] Таким образом, настоящее изобретение также относится к векторам и экспрессирующим векторам, пригодным для получения и введения неоантигенных пептидов, описываемых в настоящем описании, и к клеткам-хозяевам, содержащим такие векторы.

[277] Клетки-хозяева генетически конструируют (трансдуцируют или трансформируют, или трансфицируют) векторами, которые могут представлять собой, например, клонирующий вектор или экспрессирующий вектор. Вектор может находиться, например, в форме плазмиды, вирусной частицы, фага и т.д. Сконструированные клетки-хозяева можно культивировать в общепринятых питательных средах, модифицированных при необходимости для активации промоторов, отбора трансформантов или амплификации полинуклеотидов. Условия культивирования, такие как температура, pH и т.п., являются условиями, которые ранее использовали для клетки-хозяина, отобранной для экспрессии, и, как правило, будут очевидны специалисту в данной области.

[278] Для экспрессии неоантигенных пептидов, описываемых в настоящем описании, кодирующую последовательность предоставляют функционально связанной со страт- и стоп-кодонами, промоторными и терминаторными областями, и в определенных вариантах осуществления и системой репликации для предоставления экспрессирующего вектора для экспрессии в желаемом клеточном хозяине. Например, промоторные последовательности, совместимые с бактериальными хозяевами, предоставлены в плазмидах, содержащих подходящие участки рестрикции для вставки желаемой кодирующей последовательности. Получаемые экспрессирующие векторы трансформируют в подходящих бактериальных хозяев.

[279] Как правило, рекомбинантные экспрессирующие векторы содержат участки начала репликации и селективные маркеры, обеспечивающие трансформацию клетки-хозяина, например, ген устойчивости к ампициллину E. coli и ген TRP1 S. cerevisiae, и промотор, получаемый из экспрессируемого на высоком уровне гена для направления транскрипции последующей структурной последовательности. Такие промоторы можно получать из оперонов, кодирующих гликолитические ферменты, такие как 3-фосфоглицераткиназа (PGK), кислая фосфатаза или белки теплового шока, наряду с другими. Гетерологичная структурная последовательность собирается в соответствующей фазе с последовательностями инициации трансляции и терминации и в определенных вариантах осуществления лидерной последовательностью, способной направлять секрецию транслируемого белка в периплазматическое пространство или внеклеточную среду. Необязательно, гетерологичная последовательность может кодировать слитый белок, включая сигнальный пептид на N-конце придающий желаемые характеристики, например, стабилизацию или упрощенную очистку экспрессируемого рекомбинантного продукта.

[280] Принадлежащие дрожжам, насекомым или млекопитающим клетки-хозяева также можно использовать с применением подходящих векторов и регуляторных последовательностей. Примеры экспрессирующих систем млекопитающих включают линии COS-7 фибробластов почки обезьяны, описанные Gluzman, Cell 23:175 (1981), и другие линии клеток, способные экспрессировать совместимый вектор, например, линии клеток C127, 3T3, CHO, HeLa и BHK. Экспрессирующие векторы млекопитающих содержат участок начала репликации, подходящий промотор и энхансер, а также любые необходимые участки связывания рибосомы, участок полиаденилирования, участки донора сплайсинга и акцепторные участки, последовательности терминации транскрипции и 5'-фланкирующие нетранскрибируемые последовательности. Такие промоторы также можно получать из источников, являющихся вирусами, таких как, например, цитомегаловирус человека (CMV-IE промотор) или вирус простого герпеса 1 типа (промотор HSV TK). Для предоставления необходимых нетранскрибируемых генетических элементов можно использовать последовательности нуклеиновых кислот, получаемые из участков сплайсинга и полиаденилирования SV40.

[281] Полинуклеотиды, кодирующие неоантигенные пептиды, описываемые в настоящем описании, также могут содержать сигнальную последовательность убиквитинилирования, и/или направляющую последовательность, такую как сигнальная последовательность эндоплазматического ретикулума (ER), для облегчения перемещения получаемого пептида в эндоплазматический ретикулум.

[282] Полинуклеотиды, описываем в настоящем описании, можно вводить и экспрессировать в клетках человека (например, иммунных клетках, включая дендритные клетки). В качестве руководства по выбору кодонов для каждой аминокислоты можно использовать таблицу частоты использования кодона человека. Такие полинуклеотиды содержат спейсерные аминокислотные остатки между эпитопами и/или аналоги, такие как описанные выше аналоги, или могут содержать природные фланкирующие последовательности, смежные с эпитопами и/или аналогами (и/или CTL, HTL и B-клеточные эпитопы).

[283] В определенных вариантах осуществления неоантигенный пептид, описываемый в настоящем описании, также можно вводить/экспрессировать посредством вирусных или бактериальных векторов. Примеры экспрессирующих векторов включают аттенуированных хозяев-вирусов, таких как вирус оспавакцины или вирус оспы кур. В качестве примера такого подхода вирус оспавакцины используют в качестве вектора для экспрессии нуклеотидных последовательностей, которые кодируют неоантигенные пептиды, описываемые в настоящем описании. Векторы на основе вируса оспавакцины и способы, пригодные в протоколах иммунизации, описаны, например, в патенте США № 4722848. Другой вектор представляет собой BCG (бацилла Кальмета-Герена (Bacille Calmette Guerin)). Векторы BCG описаны Stover et al., Nature 351:456-460 (1991). Из описания, приведенного в настоящем описании, специалистам в данной области будет очевиден широкий спектр других векторов, пригодных для терапевтического введения или иммунизации неоантигенными полипептидами, описываемыми в настоящем описании, например, векторы на основе аденовируса и аденоассоциированного вируса, векторы на основе ретровирусов, векторы на основе Salmonella typhi, векторы на основе обезвреженного токсина сибирской язвы, векторы на основе вируса Сендай, векторы на основе поксвируса, векторы на основе вируса оспы канареек и векторы на основе вируса оспы кур и т.п. В определенных вариантах осуществления вектор представляет собой модифицированный вирус осповакцины Анкара (VA) (например, Bavarian Noridic (MVA-BN)).

[284] Стандартные регуляторные последовательности, хорошо известные специалистам в данной области, можно вводить в вектор для обеспечения экспрессии в клетках-мишенях человека. Некоторые элементы вектора являются необходимыми: промотор с downstream участок клонирования полинуклеотида в 5'-3' направлении, например, вставка минигена; сигнал полиаденилирования для эффективной терминации транскрипции; участок начала репликации E. coli и селективный маркер E. coli (например, ген устойчивости к ампициллину или канамицину). Для этой цели можно использовать различные промоторы, например, промотор цитомегаловируса человека (hCMV). См., например, патенты США № 5580859 и 5589466 для других подходящих промоторных последовательностей. В определенных вариантах осуществления промотор представляет собой промотор CMV-IE.

[285] Полинуклеотиды, описываемые в настоящем описании, могут содержать один или более синтетических или природных интронов в транскрибируемой области. Для повышения экспрессии полинуклеотидов также можно рассматривать введение стабилизирующих РНК последовательностей и последовательностей для репликации в клетках млекопитающих.

[286] Кроме того, полинуклеотид, описываемый в настоящем описании, может содержать иммуностимулирующие последовательности (ISS или CpG). Эти последовательности можно вводить в вектор, вне кодирующей полинуклеотид последовательности для повышения иммуногенности.

[287] В определенных вариантах осуществления размер по меньшей мере одной антигенной пептидной молекулы может составлять, но не ограничиваясь им, приблизительно 8, приблизительно 9, приблизительно 10, приблизительно 11, приблизительно 12, приблизительно 13, приблизительно 14, приблизительно 15, приблизительно 16, приблизительно 17, приблизительно 18, приблизительно 19, приблизительно 20, приблизительно 21, приблизительно 22, приблизительно 23, приблизительно 24, приблизительно 25, приблизительно 26, приблизительно 27, приблизительно 28, приблизительно 29, приблизительно 30, приблизительно 31, приблизительно 32, приблизительно 33, приблизительно 34, приблизительно 35, приблизительно 36, приблизительно 37, приблизительно 38, приблизительно 39, приблизительно 40, приблизительно 41, приблизительно 42, приблизительно 43, приблизительно 44, приблизительно 45, приблизительно 46, приблизительно 47, приблизительно 48, приблизительно 49, приблизительно 50, приблизительно 60, приблизительно 70, приблизительно 80, приблизительно 90, приблизительно 100, приблизительно 110, приблизительно 120 или более молекул аминокислотных остатков и любой диапазон, получаемый из них.

[288] В определенных вариантах осуществления длина антигенных пептидных молекул являются равной или менее 50 аминокислот. В определенных вариантах осуществления длина антигенных пептидных молекул являются равной приблизительно от 20 приблизительно до 30 аминокислот. Более длинный пептид можно конструировать несколькими путями. Например, когда HLA-связывающие области являются теоретически рассчитанными или известными, более длинный пептид может состоять из: отдельных связывающих пептидов с удлинением из 0-10 аминокислот к N- и C-концу каждого соответствующего продукта гена. Более длинный пептид также может состоять из последовательной цепи некоторых или всех связывающих пептидов с удлиненными последовательностями для каждого. В другом случае, когда секвенированием выявляют длинную (>10 остатков) последовательность эпитопа, присутствующую в пораженной ткани (например, вследствие сдвига рамки считывания, сквозного прохождения или включения интрона, что приводит к новой пептидной последовательности), более длинный пептид может состоят по всей длине из новых характерных для заболевания аминокислот. В обоих случаях использование более длинного пептида требует эндогенного процессинга профессиональными антигенпрезентирующими клетками, такими как дендритные клетки, и может приводить к более эффективной презентации антигена и индукции T-клеточных ответов. В определенных вариантах осуществления удлиненную последовательность изменяют для улучшения биохимических свойств полипептида (свойств, таких как растворимость или стабильность) или для повышения вероятности эффективного протеасомного процессинга пептида.

[289] Антигенные пептиды и полипептиды могут связывать белка HLA. В определенных вариантах осуществления антигенные пептиды могут связывать белок HLA с большей аффинностью, чем соответствующий нативный пептид/пептид дикого типа. IC50 антигенного пептида может составлять приблизительно менее чем 1000 нМ, приблизительно менее чем 500 нМ, приблизительно менее чем 250 нМ, приблизительно менее чем 200 нМ, приблизительно менее чем 150 нМ, приблизительно менее чем 100 нМ или приблизительно менее чем 50 нМ. В определенных вариантах осуществления антигенные пептиды не индуцируют аутоиммунный ответ и/или вызывают иммунологическую толерантность при введении индивидууму.

[290] Изобретение также относится к композициям, содержащим совокупность антигенных пептидов. Ссылка на антигенные пептиды включает любой подходящий способ доставки, который может приводить к введению пептида в клетку индивидуума (например, нуклеиновую кислоту). В определенных вариантах осуществления композиция содержит по меньшей мере 2 или более антигенных пептидов. В определенных вариантах осуществления композиция содержит по меньшей мере приблизительно 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450 или 500 отдельных пептидов. В определенных вариантах осуществления композиция содержит по меньшей мере один пептид из таблицы 1. В определенных вариантах осуществления композиция содержит по меньшей мере один пептид из таблицы 1 и по меньшей мере один другой пептид из таблицы 1. В определенных вариантах осуществления композиция содержит по меньшей мере один пептид из таблицы 1 и по меньшей мере один другой пептид из таблицы 2. В определенных вариантах осуществления композиция содержит по меньшей мере 20 различных пептидов. В определенных вариантах осуществления композиция содержит не более 20 различных пептидов. По изобретению 2 или более различных пептидов можно получать из одного и того же полипептида. Например, если мутация антигена кодирует полипептид, два или более антигенных пептида можно получать из полипептида. В определенных вариантах осуществления два или более антигенных пептидов, получаемые из полипептида, могут содержать матрицу блоков, которая простирается на весь полипептид (например, антигенные пептиды могут содержать серию перекрывающихся антигенных пептидов, которые охватывают участок или весь полипептид). Антигенные пептиды можно получать из любого гена, кодирующего белок. Антигенные пептиды можно получать из мутаций в злокачественной опухоли человека или из возбудителя инфекции, или аутоиммунного заболевания.

[291] Антигенные пептиды, полипептиды и аналоги можно дополнительно модифицировать так, чтобы они содержали дополнительные химические молекулы, не являющиеся обычно частью белка. Такие дериватизированные молекулы могут улучшать растворимость, биологическое время полужизни, всасывание белка или аффинность связывания. Молекулы также могут снижать или устранять любые желаемые побочные эффекты белков и т.п. Обзор таких молекул можно найти в Remington's Pharmaceutical Sciences, 20th ed., Mack Publishing Co., Easton, PA (2000). Например, антигенные пептиды и полипептиды с желаемой активностью можно модифицировать по мере необходимости для обеспечения определенных желаемых качеств, например, улучшенных фармакологических характеристик, в тоже время повышения или по меньшей мере сохранения по существу полной биологической активности немодифицированного пептида связывать желаемую молекула MHC и активировать соответствующую T-клетку. Например, антигенные пептиды и полипептиды могут являться объектом различных изменений, таких как замены, консервативные или неконсервативные, где такие изменения могут обеспечивать определенные преимущества при их использовании, такие как улучшенное связывание MHC. Такие консервативные замены могут включать замену аминокислотного остатка другим аминокислотным остатком, который является биологически и/или химически сходным, например, один гидрофобный остаток другим, или один полярный остаток другим. Эффект замен единичных аминокислот также можно исследовать с использованием D-аминокислот. Такие модификации можно проводить с применением хорошо известных способов пептидного синтеза, как описано, например, у Merrifield, Science 232:341-347 (1986), Barany & Merrifield, The Peptides, Gross & Meienhofer, eds. (N.Y., Academic Press), pp. 1-284 (1979) и Stewart & Young, Solid Phase Peptide Synthesis, (Rockford, III., Pierce), 2d Ed. (1984).

[292] Антигенный пептид также можно модифицировать путем удлинения или сокращения аминокислотной последовательности соединения, например, путем добавления или делеции аминокислот. Антигенные пептиды, полипептиды или аналоги также можно модифицировать путем изменения порядка или композиции определенных остатков. Специалисту в данной области следует понимать, что определенные аминокислотные остатки, существенные для биологической активности, например, аминокислотные остатки в критический сайтах контакта или консервативные остатки, как правило, нельзя изменять, не оказывая неблагоприятное действие на биологическую активность. Некритические аминокислоты не должны ограничиваться природными аминокислотами в белках, такие как L-a-аминокислоты, или их D-изомеры, но могут также включать неприродные аминокислоты, такие как β-γ-δ-аминокислоты, а также многие производные L-a-аминокислот.

[293] Антигенный пептид можно оптимизировать с использованием серии пептидов с заменами единичных аминокислот для определения эффекта электростатического заряда, гидрофобности и т.д. на связывание MHC. Например, серии замен положительно заряженных (например, Lys или Arg) или отрицательно заряженных (например, Glu) аминокислот можно проводить по всей длине пептида, выявляя различный характер чувствительности к различным молекулам MHC и T-клеточным рецепторам. Кроме того, можно применять множественные замены с использованием небольших, относительно нейтральных молекул, таких как Ala, Gly, Pro или аналогичных остатков. Замены могут являться гомо-олигомерами или гетеро-олигомерами. Количество и типы остатков, которые заменяют или добавляют, зависит от расстояния, необходимого между основными точками контакта и определенных требуемых функциональных характеристик (например, гидрофобности в сравнении с гидрофильностью). Также путем таких замен можно получать повышенную аффинность связывания с молекулой MHC или T-клеточным рецептором по сравнению с аффинностью исходного пептида. В любом случае в таких заменах следует использовать аминокислотные остатки или другие молекулярные фрагменты, выбранные для устранения, например, стерического взаимовлияния и взаимовлияния зарядов, которое может нарушать связывание. Замены аминокислот, как правило, представляют собой отдельные остатки. Для получения конечного пептида можно комбинировать замены, делеции, вставки или любое их сочетание.

[294] Антигенный пептид можно модифицировать с получением желаемых характеристик. Например, способность пептидов индуцировать активность CTL можно усиливать посредством связи с последовательностью, которая содержит по меньшей мере один эпитоп, который способен индуцировать ответ хелперных T-клеток. В определенных вариантах осуществления конъюгаты иммуногенные пептиды/T-хелперы являются связанными посредством спейсерной молекулы. В определенных вариантах осуществления спейсер содержит относительно небольшие, нейтральные молекулы, такие как аминокислоты или миметики аминокислот, которые являются по существу незаряженными в физиологических условиях. Спейсеры можно выбирать, например, из Ala, Gly или других нейтральных спейсеров неполярных аминокислот или нейтральных полярных аминокислот. Следует понимать, что необязательно присутствующий спейсер не должен содержать одни и те же остатки и, таким образом, может являться гетеро- или гомо-олигомером. Антигенный пептид можно связывать с T-хеперным пептидом непосредственно или через спейсер с N- или C-концом пептида. N-конец антигенного пептида или T-хелперного пептида может являться ацетилированным. Иллюстративные T-хелперные пептиды включают столбнячный токсин 830-843, грипп 307-319, спорозоит малярии 382-398 и 378-389.

[295] Настоящее изобретение по меньшей мере частично основано на способности презентировать иммунной системе пациента один или более специфических для заболевания антигенов. Специалисту в данной области из этого описания и знаний в данной области будет понятно, что существует рад способов, которыми можно получать специфические для заболевания антигены. В основном, такие специфические для заболевания антигены можно получать in vitro или in vivo. Специфические для заболевания антигены можно получать in vitro в виде пептидов или полипептидов, которые можно затем формулировать в виде вакцины или иммуногенной композиции и вводить индивидууму. Как подробно описано далее в настоящем описании, такое получение in vitro можно проводить различными способами, известными специалисту в данной области, такими как, например, пептидный синтез или экспрессия пептида/полипептида из молекулы ДНК или РНК в любой из ряда бактериальных, эукариотических или вирусных рекомбинантных экспрессирующих систем, с последующей очисткой экспрессируемого пептида/полипептида. Альтернативно, специфические для заболевания антигены можно получать in vivo путем введения молекул (например, ДНК, РНК, вирусных экспрессирующих систем и т.п.), которые кодируют специфические для заболевания антигены, индивидууму, после чего экспрессируются кодируемые специфические для заболевания антигены. Способы получения in vitro и in vivo антигенов также дополнительно описаны в настоящем описании, т.к. они относятся к фармацевтическим композициям и способам доставки терапии.

[296] В определенных вариантах осуществления настоящее изобретение относится к модифицированным антигенным пептидам. Модификация может включать ковалентную химическую модификацию, которая не изменяет первичную аминокислотную последовательность самого антигенного пептида. Модификациями можно получать пептиды с желаемыми свойствами, например, увеличение времени полужизни in vivo, повышение стабильности, уменьшение клиренса, изменение иммуногенности или аллергенности, возможность индукции конкретных антител, направленность на клетки, захват антигена, процессирование антигена, аффинность к MHC, стабильность MHC или презентация антигена. Изменение антигенного пептида, которые можно проводить включают, но не ограничиваются ими, конъюгацию с белком-носителем, конъюгацию с лигандом, конъюгацию с антителом, пэгилирование, полисиалирование гесилирование, рекомбинантные миметики PEG, слияние с Fc, слияние с альбумином, присоединение наночастиц, инкапсуляцию в оболочку из наночастиц, слияние с холестерином, слияние с железом, ацилирование, амидирование, гликозилирование, окисление боковой цепи, фосфорилирование, биотинилирование, добавление поверхностно-активного вещества, добавление миметиков аминокислот или добавление неприродных аминокислот.

[297] Проблемы, связанные с коротким временем полужизни в плазме или подверженности разложению протеазами, можно решать посредством различных модификаций, включая конъюгацию или связывание полипептидной последовательности с любым из ряда небелковых полимеров, например, полиэтиленгликоля (PEG), полипропиленгликоля или полиоксиалкиленов (см., например, как правило, через связывающий фрагмент, ковалентно связанный с другим белком и небелковым полимером, например, PEG). Продемонстрировано, что такие конъюгированные с PEG биомолекулы обладают клинически пригодными свойствами, включая лучшую физическую стабильность и термостабильность, защиту от подверженности ферментативному расщеплению, повышенную растворимость, большее время полужизни в кровотоке in vivo и пониженный клиренс, пониженную иммуногенность и антигенность и пониженную токсичность.

[298] PEG, подходящие для конъюгации с полипептидной последовательностью, являются в основном хорошо растворимыми в воде при комнатной температуре и имеют общую формулу R(0-CH2-CH2)nO-R, где R представляет собой водород или защитную группу, такую как алкильная или алканольная группа, и где n представляет собой целое число от 1 до 1000. Когда R представляет собой защитную группу, он, как правило, содержит от 1 до 8 атомов углерода. PEG, конъюгированный с полипептидной последовательностью, может быть линейным или разветвленным. Настоящим изобретением предусмотрены разветвленные производные PEG, "звездообразные-PEG" и многолучевые PEG.

[299] По настоящему описанию также предусмотрены композиции конъюгатов, где PEG имеет различное значение n, и, таким образом, ряд различных PEG are содержится в определенных соотношениях. Например, некоторые композиции содержат смесь конъюгатов, где n=l, 2, 3 и 4. В некоторых композициях процентное содержание конъюгатов, когда n=1 составляет 18-25%, процентное содержание конъюгатов, когда n=2 составляет 50-66%, процентное содержание конъюгатов, когда n=3 составляет 12-16%, и процентное содержание конъюгатов, когда n=4 составляет до 5%. Такие композиции можно получать с применением условий реакции и способов очистки, известных в данной области. Например, для разделения конъюгатов можно использовать катионообменную хроматография, а затем идентифицировать фракции, которые содержат конъюгат, содержащий, например, желаемое количество присоединенных молекул PEG, очищать от немодифицированных белковых последовательностей и от конъюгатов с другими количествами присоединенных молекул PEG.

[300] PEG может являться связанным с полипептидом по настоящему изобретению через концевую реакционноспособную группу ("спейсер"). Спейсер представляет собой, например, концевую реакционноспособную группу, которая опосредует связь между свободными амино- или карбоксильнымми группами одной или более полипептидных последовательностей и полиэтиленгликоля. PEG, содержащий спейсер, который можно связывать со свободной аминогруппой, включает N-гидроксисукцинилимидполиэтиленгликоль, который можно получать присоединением сложного эфира янтарной кислоты полиэтиленгликоля с N-гидроксисукцинилимидом. Другой активированный полиэтиленгликоль, который можно связывать со свободной аминогруппой, представляет собой 2,4-бис(0- метоксиполиэтиленгликоль)-6-хлор-s-триазин, который можно получать взаимодействием монопростого метилового эфира полиэтиленгликоля с цианурхлоридом. Активированный полиэтиленгликоль, который связывают со свободной карбоксильной группой, включает полиоксиэтилендиамин.

[301] Конъюгация одной или более полипептидных последовательностей по настоящему изобретению с PEG, содержащим спейсер, можно проводить различными общепринятыми способами. Например, реакцию конъюгации можно проводить в растворе при pH от 5 до 10, при температуре от 4°C до комнатной температуры, в течение периода от 30 минут до 20 часов с использованием молярного отношения реагента к белку от 4: 1 до 30: 1. Можно подбирать условия реакции для направления реакции к получению преимущественно желаемой степени замены. В основном, низкая температура, низкий pH (например, pH=5) и короткое время реакции, как правило, уменьшает количество, присоединившихся PEG, тогда как высокая температура, pH от нейтрального до высокого (например, pH>7) и большее время реакции, как правило, увеличивать количество присоединившихся PEG. Для остановки реакции можно использовать различные средства, известные в данной области. В определенных вариантах осуществления реакцию останавливают закислением реакционной смеси и замораживанием, например, при -20°C.

[302] По настоящему описанию также предусмотрено использование миметиков PEG. Разработаны рекомбинантные миметики PEG, которые сохраняют характеристики PEG (например, увеличенное время полужизни в сыворотке), при этом обеспечивая различные дополнительные предпочтительные свойства. В качестве примера, простые полипептидные цепи (содержащие, например, Ala, Glu, Gly, Pro, Ser и Thr), способные формировать растянутую конформацию, аналогичную PEG, можно получать рекомбинантно уже слитыми с представляющим интерес лекарственным средство на основе пептида или белка (например, технология Amunix' XTEN; Mountain View, CA). Это устраняет необходимость дополнительного этапа конъюгации во время процесса производства. Кроме того, установленные способы молекулярной биологии, способные регулировать композицию боковой цепи полипептидных цепей, что обеспечивает иммуногенность и производственные свойства.

[303] Гликозилирование может изменять физические свойства белков, а также может являться важным для стабильности, секреции и подклеточной локализации белка. Правильное гликозилирование может являться важным для биологической активности. Фактически, некоторые гены из эукариотических организмов при экспрессии в бактериях (например, E. coli), в которых отсутствуют клеточные процессы гликозилирования белков, на выходе дают белки, которые выделяют с небольшой активностью или ее отсутствием вследствие отсутствия в них гликозилирования. Добавление участков гликозилирования можно проводить путем изменения аминокислотной последовательности. Изменение полипептида можно проводить, например, добавлением или заменой одного или более остатков серина или треонина (для O-связанных участков гликозилирования) или остатков аспарагина (для N-связанных участков гликозилирования). Структура N-связанных и O-связанных остатков олигосахаридов и сахаров, встречающихся в каждом типе, может разниться. Одним из типов сахара, который часто встречается в каждом типе, является N-ацетилнейраминовая кислота (далее в настоящем описании обозначаемая как сиаловая кислота). Сиаловая кислота, как правило, является концевым остатком N-связанных и O-связанных олигосахаридов и, вследствие своего отрицательного заряда, может придавать кислотные свойства гликопротеину. Варианты осуществления по настоящему изобретению включает получение и использование N-гликозилированных вариантов.

[304] Полипептидные последовательности по настоящему изобретению можно необязательно изменять путем изменений на уровне ДНК, в частности путем мутации ДНК, кодирующей полипептид на заранее выбранных основаниях, так что получают кодоны, которые будут транслироваться в желаемые аминокислоты. Другим способом увеличения количества углеводных групп на полипептиде является химическое или ферментативное связывание гликозидов с полипептидом. Удаление углеводов можно проводить химически или ферментативно, или путем замены кодонов, кодирующих аминокислотные остатки, которые являются гликозилированными. Химические способы дегликозилирования являются известными, и ферментативное расщепление углеводных групп на полипептидах можно проводить с использованием различных эндо- и экзогликозидаз.

[305] Дополнительные подходящие компоненты и молекулы для конъюгации включают, например, молекулы для направленного действия на лимфатическую систему, тиреоглобулин; альбумины, такие как сывороточный альбумин человека (HAS); столбнячный токсин; дифтерийный анатоксин; полиаминокислоты, такие как поли(D-лизин:D-глутаминовая кислота); полипептиды VP6 ротавирусов; геммаглютинин вируса гриппа, нуклеопротеин вируса гриппа; гемоцианин морского блюдца (KLH) и коровый белок и поверхностный антиген вируса гепатита В, или любую комбинацию указанных выше.

[306] Слияние альбумина с одним или более полипептидами по настоящему изобретению можно получать, например, посредством генетической манипуляции, таким образом, что ДНК, кодирующая HSA или его фрагмент, соединяют с ДНК, кодирующей одну или более полипептидных последовательностей. Затем подходящего хозяина можно трансформировать или трансфицировать слитыми нуклеотидными последовательностями в форме, например, подходящей плазмиды, чтобы экспрессировать слитый полипептид. Экспрессию можно проводить in vitro, например, из прокариотических или эукариотических клеток или in vivo, например, из трансгенного организма. В определенных вариантах осуществления настоящего изобретения экспрессию слитого белка проводят в линиях клеток млекопитающих, например, линиях клеток СНО. Трансформация широко используют в настоящем описании для обозначения генетического изменения клетки, вызванного прямым поглощением, включением и экспрессией экзогенного генетического материала (экзогенной ДНК) из ее окружения и абсорбированного через клеточную мембрану(ы). Трансформация происходит естественным образом у некоторых видов бактерий, но ее также можно проводить искусственным образом в других клетках. Кроме того, сам альбумин можно модифицировать для продления его времени полужизни в кровотоке. Слияние модифицированного альбумина с одним или более полипептидами можно проводить техниками генетической манипуляции, описанными выше, или путем химической конъюгации; получаемая слитая молекула имеет время полужизни, которое превышает время полужизни слияний с немодифицированным альбумином. (См. WO2011/051489). Разработано несколько стратегий связывания альбумина в качетсве альтернативных вариантов прямого слияния, включая связывание альбумина через цепь конъюгированных жирных кислот (ацилирование). Поскольку сывороточный альбумин является транспортным белком для жирных кислот, эти природные лиганды с активностью связывания альбумина использовали для продления времени полужизни терапевтических средств на основе небольших белков. Например, детемир инсулина (LEVEMIR), одобренный продукт против диабета, содержит миристильную цепь, конъюгированную с генетически модифицированным инсулином, что приводит к аналогу инсулина длительного действия.

[307] Другой тип модификации заключается в конъюгации (например, связывании) одного или более дополнительных компонентов или молекул на N- и/или С-конце полипептидной последовательности, такой как другой белок (например, белок, содержащий аминокислоту последовательность, гетерологичную по отношению к исследуемому белку) или молекулу-носитель. Таким образом, примерная иллюстративную полипептидную последовательность можно предоставлять в виде конъюгата с другим компонентом или молекулой.

[308] Модификацию конъюгата может приводить к полипептидной последовательности, которая сохраняет активность с дополнительной или комплементарной функцией или активностью второй молекулы. Например, полипептидную последовательность можно конъюгировать с молекулой, например, для облегчения растворимости, хранения, время полужизни in vivo или хранения или стабильности, уменьшения иммуногенности, отсроченного или контролируемого высвобождения in vivo и т. д. Другие функции или виды активности включают конъюгат, который снижает токсичность относительно неконъюгированной полипептидной последовательности, конъюгат, который направлен на тип клетки или органа более эффективно, чем неконъюгированная полипептидная последовательность, или лекарственное средство для дальнейшей борьбы с причинам или эффектам, связанным с нарушением или заболеванием, как указано в настоящем описании (например, диабете).

[309] Полипептид также можно конъюгировать с большими медленно метаболизируемыми макромолекулами, такими как белки; полисахариды, такие как сефароза, агароза, целлюлоза, целлюлозные гранулы; полимерные аминокислоты, такие как полиглутаминовая кислота, полилизин; сополимеры аминокислот; инактивированные вирусные частицы; инактивированные бактериальные токсины, такие как анатоксин из дифтерии, столбняка, холеры, молекулы лейкотоксина; инактивированные бактерии и дендритные клетки.

[310] Дополнительные компоненты-кандидаты и молекулы для конъюгации включают молекулы пригодные для выделения или очистки. Конкретные неограничивающие примеры включают связывающие молекулы, такие как биотин (связывающая пара биотин-авидин), антитело, рецептор, лиганд, лектин или молекулы, которые содержат твердую подложку, включая, например, пластиковые или полистирольные гранулы, пластины или гранулы, магнитные гарнулы, тест-полоски и мембраны. Способы очистки, такие как катионообменная хроматография, можно использовать для отделения конъюгатов посредством разности зарядов, которая эффективно разделяет конъюгаты на их различные молекулярные массы. Содержание фракций, получаемых катионообменной хроматографией, можно идентифицировать по молекулярной массе с использованием обычных способов, например, масс-спектроскопии, SDS-PAGE или других известных способов разделения молекулярных структур по молекулярной массе.

[311] В определенных вариантах осуществления амино- или карбоксильный конец полипептидной последовательности по настоящему изобретению можно сливать с Fc-областью иммуноглобулина (например, Fc человека) с образованием слитого конъюгата (или слитой молекулы). Было показано, что конъюгаты слияния Fc увеличивают общее время полужизни биофармацевтических препаратов, и, таким образом, для биофармацевтического препарата может требоваться менее частое введение.

[312] Fc связывается с неонатальным Fc-рецептором (FcRn) в эндотелиальных клетках, которые выстилают кровеносные сосуды, и после связывания слитая с Fc молекула защищена от разложения и повторно высвобождается в кровоток, сохраняя молекулу в кровотоке в течение более длительного периода времени. Полагают, что такое связывание Fc является механизмом, посредством которого эндогенный IgG сохраняет свой длительный период полувыведения из плазмы. Более поздняя технология Fc-слияния связывает одну копию биофармацевтического препарата с Fc-областью антитела для оптимизации фармакокинетических и фармакодинамических свойств биофармацевтического препарата по сравнению с традиционными конъюгатами Fc-слияние.

[313] По настоящему описанию предусмотрено использование других модификаций, в настоящее время известных или разработанных в будущем, полипептидов для улучшения одного или более свойств. Один из таких способов продления время полужизни в коровотоке, увеличения стабильности, уменьшения клиренса или изменения иммуногенности или аллергенности полипептида по настоящему изобретению включает модификацию полипептидных последовательностей путем гесилирования, в котором используют производные гидроксиэтилкрахмала, связанные с другими молекулами, для модификации характеристик молекулы. Различные аспекты гесилирования описаны, например, в патентных заявках США № 2007/0134197 и 2006/0258607.

[314] Белки или пептиды можно получать любым способом, известным специалистам в данной области, включая экспрессию белков, полипептидов или пептидов стандартными молекулярно-биологическими способами, выделение белков или пептидов из природных источников, трансляцию in vitro или химический синтез белков или пептидов.

[315] Пептиды можно легко синтезировать химически с использованием реагентов, которые не содержат загрязняющих веществ бактериального или животного происхождения (Merrifield RB: Solid phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am. Chem. Soc.85:2149-54, 1963). В определенных вариантах осуществления антигенные пептиды получают путем (1) параллельного твердофазного синтеза на многоканальных устройствах с использованием однородных условий синтеза и расщепления; (2) очистки на колонке ОФ-ВЭЖХ с отгонкой колонка; и повторной промывкой, но не заменой, между пептидами; с последующим (3) анализом с ограниченным набором наиболее информативных анализов. Область действия Надлежащей производственной практики (GMP) можно определять для набора пептидов для отдельного пациента, таким образом, что требуется процедура переключения для замены только между синтезами пептидов для разных пациентов.

[316] Альтернативно, для получения антигенного пептида in vitro можно использовать нуклеиновую кислоту (например, полинуклеотид), кодирующую антигенный пептид по изобретению. Полинуклеотид может представлять собой, например, ДНК, кДНК, ПНК, ЦНК, РНК, одно- и/или двухцепочечные, нативные или стабилизированные формы полинуклеотидов, такие как, например, полинуклеотиды с фосфоротитовым скелетом или их сочетания, и он может содержать или не содержать интроны при условии, что он кодирует пептид. В определенных вариантах осуществления для получения пептида используют трансляцию in vitro. Можно также получать экспрессирующий вектор, способный экспрессировать полипептид. Экспрессирующие векторы для разных типов клеток хорошо известны в данной области, и их можно выбирать без излишнего экспериментирования. Как правило, ДНК вводят в экспрессирующий вектор, такой как плазмида, в правильной ориентации и в правильную рамку считывания для экспрессии. При необходимости ДНК можно связывать с соответствующими транскрипционными и трансляционными регуляторными контрольными нуклеотидными последовательностями, распознаваемыми желаемым хозяином (например, бактериями), хотя такие регуляторные последовательности обычно являются доступными в экспрессирующем векторе. Затем вектор вводят в бактерии-хозяева для клонирования стандартными способами (см., например, Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.).

[317] Также предусмотрены экспрессирующие векторы, содержащие выделенные полинуклеотиды, а также клетки-хозяева, содержащие экспрессирующие векторы. Антигенные пептиды можно предоставлять в форме молекул РНК или кДНК, кодирующих желаемые антигенные пептиды. Один или более антигенных пептидов по изобретению могут кодироваться одним экспрессирующим вектором.

[318] В определенных вариантах осуществления полинуклеотиды могут содержать кодирующую последовательность для специфического для заболевания антигенного пептида, слитого в той же рамке считывания с полинуклеотидом, который помогает, например, в экспрессии и/или секреции полипептида из клетки-хозяина (например, лидерной последовательностью, которая функционирует как секреторная последовательность для управления переносом полипептида из клетки). Полипептид, содержащий лидерную последовательность, представляет собой препротеин и может содержать лидерную последовательность, расщепляемую клеткой-хозяином с образованием зрелой формы полипептида.

[319] В определенных вариантах осуществления полинуклеотиды могут содержать кодирующую последовательность для специфического для заболевания антигенного пептида, слитого в той же раме считывания с маркерной последовательностью, которая позволяет, например, очищать кодируемый полипептид, который затем может вводить в персонализированную вакцину против заболевания или иммуногенную композицию. Например, маркерная последовательность может представлять собой гексагистидиновую метку, доставляемую вектором pQE-9 для обеспечения очистки зрелого полипептида, слитого с маркером, в случае бактериального хозяина, или маркерная последовательность может представлять собой гемагглютининовую (HA) метку, получаемую из белка гемагглютинина гриппа, когда используют являющегося млекопитающим хозяина (например, клетки COS-7). Дополнительные метки включают, но не ограничиваются ими, метки кальмодулин, метки FLAG, метки Myc, метки S, метки SBP, Softag 1, Softag 3, метку V5, метку Xpress, метки Isopeptag, SpyTag, метки Biotin Carboxyl Carrier Protein (BCCP) GST, метки флуоресцентного белка (например, метки зеленого флуоресцентного белка), метки, связывающие белки с мальтозой, метки Nus, метки Strep, метка тиоредоксина, метка TC, метка Ty и т.п.

[320] В определенных вариантах осуществления полинуклеотиды могут содержать кодирующую последовательность для одного или более специфических для заболевания антигенспецифических пептидов, слитых в одной и той же рамке считывания с получением одной конкатемеризованной конструкции антигенного пептида, способной продуцировать многие антигенные пептиды.

[321] В определенных вариантах осуществления можно предоставлять выделенные молекулы нуклеиновой кислоты, содержащие нуклеотидную последовательность, по меньшей мере на 60% идентичную, по меньшей мере на 65% идентичную, по меньшей мере на 70% идентичную, по меньшей мере на 75% идентичную, по меньшей мере на 80% идентичную, по меньшей мере на 85% идентичную, по меньшей мере, на 90% идентичную, по меньшей мере на 95% идентичную или по меньшей мере на 96%, 97%, 98% или 99%, идентичную полинуклеотиду, кодирующему специфический для заболевания антигенный пептид по настоящему изобретению.

[322] Изолированные специфические для заболевания антигенные пептиды, описываемые в настоящем описании, можно получать in vitro (например, в лаборатории) любым подходящим способом, известным в данной области. Такие способы лежат в диапазоне от прямых способов синтеза белка до конструирования последовательности ДНК, кодирующей выделенные полипептидные последовательности, и экспрессии этих последовательностей в подходящем трансформированном хозяине. В определенных вариантах осуществления последовательность ДНК конструируют с использованием рекомбинантной технологии путем выделения или синтеза последовательности ДНК, кодирующей представляющий интерес белок дикого типа. Необязательно, последовательность можно подвергать мутагенезу посредством сайт-специфического мутагенеза с предоставлением ее функциональных аналогов. См., Например, Zoeller et al., Proc. Nat'l. Acad. Sci. USA 81:5662-5066 (1984) и патент США №4588585.

[323] В определенных вариантах осуществления последовательность ДНК, кодирующая представляющий интерес полипептид, конструируют путем химического синтеза с использованием олигонуклеотидного синтезатора. Такие олигонуклеотиды можно конструировать на основе аминокислотной последовательности желаемого полипептида и отбора тех кодонов, которые являются подходящими в клетке-хозяине, в которой получают представляющий интерес рекомбинантный полипептид. Для синтеза выделенной полинуклеотидной последовательности, кодирующей представляющий интерес выделенный полипептид, можно применять стандартные способы. Например, полную последовательность аминокислот можно использовать для конструирования обратного транслируемого гена. Кроме того, можно синтезировать олигомер ДНК, содержащий нуклеотидную последовательность, кодирующую конкретный выделенный полипептид. Например, можно синтезировать несколько небольших олигонуклеотидов, кодирующих части желаемого полипептида, а затем лигировать. Отдельные олигонуклеотиды, как правило, содержат 5'- или 3'-выступы для комплементарной сборки.

[324] После сборки (например, путем синтеза, сайт-специфического мутагенеза или другого способа) полинуклеотидные последовательности, кодирующие конкретный представляющий интерес выделенный полипептид, вставляют в экспрессирующий вектор и необязательно функционально связывают с регулирующей экспрессию последовательностью, подходящею для экспрессии белка в желаемом хозяине. Правильную сборка можно подтверждать секвенированием нуклеотидов, рестрикционным картированием и экспрессией биологически активного полипептида в подходящем хозяине. Как хорошо известно в данной области, для получения высоких уровней экспрессии трансфицированного гена в хозяине ген можно оперативно связывать с регулирующими транскрипцию и трансляцию последовательностями, которые являются функциональными в выбранном хозяине для экспрессии.

[325] Рекомбинантные экспрессирующие векторы можно использовать для амплификации и экспрессии ДНК, кодирующей специфические для заболевания антигенные пептиды. Рекомбинантные экспрессирующие векторы представляют собой реплицируемые ДНК-конструкции, которые содержат синтетические или получаемые из кДНК фрагменты ДНК, кодирующие специфический для заболевания антигенный пептид, или биоэквивалентный аналог, функционально связанный с подходящими транскрипционными или трансляционными регуляторными элементами, полученными из генов млекопитающих, микроорганизмов, вирусов или насекомых. Транскрипционная единица, как правило, содержит совокупность (1) генетического элемента или элементов, обладающих регуляторной ролью в экспрессии генов, например, транскрипционных промоторов или энхансеров, (2) структурной или кодирующей последовательности, которая транскрибируется в мРНК и транслируется в белок, и (3) соответствующих последовательностей инициации и терминации транскрипции и трансляции, как подробно описано в настоящем описании. Такие регуляторные элементы могут включать операторную последовательность для контроля транскрипции. Дополнительно можно вводить возможность репликации в хозяине, как правило, обеспечиваемую участком начала репликации, и селективный ген для облегчения распознавания трансформантов. Области ДНК являются функционально связанными, когда они функционально связаны друг с другом. Например, ДНК для сигнального пептида (секреторного лидера) является функционально связанной с ДНК для полипептида, если она экспрессируется в качестве предшественника, который участвует в секреции полипептида; промотор является функционально связанным с кодирующей последовательностью, если он контролирует транскрипцию последовательности; или участок связывания рибосомы является функционально связанным с кодирующей последовательностью, если он расположен так, чтобы допускать трансляцию. Как правило, функционально связанный означает смежный, а в случае секреторных лидеров, означает смежный и в рамке считывания. Структурные элементы, предназначенные для применения в дрожжевых экспрессирующих системах, включают лидерную последовательность, обеспечивающую внеклеточную секрецию транслируемого белка клеткой-хозяином. Альтернативно, когда рекомбинантный белок экспрессируется без лидерной или транспортной последовательности, он может содержать N-концевой остаток метионина. Этот остаток необязательно может затем отщепляться от экспрессированного рекомбинантного белка с получением конечного продукта.

[326] Пригодные экспрессирующие векторы для эукариотических хозяев, особенно млекопитающих или людей, включают, например, векторы, содержащие регулирующие экспрессию последовательности из SV40, вируса папилломы крупного рогатого скота, аденовируса и цитомегаловируса. Пригодные экспрессирующие векторы для бактериальных хозяев включают известные бактериальные плазмиды, такие как плазмиды из Escherichia coli, включая pCR 1, pBR322, pMB9 и их производные, плазмиды с более широким диапазоном хозяев, такие как M13 и нитевидные одноцепочечные ДНК-фаги.

[327] Подходящие клетки-хозяева для экспрессии полипептида включают прокариотов, дрожжей, насекомых или высшие эукариотические клетки под контролем соответствующих промоторов. Прокариоты включают грамотрицательные или грамположительные организмы, например, E. coli или бациллы. Высшие эукариотические клетки включают установленные линии клеток млекопитающих. Также можно использовать бесклеточные системы трансляции. Соответствующие клонирующие и экспрессирующие векторы для использования с клетками-хозяевами бактерий, грибов, дрожжей и млекопитающих хорошо известны в данной области (см. Pouwels et al., Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985).

[328] Для экспрессии рекомбинантного белка также преимущественно применяют различные системы культивирования клеток млекопитающих или насекомых. Можно проводить экспрессия рекомбинантных белков в клетках млекопитающих, поскольку такие белки, как правило, являются правильно свернутыми, соответствующим образом модифицированными и полностью функциональными. Примеры подходящих линий клеток-хозяев млекопитающих включают линии клеток почки обезьяны COS-7, описанные Gluzman (Cell 23: 175, 1981), и другие линии клеток, способные экспрессировать соответствующий вектор, включая, например, L-клетки, линии клеток C127, 3T3, яичника китайского хомяка (CHO), 293, HeLa и BHK. Экспрессирующие векторы млекопитающих могут содержать нетранскрибируемые элементы, такие как участок начала репликации, подходящий промотор и энхансер, связанный с экспрессируемым геном, и другие 5'- или 3'-фланкирующие нетранскрибируемые последовательности и 5'- или 3'-нетранслируемые последовательности, такие как необходимые участки связывания рибосомы, участок полиаденилирования, донорные и акцепторные участка сплайсинга и последовательности терминации транскрипции. Обзор бакуловирусных систем для получения гетерологичных белков в клетках насекомых приведен у Luckow and Summers, Bio/Technology 6:47 (1988).

[329] Белки, продуцируемые трансформированным хозяином, можно очищать любым подходящим способом. Такие стандартные способы включают хроматографию (например, ионообменную, аффинную и колоночную хроматографию с распределением по размерам и т.п.), центрифугирование, дифференциальную растворимость или любой другой стандартный способ очистки белка. Аффинные метки, такие как гексагистидин, связывающий мальтозу домен, последовательность оболочки вируса гриппа и глутатион-S-трансфераза, можно присоединять к белку, чтобы обеспечивать легкую очистку пропусканием через соответствующую аффинную колонку. Выделенные белки можно также характеризовать физически с применением таких способов, как протеолиз, ядерный магнитный резонанс и рентгеновская кристаллография. Например, супернатанты из систем, секретирующих рекомбинантный белок в культуральную среду, можно сначала концентрировать с использованием коммерчески доступного фильтра для концентрации белка, например, устройства для ультрафильтрации Amicon или Millipore Pellicon. После стадии концентрации концентрат можно наносить на подходящую матрицу для очистки. Альтернативно можно применять анионообменную смолу, например, матрицу или субстрат, обладающие выступающими группами диэтиламиноэтила (DEAE). Матрицы могут представлять собой акриламид, агарозу, декстран, целлюлозу или другие типы, общепринятые для очистки белка. Альтернативно, можно применять стадию катионного обмена. Подходящие катионообменники включают в себя различные нерастворимые матрицы, содержащие сульфопропильные или карбоксиметильные группы. Наконец, одну или несколько стадий обращенно-фазовой высокоэффективной жидкостной хроматографии (ОФ-ВЭЖХ, включающих гидрофобную среду ОФ-ВЭЖХ, например, силикагель, обладающий выступающими метильными или другими алифатическими группами, можно применять для дополнительной очистки композиции белок раковой стволовой клетки-Fc. Некоторые или все из вышеупомянутых стадий очистки в различных сочетаниях также можно применять для получения гомогенного рекомбинантного белка.

[330] Рекомбинантный белок, продуцированный в бактериальной культуре, можно выделять, например, посредством исходного отделения от осадков клеток с последующими одной или более этапами концентрации, высаливания, ионного обмена в водных растворах или эксклюзионной хроматографии. Высокоэффективную жидкостную хроматографию (ВЭЖХ) можно применять для конечных этапов очистки. Клетки микроорганизмов, применяемые для экспрессии рекомбинантного белка, можно разрушать любым подходящим способом, включая циклы замораживания и оттаивания, обработку ультразвуком, механическое разрушение или применение средств для лизиса клеток.

[331] Настоящее изобретение также предусматривает использование молекул нуклеиновой кислоты в качестве носителей для доставки антигенных пептидов/полипептидов нуждающемуся в этом индивидууму in vivo, в форме, например, ДНК/РНК-вакцин (см., например, WO2012/159643 и WO2012/159754, полностью включенных, таким образом, посредством ссылки).

[332] В определенных вариантах осуществления антигены можно вводить нуждающемуся в этом пациенту с использованием плазмиды. Такие плазмиды представляют собой плазмиды, которые, как правило, состоят из сильного вирусного промотора, способствующего транскрипции in vivo и трансляции гена (или комплементарной ДНК), представляющего интерес (Mor, et al., 1995). Journal of Immunology 155 (4): 2039-2046). В некоторых случаях можно вводить интрон А для улучшения стабильности мРНК и, таким образом, повышать экспрессию белка (Leitner et al., 1997). Journal of Immunology 159 (12): 6112-6119). Плазмиды также включают сильный сигнал терминации полиаденилирования/транскрипции, такой как сигнал полиаденилирования последовательности бычьего гормона роста или бета-глобулина кролика (Alarcon et al., (1999). Adv. Parasitol. Advances in Parasitology 42: 343-410; Robinson et al., (2000). Adv. Virus Res. Advances in Virus Research 55: 1-74, Böhmet al., (1996). Journal of Immunological Methods 193 (1): 29-40.). В некоторых случаях конструируют мультицистронные векторы для экспрессии более одного иммуногена или для экспрессии иммуногена и иммуностимулирующего белка (Lewis et al., 1999). Advances in Virus Research (Academic Press) 54: 129-88).

[333] Плазмиды можно вводить в ткани животных несколькими различными способами. Двумя наиболее популярными подходами являются инъекция ДНК в физиологическом растворе с использованием стандартной иглы для подкожных инъекций и доставка с помощью генных пушек. Схематический план конструирования ДНК-вакцинной плазмиды и ее последующая доставка этими двумя способами в хозяина проиллюстрирована в Scientific American (Weiner et al., (1999) Scientific American 281 (1): 34-41). Инъекцию в физиологическом растворе, как правило, вводят внутримышечно (IM) в скелетной мышце или внутрикожно (ID), где ДНК доставляют во внеклеточные пространства. Этому может способствовать электропорация путем временного повреждения мышечных волокон миотоксинами, такими как бупивакаин; или с использованием гипертонических растворов солевого раствора или сахарозы (Alarcon et al., (1999) Adv Advs in Parasitology 42: 343-410). На иммунные ответы на этот способ доставки могут влиять многие факторы, включая тип иглы, выравнивание иглы, скорость инъекции, объем инъекции, тип мышц и возраст, пол и физиологическое состояние животного, которому вводят инъекцию (Alarcon et al., (1999). Adv. Parasitol. Advances in Parasitology 42: 343-410).

[334] Доставка генной пушкой, другой широко используемый способ доставки, баллистически ускоряет плазмидную ДНК (пДНК), которая адсорбирована на микрочастицах золота или вольфрама в клетки-мишени, с использованием сжатого гелия в качестве ускорителя (Alarcon et al., (1999). Adv. Parasitol, Advances in Parasitology 42: 343-410, Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88).

[335] Альтернативные способы доставки могут включать ингаляцию аэрозолей голой ДНК на поверхностях слизистой оболочки, такой как слизистая оболочка носа и легких (Lewis et al., 1999). Advances in Virus Research (Academic Press) 54: 129-88) и местное нанесение пДНК на слизистую оболочку глаза и слизистую оболочку влагалища (Lewis et al., (1999) Advances in Virus Research (Academic Press) 54: 129-88). Доставку на поверхность слизистой оболочки также проводили с использованием препаратов катионной липосомы-ДНК, биоразлагаемых микросфер, ослабленных векторов Shigella или Listeria для перорального введения в слизистую кишечника и рекомбинантных аденовирусных векторов. ДНК или РНК также можно доставлять в клетки после мягкого механического разрушения клеточной мембраны, временно пермеабилизирующего клетку. Такое мягкое механическое разрушение мембраны можно проводить путем аккуратного продавливания клеток через небольшое отверстие (Ex Vivo Cytosolic Delivery of Functional Macromolecules to Immune Cells, Sharei et al, PLOS ONE | DOI:10.1371/journal.pone.0118803 April 13, 2015).

[336] В определенных вариантах осуществления специфическая для заболевания вакцина или иммуногенная композиция может содержать отдельные ДНК-плазмиды, кодирующие, например, один или более антигенных пептидов/полипептидов. Как описано в настоящем описании, точный выбор экспрессирующих векторов может зависеть от пептида/полипептида, который необходимо экспрессировать, и известен специалисту в данной области. Ожидают, что ожидаемая стойкость конструкций ДНК (например, в эписомальной, нереплицирующей, неинтегрированной форме в мышечных клетках) обеспечит более длительную защиту.

[337] Один или несколько антигенных пептидов по изобретению могут кодироваться и экспрессироваться in vivo с использованием системы на основе вирусов (например, системы на основе аденовируса, адено-ассоциированного вируса (AAV), поксвируса или лентивируса). В определенных вариантах осуществления вакцина или иммуногенная композиция против заболевания может содержать вектор на основе вируса для применения у нуждающегося в ней пациента, являющегося человеком, такого как, например, аденовирус. Плазмиды, которые можно использовать для доставки вирусов, аденовирусов и лентивирусов, описаны ранее (см., например, патенты США № 6955808 и 6943019 и патентную заявку США № 20080254008, включенные, таким образом, посредством ссылки).

[338] Пептиды и полипептиды по изобретению также можно экспрессировать посредством вектора, например, молекулы нуклеиновой кислоты, как обсуждалось в настоящем описании, например, РНК или ДНК-плазмиды, вирусного вектора, такого как поксвирус, например, ортопоксвирус, вирус оспы птиц или аденовирус, AAV или лентивирус. Этот подход включает использование вектора для экспрессии нуклеотидных последовательностей, которые кодируют пептид по изобретению. При введении в хозяина с острой или хронической инфекцией или в неинфицированного хозяина вектор экспрессирует иммуногенный пептид и тем самым вызывает ответ CTL хозяина.

[339] Среди векторов, которые можно использовать в практическом осуществлении изобретения, интеграцию в геном клетки-хозяина можно проводить способами переноса генов ретровирусов, что часто приводит к длительной экспрессии введенного трансгена. В определенных вариантах осуществления изобретения ретровирус является лентивирусом. Кроме того, высокую эффективность трансдукции наблюдали во многих разных типах клеток и тканях-мишенях. Тропизм ретровируса можно изменять путем включения чужеродных белков оболочки, что расширяет возможную целевую популяцию клеток-мишеней. Ретровирус также можно конструировать для обеспечения условной экспрессии введенного трансгена, так что только определенные типы клеток инфицируют лентивирусом. Можно использовать клеткоспецифичные промоторы для направления экспрессии в конкретных типах клеток. Лентивирусные векторы представляют собой ретровирусные векторы (и, таким образом, как лентивирусный, так и ретровирусный векторы можно использовать в практическом осуществлении изобретения). Кроме того, лентивирусные векторы способны трансдуцировать или инфицировать не делящиеся клетки и, как правило, продуцируют высокие титры вирусов. Таким образом выбор ретровирусной системы переноса генов может зависеть от ткани-мишени. Ретровирусные векторы состоят из действующих в цис-положении длинных концевых повторов с упаковочной емкостью до 6-10 т.п.н. для чужеродной последовательности. Минимальные действующие в цис-положении LTR являются достаточными для репликации и упаковки векторов, которые затем используют для интеграции желаемой нуклеиновой кислоты в клетку-мишень для обеспечения постоянной экспрессии. Широко используемые ретровирусные векторы, которые можно использовать в практическом осуществлении изобретения, включают векторы, которые основаны на вирусе лейкоза мыши (MuLV), вирусе лейкоза гиббонов (GaLV), вирусе иммунодефицита обезьян (SIV), вирусе иммунодефицита человека (ВИЧ) и их сочетаниях (см., например, Buchscher et al., (1992) J. Virol. 66: 2731-2739; Johann et al., (1992) J. Virol.66: 1635-1640; Sommnerfelt et al., (1990)) Virol.176: 58-59, Wilson et al., (1998) J. Virol.63: 2374-2378; Miller et al., (1991) J. Virol.65: 2220-2224; PCT/US94/05700).

[340] Также пригодным в практическом осуществлении изобретения является минимальный лентивирусный вектор, не связанный с приматами, такой как лентивирусный вектор, основанный на вирусе инфекционной анемии лошади (EIAV). Векторы могут содержать промотор цитомегаловируса (ЦМВ), направляющий экспрессию гена-мишени. аким образом, изобретение относится к вектору(ам), пригодным в практическом осуществлении изобретения: вирусным векторам, включая ретровирусные векторы и лентивирусные векторы.

[341] В данном варианте осуществления доставка осуществляется через лентивирус. Дозы, например, 10 мкл рекомбинантного лентивируса с титром 1×109 трансдуцирующих единиц (ТЕд)/мл, можно адаптировать или экстраполировать для использования ретровирусного или лентивирусного вектора в настоящем изобретении. Для трансдукции в тканях, таких как головной мозг, необходимо использовать очень маленькие объемы, поэтому препарат вируса концентрируют ультрацентрифугированием. Можно использовать другие способы концентрации, такие как ультрафильтрация или связывание и элюирование из матрицы. В других вариантах осуществления количество вводимого лентивируса может составлять 1×105 или приблизительно 1×105 единиц образования бляшек (БОЕ), 5×105 или приблизительно 5×105 БОЕ, 1×106 или около 1×106 БОЕ, 5×106 или приблизительно 5×106 БОЕ, 1×107 или приблизительно 1×107 БОЕ, 5×107 или приблизительно 5×107 БОЕ, 1×108 или приблизительно 1×108 БОЕ, 5×108 или приблизительно 5×108 БОЕ, 1×109 или приблизительно 1×109 БОЕ, 5×109 или приблизительно 5×109 БОЕ, 1×1010 или приблизительно 1×1010 БОЕ или 5×1010 или приблизительно 5×1010 БОЕ в качестве общей однократной дозы для среднего человека 75 кг или с поправкой на массу и размер, и виды индивидуума. Специалист в данной области может определить подходящую дозу. Подходящие дозы для вируса можно определять эмпирически.

[342] Также пригодным в практическом осуществлении изобретения является вектор аденовируса. Одним из преимуществ является способность рекомбинантных аденовирусов эффективно переносить и экспрессировать рекомбинантные гены в различных клетках и тканях млекопитающих in vitro и in vivo, что приводит к высокой экспрессии переносимых нуклеиновых кислот. Кроме того, способность продуктивно инфицировать покоящиеся клетки расширяет полезность рекомбинантных аденовирусных векторов. Кроме того, высокие уровни экспрессии обеспечивают то, что продукты нуклеиновых кислот будут экспрессироваться на достаточных уровнях, чтобы вызывать иммунный ответ (см., например, патент США № 0729848, включенный в настоящее описание посредством ссылки). Что касается векторов аденовируса, пригодных в практическом осуществлении изобретения, следует упомянуть патент США № 6558080. Используемый аденовирусный вектор можно выбирать из группы, состоящей из векторов Ad5, Ad35, Ad11, C6 и C7. Опубликована последовательность генома аденовируса 5 ("Ad5"). (Chroboczek, J., Bieber, F., and Jacrot, B. (1992) The Sequence of the Genome of Adenovirus Type 5 and Its Comparison with the Genome of Adenovirus Type 2, Virology 186, 280-285; полное содержание которых, таким образом, включено посредством ссылки). Векторы Ad35 описаны в патентах США №6974695, 6913922 и 6869794. Векторы Ad11 описаны в патенте США № 6913922. Аденовирусные векторы C6 описаны в патентах США № 6780407, 6537594, 6309647, 6265189, 6156567, 6090393, 5942235 и 5833975. Векторы C7 описаны в патенте США № 6277558. Также можно использовать аденовирусные векторы, которые являются дефектными по E1 или у которых удален E1, дефектными по E3 или у которых удален E3, и/или дефектными по E4 или у которых удален E4. Определенные аденовирусы с мутациями в области E1 обладают повышенным показателем безопасности, т.к. дефектные по E1 мутанты аденовируса являются дефектными по репликации в непермиссивных клетках, или в крайнем случае являются сильно аттенуированными. Аденовирусы с мутациями в области E3 могут обладать повышенной иммуногенностью в результате нарушения механизма, посредством которого аденовирус подавляет молекулы MHC I класса. Аденовирусы с мутациями E4 может обладать пониженной иммуногенностью аденовирусного вектора вследствие подавление поздней экспрессии гена. Такие векторы могут являться особенно пригодными, когда желательна повторная вакцинация с использованием того же вектор. В соответствии с настоящим изобретением можно использовать аденовирусные векторы, у которых удалены или которые являются мутантными по E1, E3, E4, E1 и E3 и E1 и E4. Кроме того, в соответствии с настоящим изобретением также можно использовать "выпотрошенные" аденовирусные векторы, в которых все вирусные гены удалены. Таким векторам необходим вирус-помощник для их репликации и необходима конкретная линия клеток 293 человека, экспрессирующая E1a и Cre, условие, которое не существует в природной среде. Такие "выпотрошенные" векторы не являются иммуногенными, и, таким образом, векторы можно инокулировать несколько раз для повторной вакцинации. "Выпотрошенные" аденовирусные векторы можно использовать для введения гетерологичных вставок/генов, таких как трансгены по настоящему изобретению, и их можно использовать даже для совместной доставки большого числа гетерологичных вставок/генов. В определенных вариантах осуществления доставку проводят через аденовирус, который может находиться в одной усиленной дозе. В определенных вариантах осуществления аденовирус доставляют посредством многократных доз. В отношении доставки in vivo AAV является более эффективным по сравнению с другими вирусными векторы вследствие низкой токсичности и низкой вероятности возникновения инсерционного мутагенеза, т.к. он не интегрируется в геном хозяина. AAV имеет ограничение упаковки 4,5 или 4,75 т.о. Контракции больше 4,5 или 4,75 т.о. приводят к значительно пониженной продукции вируса. Существует многие промоторы, которые можно использовать направление экспрессии молекулы нуклеиновой кислоты. ITR AAV может служить в качестве промотора и является предпочтительным для устранения потребности в дополнительном промоторном элементе. Для повсеместной экспрессии можно использовать следующие ниже промоторы: CMV, CAG, CBh, PGK, SV40, тяжелые или легкие цепи ферритина и т.д. Для экспрессии в головном мозге можно использовать следующие ниже промоторы: синапсин I для всех нейронов, CaMKII альфа для возбуждаемых нейронов, GAD67 или GAD65, или VGAT для ГАМК-эргических нейронов и т.д. Промоторы, используемые для направления синтезу РНК могут включать: промоторы Pol III, такие как U6 или H1. Использование промотора Pol II и интронную кассету можно применять для экспрессии гидовой РНК (гРНК). Касательно векторов AAV пригодных в практическом осуществлении изобретения стоит упомянуть патенты США № 5658785, 7115391, 7172893, 6953690, 6936466, 6924128, 6893865, 6793926, 6537540, 6475769 и 6258595, и цитируемые в них документа. Что касается AAV, то AAV может представлять собой AAV1, AAV2, AAV5 или любое их сочетание. Можно выбирать AAV в зависимости от клеток-мишеней; например, можно выбирать AAV серотипы 1, 2, 5 или гибридный капсидный AAV1, AAV2, AAV5 или любое их сочетание для направленного воздействия на клетки головного мозга или нервные клетки; и можно выбирать AAV4 для направленного воздействия на ткань сердца. AAV8 является пригодным для доставки в печень. В определенных вариантах осуществления доставку проводят посредством AAV. Дозу можно регулировать для уравновешивания терапевтического положительного эффекта и любых побочных эффектов.

[343] В определенных вариантах осуществления эффективная активация клеточного иммунного ответа на вакцину или иммуногенную композицию против заболевания можно получать экспрессией релевантных антигенов в вакцине или иммуногенной композиции в непатогенном микроорганизме. Известными примерами таких микроорганизмов являются Mycobacterium bovis BCG, Salmonella и Pseudomona (см. патент США № 6,991,797, который полностью включен в настоящее описание посредством ссылки).

[344] В определенных вариантах осуществления в вакцине или иммуногенной композиции против заболевания используют поксвирус. К ним относятся ортопоксвирус, вирус оспы птиц, вирус оспа вакцины, MVA, NYVAC, вирус оспы канарейки, ALVAC, вирус оспы кур, TROVAC и т.д. (См., например, Verardiet al., Hum Vaccin Immunother, 2012 Jul, 8 (7): 961-70, и Moss, Vaccine 2013, 31 (39): 4220-4222). Экспрессирующие векторы поксвируса были описаны в 1982 году и быстро стали широко использоваться для разработки вакцин, а также для исследований во многих областях. Преимущества векторов включают простую конструкцию, способность вмещать большое количество чужеродной ДНК и высокие уровни экспрессии. Информация, касающуюся поксвирусов, которые можно использовать в практическом осуществлении изобретения, такие как подсемейство Chordopoxvirinae поксвирусов (поксвирусы позвоночных), например, ортопоксвирусы и авипоксвирусы, например, вирус оспавакцины (например, штамм Wyeth, штамм WR (например, ATCC® VR-1354), штамм Copenhagen, NYVAC, NYVAC.1, NYVAC.2, MVA, MVA-BN), вирус оспы канареек (например, штамм Wheatley C93, ALVAC), вирус куриной оспы (например, штамм FP9, штамм Webster, TROVAC), вирус оспы голубя, вирус оспы перепелки и вирус оспы енотав числе прочего их синтетические или неприродные рекомбинанты, их использование и способы получения с использованием таких рекомбинантов, можно найти в научной и патентной литературе.

[345] В определенных вариантах осуществления вирус оспавакцины используют в вакцине или иммуногенной композиции против заболевания для экспрессии антигена. (Rolph et al., Recombinant viruses as vaccines and immunological tools. Curr Opin Immunol 9:517-524, 1997). Рекомбинантный вирус оспавакцины способен реплицироваться в цитоплазме инфицированной клетки-хозяина, и, таким образом, представляющий интерес полипептид может индуцировать иммунный ответ. Кроме того, поксвирусы широко использовали в качестве вакцинных векторов или векторов иммуногенной композиции из-за их способности направлено воздействовать на кодируемые антигены для процессирования по пути главного комплекса гистосовместимости I класса посредством прямого инфицирования иммунных клеток, в частности антигенпредставляющих клеток, а также вследствие их способности являться адъювантом.

[346] В определенных вариантах осуществления используют ALVAC в качестве вектора в вакцине или иммуногенной композиции против заболевания. ALVAC является вирусом оспы канареек, который можно модифицировать для экспрессии чужеродных трансгенов, и его широко использовали в качестве способа вакцинации против как прокариотических, так и эукариотических антигенов (Horig H, Lee DS, Conkright W, et al. Phase I clinical trial of a recombinant canarypoxvirus (ALVAC) vaccine expressing human carcinoembryonic antigen and the B7.1 co-stimulatory molecule. Cancer Immunol Immunother 2000;49:504-14; von Mehren M, Arlen P, Tsang KY, et al. Pilot study of a dual gene recombinant avipox vaccine containing both carcinoembryonic antigen (CEA) and B7.1 transgenes in patients with recurrent CEA-expressing adenocarcinomas. Clin Cancer Res 2000;6:2219-28; Musey L, Ding Y, Elizaga M, et al. HIV-1 vaccination administered intramuscularly can induce both systemic and mucosal T cell immunity in HIV-1-uninfected individuals. J Immunol 2003;171:1094-101; Paoletti E. Applications of pox virus vectors to vaccination: an update. Proc Natl Acad Sci U S A 1996;93:11349-53; патент США № 7255862). В клиническом испытании I фазы вирус ALVAC, экспрессирующий опухолевый антиген CEA, обладал отличными показателями безопасности и привел к усилению специфичных к СЕА Т-клеточных ответов у отдельных пациентов; тем не менее, не наблюдали объективные клинические реакции (Marshall JL, Hawkins MJ, Tsang KY, et al. Phase I study in cancer patients of a replication-defective avipox recombinant vaccine that expresses human carcinoembryonic antigen. J Clin Oncol 1999;17:332-7).

[347] В определенных вариантах осуществления модифицированный вирус осповакцины Анкара (MVA) можно использовать в качестве вирусного вектора для антигенной вакцины или иммуногенной композиции. MVA является представителем семейства ортопоксвирусов и образовался приблизительно в результате 570 серийных пассажей фибробластов куриного эмбриона штамма Анкара вируса оспавакцины (CVA) (для обзора см. Mayr, A., et al., Infection 3, 6-14, 1975). В результате проходов этих пассажей получаемый вирус MVA содержит на 31 тысячу нуклеотидов меньше геномной информации по сравнению с CVA и в значительной степени ограничена клеткой-хозяином (Meyer H. et al., J. Gen. Virol., 72, 1031-1038, 1991). MVA характеризуется своей сильной аттенуацией, а именно пониженной вирулентностью или инфекционной способностью, но при этом обладает превосходной иммуногенностью. При тестировании на различных моделях на животных было доказано, что MVA является авирулентным, даже у индивидуумов с иммунодефицитом. Кроме того, MVA-BN®-HER2 является кандидатной иммунотерапией, предназначенной для лечения HER-2-положительного рака молочной железы, и в настоящее время проходит клинические испытания. (Mandl et al., Cancer Immunol Immunother. Jan 2012; 61 (1): 19-29). Способы получения и использования рекомбинантного MVA описаны (например, см. патенты США № 8309098 и 5185146, полностью включенные).

[348] В определенных вариантах осуществления рекомбинантные вирусные частицы вакцины или иммуногенной композиции вводят нуждающимся в этом пациентам.

Связывающие неоантигены пептиды

[349] В определенных вариантах осуществления настоящее изобретение относится к связывающему белку (например, к антителу или его антигенсвязывающему фрагменту) или к Т-клеточному рецептору (TCR) или к химерному антигенному рецептору (CAR), способному связываться с высокой аффинностью с комплексом неоантигенный пептид:лейкоцитарный антиген человеческа (HLA). В определенных вариантах осуществления настоящее изобретение относится к CAR, который способен связываться с высокой аффинностью с неоантигенным пептидом, получаемом из внеклеточного домена белка. В определенных вариантах осуществления специфический к неоантигену связывающий белок или TCR, или CAR, как описано в настоящем описании, включает видов вариантов полипептидов, которые имеют одну или более замен, вставок или делеций аминокислот в нативной аминокислотной последовательности, при условии, что связывающий белок сохраняет или по существу сохраняет свою специфическую функцию связывания. Консервативные замены аминокислот хорошо известны и могут происходить естественным образом или могут быть введены при получении рекомбинантного синтетического белка или TCR. Замены, делеции и добавления аминокислот можно вводить в белок с использованием известных в данной области способов мутагенеза (см., например, Sambrook et al., Molecular Cloning: A Laboratory Manual, 3-е изд., Cold Spring Harbor Laboratory Press, NY, 2001). Направленные на олигонуклеотид сайт-специфичнеские (или сегмент-специфический) способы мутагенеза можно использовать для предоставления измененного полинуклеотида, который имеет определенные кодоны, измененные в соответствии с желаемой заменой, делецией или вставкой. Альтернативно, для получения вариантов иммуногенного полипептида можно использовать способы случайного мутагенеза или насыщающего мутагенеза, такие как мутагенез сканирования аланином, мутагенез с допускающей ошибки полимеразной цепной реакцией и сайт-специфический мутагенез (см., например, Sambrook et al., выше).

[350] Различные критерии, известные специалистам в данной области, указывают, является ли аминокислота, которая замещена в конкретном положении в пептиде или полипептиде, является консервативной (или сходной). Например, сходная аминокислота или консервативная замена аминокислот представляют собой аминокислоту, в которой аминокислотный остаток заменяют аминокислотным остатком со сходной боковой цепью. Сходные аминокислоты можно разделить по следующим категориям: аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин); аминокислоты с кислыми боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота); аминокислоты с незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин, гистидин); аминокислоты с неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан); аминокислоты с бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и аминокислоты с ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан). Пролин, который считается более сложным для классификации, разделяет свойства с аминокислотами, которые имеют алифатические боковые цепи (например, лейцин, валин, изолейцин и аланин). В некоторых случаях можно считать замену глутамина на глутаминовую кислоту или аспарагина на аспарагиновую кислоту сходной заменой, что заключается в том, что глутамин и аспарагин являются амидными производными глутаминовой кислоты и аспарагиновой кислоты, соответственно. Как понятно из уровня техники, "сходство" между двумя полипептидами определяют сравнением аминокислотной последовательности и консервативных замен аминокислот ее полипептида с последовательностью второго полипептида (например, с использованием GENEWORKS, Align, алгоритма BLAST или других алгоритмов, описываем в настоящем описании и практикуемых в данной области).

[351] В определенных вариантах осуществления специфичный к неоантигену связывающий белок, TCR или CAR, способен (а) специфически связываться с комплексом неоантиген:HLA на поверхности клетки независимо или в отсутствие CD8. В определенных вариантах осуществления специфичный к неоантигену связывающий белок является T-клеточным рецептором (TCR), химерный антигенный рецептор или антигенсвязывающий фрагмент TCR, любой из которых может являться химерным, гуманизированным или принадлежать человеку. В дополнительных вариантах осуществления антигенсвязывающий фрагмент TCR содержит одноцепочечный TCR (scTCR).

[352] В определенных вариантах осуществления предоставлена композиция, содержащая специфичный к неоантигену связывающий белок или высокоаффинный рекомбинантный TCR в соответствии с любым из указанных выше вариантов осуществления и фармацевтически приемлемый носитель, разбавитель или эксципиент.

[353] Способы, используемые для выделения и очистки рекомбинантно получаемого растворимого TCR, в качестве примера, могут включать получение супернатантов от подходящих систем клеток-хозяев/векторов, которые секретируют рекомбинантный растворимый TCR в культуральную среду, а затем концентрацию среды с использованием коммерчески доступного фильтра. После концентрации концентрат можно наносить на одну подходящую матрицу очистки или на ряд подходящих матриц, таких как аффинная матрица или ионообменная смола. Для дальнейшей очистки рекомбинантного полипептида можно использовать один или более этапов обращенно-фазной ВЭЖХ. Эти способы очистки также можно применять при выделении иммуногена из его естественной среды. Способы для крупномасштабного производства одного или более выделенных/рекомбинантных растворимых TCR, описываемых в настоящем описании, включают культивирование клеток с подпиткой, за которой наблюдают и контролируют для поддержания соответствующих условий культивирования. Очистку растворимого TCR может быть осуществлена в соответствии со способами, можно проводить способами, описываемыми в настоящем описании и известными в данной области.

III. Иммуногенные и вакцинные композиции

[354] В определенных вариантах осуществления настоящее изобретение относится к иммуногенной композиции, например, вакцинной композиции, способной вызывать специфичный к неоантигену ответ (например, гуморальный или клеточноопосредованный иммунный ответ). В определенных вариантах осуществления иммуногенная композиция содержит терапевтические средства на основе неоантигена (например, пептиды, полинуклеотиды, TCR, CAR, клетки, содержащие TCR или CAR, дендритную клетку, содержащую полипептид, дендритную клетку, содержащую полинуклеотид, антитело и т.д.), описываемые в настоящем описании, соответствующего опухолеспецифическому неоантигену, идентифицированному в настоящем описании.

[355] В определенных вариантах осуществления иммуногенные пептиды идентифицируют от одного или более индивидуумов с заболеванием или состоянием. В определенных вариантах осуществления иммуногенные пептиды являются специфическими для одного или более индивидуумов с заболеванием или состоянием. В определенных вариантах осуществления иммуногенные пептиды могут связываться с HLA, который совпадает с гаплотипом HLA одного или более индивидуумов с заболеванием или состоянием.

[356] Специалист в данной области сможет выбирать неоантигенные терапевтические средства посредством тестирования, например, получения Т-клеток in vitro, а также их эффективности и общего присутствия, пролиферации, аффинности и размножения определенных Т-клеток для определенных пептиды и функциональность Т-клеток, например путем анализа продукции IFN-γ или уничтожения опухоли Т-клетками. Затем наиболее эффективные пептиды можно объединять в виде иммуногенной композиции.

[357] В определенных вариантах осуществления настоящего изобретения различные неоантигенные пептиды и/или полипептиды выбраны так, что одна иммуногенная композиция содержит неоантигенные пептиды и/или полипептиды, способные связываться с различными молекулами МНС, такими как другая молекула МНС I класса. В определенных вариантах осуществления иммуногенная композиция содержит неоантигенные пептиды и/или полипептиды, способные связываться с наиболее часто встречающимися молекулами МНС I класса. Таким образом, описываемые в настоящем описании иммуногенные композиции содержат различные пептиды, способные связываться по меньшей мере с 2, по меньшей мере с 3 или по меньшей мере с 4 молекулами МНС I класса или II класса.

[358] В определенных вариантах осуществления иммуногенная композиция, описываемая в настоящем описании, способна индуцировать специфический ответ цитотоксических Т-клеток, специфический ответ хелперных Т-клеток или ответ В-клеток.

[359] В определенных вариантах осуществления иммуногенная композиция, описываемая в настоящем описании, может дополнительно содержать адъювант и/или носитель. Примеры пригодных адъювантов и носителей приведены ниже. Полипептиды и/или полинуклеотиды в композиции могут быть связаны с носителем, таким как, например, белок или антигенпрезентирующая клетка, такая как, например, дендритная клетка (DC), способная презентировать пептид Т-клетке или В-клетке. В дополнительных вариантах осуществления связывающие DC пептиды используют в качестве носителей для направленной доставки неоантигенных пептидов и полинуклеотидов, кодирующих неоантигенные пептиды, в дендритные клетки (Sioud et al., FASEB J 27: 3272-3283 (2013)).

[360] В вариантах осуществления неоантигенные полипептиды или полинуклеотиды можно предоставлять в виде антигенпрезентирующих клеток (например, дендритных клеток), содержащих такие полипептиды или полинуклеотиды. В других вариантах осуществления такие антигенпрезентирующие клетки используются для стимуляции Т-клеток для применения у пациентов.

[361] В определенных вариантах осуществления антигенпрезентирующие клетки являются дендритными клетками. В родственных вариантах осуществления дендритные клетки являются аутологичными, которые примируют неоантигенным пептидом или нуклеиновой кислотой. Неоантигенным пептидом может представлять собой любой подходящий пептид, который приводит к соответствующему Т-клеточному ответу. Т-клеточная терапия с использованием аутологичных дендритных клеток, нагруженных пептидами из опухолеассоциированного антигена, описана у Murphy et al. (1996) The Prostate 29, 371-380 and Tjua et al. (1997) The Prostate 32, 272-278. В определенных вариантах осуществления Т-клетка представляет собой CTL. В определенных вариантах осуществления Т-клетка представляет собой HTL.

[362] Таким образом, в одном варианте осуществления настоящего изобретения иммуногенная композиция, содержащая по меньшей мере одну антигенпредставляющую клетку (например, дендритную клетку), которую примируют или нагружают одним или более неоантигенными полипептидами или полинуклеотидами, описываемыми в настоящем описании. В вариантах осуществления такие APC являются аутологичными (например, аутологичными дендритными клетками). Альтернативно, мононуклеарные клетки периферической крови (РВМС), выделяемые у пациента, можно нагружать неоантигенными пептидами или полинуклеотидами ex vivo. В соответствующих вариантах осуществления такие APC или PBMC обратно инъецируют пациенту.

[363] Полинуклеотид может представлять собой любой подходящий полинуклеотид, который способен трансдуцировать дендритную клетку, таким образом, приводя к презентации неоантигенного пептида и индукции иммунитета. В определенных вариантах осуществления полинуклеотид может представлять собой голую ДНК, которая поглощается клетками посредством пассивной нагрузкой. В другом варианте осуществления полинуклеотид является частью средства доставки, например, липосомы, вирусной частицы, плазмиды или экспрессирующего вектора. В другом варианте осуществления полинуклеотид доставляют посредством безвекторной системы доставки, например, высокоэффективной электропорацией и высокоскоростной клеточной деформацией). В вариантах осуществления такие антигенпрезентирующие клетки (АРС) (например, дендритные клетки) или мононуклеарные клетки периферической крови (РВМС) используют для стимуляции Т-клетки (например, аутологичной Т-клетки). В родственных вариантах осуществления Т-клетка представляет собой CTL. В других соответствующих вариантах осуществления Т-клетка является HTL. Такие Т-клетки затем вводят пациенту. В определенных вариантах осуществления CTL вводят пациенту. В определенных вариантах осуществления HTL вводят пациенту. В определенных вариантах осуществления CTL и HTL вводят пациенту. Введение любого терапевтического средства можно проводить одновременно или последовательно и в любом порядке.

[364] Фармацевтические композиции (например, иммуногенные композиции), описываемые в настоящем описании для терапевтического лечения, предназначены для парентерального, местного, назального, перорального или локального введения. В определенных вариантах осуществления фармацевтические композиции, описываемые в настоящем описании, вводят парентерально, например, внутривенно, подкожно, внутрикожно или внутримышечно. В вариантах осуществления композицию можно вводить внутримышечно. Композиции можно вводить в месте хирургического удаления, чтобы индуцировать локальный иммунный ответ на опухоль. В определенных вариантах осуществления, описываемых в настоящем описании, представлены композиции для парентерального введения, которые содержат раствор неоантигенных пептидов и иммуногенные композиции растворяют или суспендируют в приемлемом носителе, например, водном носителе. Можно использовать различные водные носители, например, воду, забуференную воду, 0,9% физиологический раствор, 0,3% глицин, гиалуроновую кислоту и т.п. Эти композиции можно стерилизовать общепринят хорошо известными способами стерилизации или можно стерильно фильтровать. Получаемые водные растворы можно упаковывать для применения в том виде, в котором они есть или лиофилизированном, где лиофилизированного препарата объединяют со стерильным раствором перед введением. Композиции могут содержать фармацевтически приемлемые вспомогательные вещества по мере необходимости для приближения к физиологическим условиям, такие как регулирующие рН и буферные средства, регулирующие тоничность средства, смачивающие агенты и т.п., например, ацетат натрия, лактат натрия, хлорид натрия, хлорид калия, хлорид кальция, монолаурат сорбитана, олеат триэтаноламина и т.д.

[365] Концентрация неоантигенных пептидов и полинуклеотидов, описываемых в настоящем описании, в фармацевтических составах, может варьироваться в широких пределах, т.е. от менее чем приблизительно 0,1%, как правило, или по меньшей мере от 2% до 20-50% или более по массе, и их будут выбирать в зависимости от объемов жидкости, вязкости и т. д. в соответствии с выбранным конкретным способом введения.

[366] Неоантигенные пептиды и полинуклеотиды, описываемые в настоящем описании, также можно вводить посредством липосом, которые направляют пептиды в конкретную клеточную ткань, такую как лимфоидная ткань. Липосомы также являются пригодными для увеличения времени полужизни пептидов. Липосомы включают эмульсии, пены, мицеллы, нерастворимые монослои, жидкие кристаллы, фосфолипидные дисперсии, ламенарные слои и т.д. В этих препаратах пептид, который должен быть доставлен, вводят как часть липосомы, отдельно или в сочетании с молекулой, которая связывается, например, с рецептором, преобладающим среди лимфоидных клеток, таких как моноклональные антитела, которые связываются с антигеном DEC205, или с другими терапевтическими или иммуногенными композициями. Таким образом, липосомы, заполненные желаемым пептидом или полинуклеотидом, описываемым в настоящем описании, можно направлять в участок лимфоидных клеток, где затем липосомы доставляют выбранные терапевтические/иммуногенные полипептидные/полинуклеотидные композиции. Липосомы можно формировать из стандартных липидов, образующих везикулы, которые, как правило, включают нейтральные и отрицательно заряженные фосфолипиды и стерол, например, холестерин. Выбор липидов, как правило, осуществляется при рассмотрении, например, размера липосом, кислотной лабильности и стабильности липосом в кровяном потоке. Для получения липосом доступны различные способы, как описано, например, у Szoka et al., Ann. Rev. Biophys. Bioeng. 9; 467 (1980), патентах США № 4235871, 4501728, 4501728, 4837028 и 5019369.

[367] Для направленности на иммунные клетки неоантигенные полипептиды или полинуклеотиды необходимо заключать в липосому для детерминант клеточной поверхности желаемых клеток иммунной системы. Липосомную суспензию, содержащую пептид, можно вводить внутривенно, локально, местно и т.д. в дозе, которая варьируется в зависимости, в числе прочего от способа введения, доставляемых полипептида или полинуклеотида и стадии заболевания, подлежащего лечению.

[368] В определенных вариантах осуществления неоантигенные полипептиды и полинуклеотиды направлены на дендритные клетки. В определенных вариантах осуществления неоантигенные полипептиды и полинуклеотиды направлены на дендритнын клетки с использованием маркеров DEC205, XCR1, CD197, CD80, CD86, CD123, CD209, CD273, CD283, CD289, CD184, CD85h, CD85j, CD85k, CD85d, CD85g, CD85a, рецептор TSLP, Clec9a или CD1a.

[369] Для твердых композиций можно использовать общепринятые или на основе наночастиц нетоксичные твердые носители, которые включают, например, маннит, лактоз, крахмал, стеарат магния, сахарин натрия, тальк, целлюлозу, глюкозу, сахарозу, карбоната магния фармацевтической степени чистоты и т.п. Для перорального введения фармацевтически приемлемую нетоксичную композицию получают введением любого из обычно применяемых эксципиентов, таких как ранее перечисленные носители, и, как правило, 10-95% активного ингредиента, т.е. одного или более неоантигенных полипептидов или полинуклеотидов, описываемых в настоящем описании в концентрации 25%-75%.

[370] Для аэрозольного введения неоантигенные полипептиды или полинуклеотиды можно поставлять в высокодисперсной форме вместе с поверхностно-активным веществом и пропеллентом. Представителями таких средств являются сложные эфиры или неполные эфиры жирных кислот, содержащие от 6 до 22 атомов углерода, таких как капроновая, октановая, лауриновая, пальмитиновая, стеариновая, линолевая, линоленовая, олестериновая и олеиновая кислоты с алифатическим многоатомным спиртом или его циклическим ангидридом. Можно использовать смешанные сложные эфиры, такие как смешанные или природные глицериды. Поверхностно-активное вещество может составлять 0,1-20% по массе композиции или 0,25-5%. Баланс композиции может быть пропеллентом. Также по желанию можно вводить носитель, как, например, с лецитином для интраназальной доставки.

[371] Дополнительные способы доставки неоантигенных полинуклеотидов, описываемых в настоящем описании, также известны в данной области. Например, нуклеиновую кислоту можно доставлять непосредственно как "голую ДНК". Такой подход описан, например, у Wolff et al., Science 247: 1465-1468 (1990), а также в патентах США № 5580859 и 5589466. Нуклеиновые кислоты также можно вводить с использованием баллистической доставки, как описано, например, в патенте США № 5204253. Можно вводить частицы, состоящие только из ДНК. Альтернативно, ДНК можно прикреплять к частицам, таким как частицы золота.

[372] Для в терапевтических или иммунизационных целях пациенту также можно вводить иРНК, кодирующую неоантигенные пептиды или связывающие пептид средства. В определенных вариантах осуществления иРНК представляет собой самоамплифицирующуюся РНК. В дополнительном варианте осуществления самоамплифицирующуюся РНК является частью синтетического состава липидной наночастицы (Geall et al., Proc Natl Acad Sci U S A. 109: 14604-14609 (2012)).

[373] Нуклеиновые кислоты также можно доставлять в комплекс, образованным с катионными соединениями, такими как катионные липиды. Опосредованные липидами способы доставки гена описаны, например, в WO 96/18372, WO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6 (7): 682-691 (1988); патенте США № 5279833; WO 91/06309 и Felgner et al., Proc. Natl. Acad. Sci. USA 84: 7413-7414 (1987).

[374] Неоантигенные пептиды и полипептиды, описываемые в настоящем описании, также можно экспрессировать аттенуированными вирусами, такими как вирус оспавакцины или вирус оспы кур. Этот подход включает использование вируса осповакцины в качестве вектора для экспрессии нуклеотидных последовательностей, которые кодируют пептид, описываемый в настоящем описании. При введении остро или хронически инфицированному хозяину или неинфицированному хозяину рекомбинантный вирус оспавакцины экспрессирует иммуногенный пептид и, таким образом, вызывает ответ CTL у хозяина. Векторы на основе оспавакцины и способы, пригодные в протоколах иммунизации, описаны, например, в патенте США № 4722848. Другим вектором является BCG (Bacille Calmette Guerin). BCG-векторы описаны у Stover et al. (Nature 351: 456-460 (1991)). Специалистам в данной области техники из описания, предоставленного в настоящем описании будет понятно, что широкий спектр других векторов, пригодных для терапевтического введения или иммунизации описываемых в настоящем описании пептидов, будет очевидным.

[375] Адъюванты представляют собой любое вещество, добавка которого в иммуногенную композицию увеличивает или иным образом модифицирует иммунный ответ на терапевтическое средство. Носителями являются каркасные структуры, например, полипептид или полисахарид, к которым можно присоединять неоантигенный полипептид или полинуклеотид. Необязательно, адъюванты конъюгированы ковалентно или нековалентно с полипептидами или полинуклеотидами, описываемыми в настоящем описании.

[376] Способность адъюванта увеличивать иммунный ответ на антиген, как правило, проявляется в значительном увеличении иммуноопосредованной реакции или уменьшении симптомов заболевания. Например, увеличение гуморального иммунитета может проявляться в значительном увеличении титра антител, индуцированных против антигена, и увеличение активности Т-клеток может проявляться в повышенной клеточной пролиферации или клеточной цитотоксичности, или секреции цитокинов. Адъювант также может изменять иммунный ответ, например, путем изменения в первую очередь гуморального ответа или ответа Т-хелперов 2 на преимущественно клеточный или ответ Т-хелперов 1.

[377] Подходящие адъюванты известны в данной области (см., WO 2015/095811) и в качестве неограничивающих примеров включают поли(I:C), поли-ICLC, агонист STING, 1018 ISS, соли алюминия, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, имихимод, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, JuvImmune, LipoVac, MF59, монофосфориллипида A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTel®. векторной системы, PLG микрочастицы, резиквимод, SRL172, виросом и других вирусоподобных частиц, YF-17D, VEGF-Trap, R848, бета-глюкана, Pam3Cys, Pam3CSK4, Aquila's стимунола QS21 (Aquila Biotech, Worcester, Mass., USA), которые получают из сапонина, микобактериальных экстрактов и синтетических миметиков бактериальной клеточной стенки и дрпугих фирменных адъювантов, таких как Ribi's Detox. Quil или Superfos. Адъюванты также включают неполный адъювант Фрейнда или GM-CSF. Ранее были раскрыты некоторые иммунологические адъюванты (например, MF59), специфические для дендритных клеток, а также их получение (Dupuis M, et al., Клетка Immunol. 1998; 186(1):18-27; Allison A C; Dev Biol Stand. 1998; 92:3-11) (Mosca et al. Frontiers in Bioscience, 2007; 12:4050-4060) (Gamvrellis et al. Immunol & Cell Biol. 2004; 82: 506-516). Кроме того, можено использовать цитокины. Некоторые цитокины напрямую были связаны с влиянием на миграцию дендритных клеток в лимфоидную ткань (например, TNF-альфа), повышением созревания дендритных клеток в эффективные антигенпрезентирующие клетки для T-лиьфоцитов (например, GM-CSF, PGE1, PGE2, IL-1, IL-1b, IL-4, IL-6 и CD40L) (патент США № 5849589 полностью включенн в настоящее описание посредством ссылки) и проявлением себя в качестве иммуноадъювантов (например, IL-12) (Gabrilovich D I, et al., J Immunother Emphasis Tumor Immunol. 1996 (6):414-418).

[378] Также сообщалось, что иммуностимулирующие олигонуклеотиды CpG усиливают действие адъювантов в условиях вакцины. Практически, олигонуклеотиды CpG действуют путем активации врожденной (неадаптивной) иммунной системы через Toll-подобные рецепторы (TLR), в основном TLR9. CpG-активированная активация TLR9 повышает антигенспецифический гуморальный и клеточные ответы на широкий спектр антигенов, включая пептидные или белковые антигены, живые или убитые вирусы, иммуногенные фармацевтические композиции дендритных клеток, аутологичные клеточные иммуногенные композиции и полисахаридные конъюгаты как в профилактических, так и в терапевтических иммуногенных фармацевтических композициях. Следует отметить, что он усиливает созревание и дифференцировку дендритных клеток, что приводит к усиленной активации клеток TH1 и образование сильных цитотоксических Т-лимфоцитов (CTL), даже в отсутствие помощи CD4 T-клеток. Смещение TH1, индуцированное стимуляцией TLR9, сохраняется даже в присутствии адъювантов, таких как квасцы или неполный адъювант Фрейнда (IFA), которые как правило способствуют смещению TH2. CpG-олигонуклеотиды проявляют еще большее адъювантное действие при формулировании или совместном введении с другими адъювантами или в составах, таких как микрочастицы, наночастицы, липидные эмульсии или аналогичные составы, которые являются особенно необходимыми для индукции сильного ответа, когда антиген является относительно слабым. Они также ускоряют иммунный ответ и позволяют снизить дозы антигена с сопоставимыми ответами антител на полную дозу иммуногенной фармацевтической композиции без CpG в некоторых экспериментах (Arthur M. Krieg, Nature Reviews, Drug Discovery, 5, June 2006, 471- 484). В патенте США № 6406705 В1 описано совместное использование олигонуклеотидов CpG, адъювантов без нуклеиновой кислоты и антигена для индукции антигенспецифического иммунного ответа. Коммерчески доступный антагонист CpG TLR9 представляет собой dSLIM (Иммуномодулятор с двойной структурой стебель-петля) от Mologen (Berlin, GERMANY), который является компонентом фармацевтической композиции, описываемой в настоящем описании. Также можно использовать другие связывающие TLR молекулы, такие как связывающий РНК TLR 7, TLR 8 и/или TLR 9.

[379] Другие примеры пригодных адъювантов включают, но не ограничиваются ими, химически модифицированные CpG (например, CpR, Idera), поли(I:C) (например, поли:CI2U), не-CpG бактериальную ДНК или РНК, ssRNA40 для TLR8, а также иммуноактивные низкомолекулярные соединения и антитела, такие как циклофосфамид, сунитиниб, бевацизумаб, целебрекс, NCX-4016, силденафил, тадалафил, варденафил, сорафиниб, XL-999, CP-547632, пазопаниб, ZD2171, AZD2171, ипилимумаб, тремелимумаба и SC58175, которые могут действовать терапевтически и/или как адъювант. Специалист в данной области может легко определять без излишнего экспериментирования количество и концентрацию адъювантов и добавок, пригодных в контексте настоящего изобретения. Дополнительные адъюванты включают колониестимулирующие факторы, такие как гранулоцитарный макрофагальный стимулятор колонии (GM-CSF, Sargramostim).

[380] В определенных вариантах осуществления иммуногенная композиция по настоящему изобретению может содержать более одного другого адъюванта. Кроме того, изобретение относится к терапевтической композиции, содержащей любое адъювантное вещество, включающее любое из указанных выше веществ или их сочетания. Такой неоантигенный терапевтический (например, гуморальный или клеточно-опосредованный иммунный ответ) также предусмотрен. В определенных вариантах осуществления иммуногенная композиция содержит неоантигенные терапевтические средства (например, пептиды, полинуклеотиды, TCR, CAR, клетки, содержащие TCR или CAR, полипептид, содержащий дендритные клетки, дендритную клетку, содержащую полинуклеотид, антитело и т.д.), и адъювант можно вводить раздельно в любую подходящую последовательность.

[381] Носитель может присутствовать независимо от адъюванта. Функция носителя может, например, заключаться в увеличении молекулярной массы конкретного мутанта с целью повышения его активности или иммуногенности, в обеспечении стабильности, повышения биологической активности или увеличения времени полувыведения из сыворотки. Кроме того, носитель может способствовать презентации пептидов Т-клеткам. Носителем может представлять собой любой подходящий носитель, известный специалисту в данной области, например, белок или представляющая антиген клетка. Белок-носитель может представлять собой, но не ограничивается ими, гемоцианин морского блюдца, белками сыворотки, такими как трансферрин, бычий сывороточный альбумин, сывороточный альбумин человека, тиреоглобулин или овальбумин, иммуноглобулины или гормоны, такие как инсулин или пальмитиновая кислота. В определенных вариантах осуществления носитель содержит домен типа фиброз человека типа III (Koide et al. Methods Enzymol, 2012; 503: 135-56). Для иммунизации людей носитель должен представлять собой физиологически приемлемый носителем, приемлемый для людей и безопасный. Однако столбнячный токсин и/или дифтерийный анатоксин являются подходящими носителями В определенных вариантах осуществления изобретения. Альтернативно, носитель может представлять собой декстраны, например, сефарозу.

[382] В определенных вариантах осуществления полипептиды можно синтезировать как многосвязные пептиды в качестве альтернативы связыванию полипептида с носителем для повышения иммуногенности. Такие молекулы также известны как множественные антигенные пептиды (MAPS).

[383] Неоантигены, которые индуцируют иммунный ответ, можно использовать в качестве композиции в сочетании с приемлемым носителем или эксципиентом. Такие композиции являются пригодными для анализа in vitro или in vivo или для введения индивидууму in vivo или ex vivo для лечения индивидуума с заболеванием.

[384] Таким образом, в дополнение к активному ингредиенту фармацевтические композиции могут содержать фармацевтически приемлемый эксципиент, носитель, буфер, стабилизатор или другие вещества, хорошо известные специалистам в данной области. Такие вещества должны являться нетоксичными и не должны влиять на эффективность активного ингредиента. Точный характер носителя или другого материала будет зависеть от пути введения.

[385] Фармацевтические составы, содержащие представляющий интерес белок, например, неоантиген, описываемый в настоящем описании, можно получать для хранения путем смешивания неоантигена с желаемой степенью чистоты с необязательными физиологически приемлемыми носителями, эксципиентами или стабилизаторами (Remington's Pharmaceutical Sciences 16th edition, Oslo, A. Ed. (1980)), в форме лиофилизированных составов или водных растворов. Приемлемыми носителями, эксципиентами или стабилизаторами являются такими, которые являются нетоксичными для реципиентов в используемых дозировках и концентрациях и включают буферы, такие как фосфатный, цитратный и другие органические кислоты; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (такие как октадецилдиметилбензил хлорид аммония, хлорид гексаметония, хлорид бензалкония, хлорид бензетония, фенол, бутиловый или бензиловый спирт, алкилпарабены, такие как метилпарабен или пропилпарабен, катехол, резорцин, циклогексанол, 3-пентанол и м-крезол); низкомолекулярные (менее 10 остатков) полипептиды; белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин или лизин; моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатирующие средства, такие как EDTA; сахара, такие как сахароза, маннит, трегалоза или сорбит; солеобразующие противоионы, такие как натрия; комплексные соединения с металлами (например, Zn-белковые комплексы), и/или неионные поверхностно-активные вещества, такие как TWEEN®, PLURONICS® или полиэтиленгликоль (PEG).

[386] Приемлемые носители являются физиологически приемлемыми для пациента, которому их вводят, и сохраняют терапевтические свойства соединений с/в которые их вводят. Приемлемые носители и их составы, как правило, описаны, например, в Remington Pharmaceutical Sciences (18-е издание, изд. A. Gennaro, Mack Publishing Co., Easton, PA, 1990). Один иллюстративный носитель представляет собой физиологический раствор. Фармацевтически приемлемый носитель представляет собой фармацевтически приемлемое вещество, композицию или носитель, такой как жидкий или твердый наполнитель, разбавитель, эксципиент, растворитель или инкапсулирующий материал, предназначенный для переноса или транспортировки исследуемых соединений от участка введения одного органа или части организма в другой орган или часть организма или в системе анализа in vitro. Приемлемые носители являются совместимыми с другими ингредиентами состава и не наносят вред индивидууму, которому их вводят. Также приемлемый носитель не должен изменять специфическую активность неоантигенов.

[387] В одном из аспектов в настоящем описании предоставлены фармацевтически приемлемые или физиологически приемлемые композиции, содержащие растворители (водные или неводные), растворы, эмульсии, диспергирующие среды, покрытия, изотонические и способствующие всасыванию или замедляющие всасывание средства, совместимые с фармацевтическим введением. Таким образом, фармацевтические композиции или фармацевтические составы относятся к композиции, подходящей для фармацевтического использования у индивидуума. Фармацевтические композиции и составы содержат количество неоантигена (или полинуклеотида, кодирующего неоантиген) и фармацевтически или физиологически приемлемый носитель. Композиции можно формулировать так, чтобы они являлись совместимыми с конкретным путем введения (т.е. системным или локальным). Таким образом, композиции включают носители, разбавители или эксципиенты, подходящие для введения различными путями.

[388] В определенных вариантах осуществления композиция дополнительно содержит приемлемую добавку для улучшения стабильности неоантигена в композиции и/или для контроля скорости высвобождения композиции. Приемлемые добавки не изменяют специфическую активность неоантигенов. Иллюстративные приемлемые добавки включают, но не ограничиваются ими, сахар, такой как маннит, сорбит, глюкоза, ксилит, трегалоза, сорбоза, сахароза, галактоза, декстран, декстроза, фруктоза, лактоза и их смеси. Приемлемые добавки можно комбинировать с приемлемыми носителями и/или эксципиентами, такими как декстроза. Альтернативно, иллюстративные приемлемые добавки включают, но не ограничиваются ими, поверхностно-активное вещество, такое как полисорбат 20 или полисорбат 80, для повышения стабильности пептида и уменьшения гелеобразования раствора. Поверхностно-активное вещество можно добавлять к композиции в количестве от 0,01% до 5% раствора. Добавление таких приемлемых добавок увеличивает стабильность и время полужизни композиции при хранении.

[389] Фармацевтическую композицию можно вводить, например, путем инъекции. Композиции для инъекций включают водные растворы (в случае вдорастворимых) или дисперсии и стерильные порошки для немедленного получения стерильных растворов для инъекций или дисперсии. Для внутривенного введения подходящие носители включают физиологический раствор, бактериостатическую воду или забуференный фосфатом физиологический раствор (PBS). Носитель может представлять собой растворителем или диспергирующей средой, содержащей, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль и т.д.) и подходящие их смеси. Жидкое состояние можно поддерживать, например, путем использования покрытия, такого как лецитин, путем поддержания требуемого размера частиц в случае дисперсии и с использованием поверхностно-активных веществ. Антибактериальные и противогрибковые средства включают, например, парабены, хлорбутанол, фенол, аскорбиновую кислоту и тимеросал. В композиции можно включать средства придания изотоничности, например, сахара, полиспирты, такие как манитол, сорбит и хлорид натрия. Получаемые растворы можно упаковывать для применения в том виде, в каком они есть или лиофилизированном, затем лиофилизированный препарат можно объединять со стерильным раствором перед введением. Для внутривенного введения, инъекции или инъекции на участке поражения активный ингредиент находится в форме парентерально приемлемого водного раствора, который не содержит пирогенов и имеет подходящий рН, изотоничность и стабильность. Специалистам в данной области способны подготавливать подходящие растворы, с использованием, например, изотонических носителей, таких как инъекция хлорида натрия, инъекция раствора Рингера, инъекция лактированного раствора Рингера. При необходимости можно вводить консерванты, стабилизаторы, буферы, антиоксиданты и/или другие добавки. Стерильные растворы для инъекций можно получать введением активного ингредиента в требуемом количестве в подходящем растворителе с одним или комбинацией ингредиентов, перечисленных выше, с последующей стерилизацией фильтрованием. Как правило, дисперсии получают введением активного ингредиента в стерильный носитель, который содержит основную дисперсионную среду и требуемые другие ингредиенты из перечисленных выше. В случае стерильных порошков для получения стерильных растворов для инъекций предпочтительными способами получения являются вакуумная сушка и сушка вымораживанием, которая позволяет получать порошок активного ингредиента плюс любой дополнительный желаемый ингредиент из его ранее стерильно-отфильтрованного раствора.

[390] Композиции можно традиционно вводить внутривенно, таким образом, как, например, посредством инъекции стандартной дозы. Для инъекции активный ингредиент может находиться в форме парентерально приемлемого водного раствора, который по существу не содержит пирогенов и имеет подходящие значения рН, изотоничности и стабильности. Можно подготавливать подходящие растворы, используя, например, изотонические носители, такие как инъекция хлорида натрия, инъекция раствора Рингера, инъекция лактированного раствора Рингера. При необходимости можно вводить консерванты, стабилизаторы, буферы, антиоксиданты и/или другие добавки. Кроме того, композиции можно вводить путем аэрозолизации.

[391] В определенных вариантах осуществления композицию лиофилизируют, например, для увеличения срока годности при хранении. Когда композиции предусматривают для применения в лекарственных средствах или в любом из способов, представленных в настоящем описании, предусмотрено, что композиция может по существу не содержать пирогенов, таким образом, что композиция не будет вызывать воспалительную реакцию или небезопасную аллергическую реакцию при введении являющемуся человеком пациенту. Испытание композиций на пирогены и получение композиций, по существу не содержащих пирогены, хорошо поняты специалисту в данной области, и их можно получать с использованием коммерчески доступных наборов.

[392] Приемлемые носители могут содержать соединение, которое стабилизирует, увеличивает или замедляет поглощение или увеличивает или замедляет клиренс. Такие соединения включают, например, углеводы, такие как глюкоза, сахароза или декстраны; низкомолекулярные белки; композиции, которые уменьшают клиренс или гидролиз пептидов; или эксципиенты или другие стабилизаторы и/или буферы. Средства, которые замедляют всасывание, включают, например, моностеарат алюминия и желатин. Также можно использовать моющие средства могут для стабилизации или увеличения или уменьшения поглощения фармацевтической композиции, включая липосомальные носители. Для защиты от расщепления соединение можно подвергать взаимодействию с образованием комплекса с композицией, чтобы сделать его устойчивым к кислому и ферментативному гидролизу, или соединение может входить в состав комплекса в подходящем устойчивом носителе, таком как липосома.

[393] Композиции можно вводить способом, совместимым с дозируемым составом и в терапевтически эффективном количестве. Величина, подлежащая введению, зависит от подлежащего лечению индивидуума, способности иммунной системы индивидуума использовать активный ингредиент и желаемой степени требуемой способности связывания. Точные количества активного ингредиента, которые необходимо вводить, зависят от суждения практикующего врача и характерны для каждого индивидуума. Подходящие режимы для начального введения и вторичные инъекции антигена также являются переменными, но типичны для первоначального введения, за которым следуют повторные дозы с интервалами через один или более часов путем последующей инъекции или другого введения. Альтернативно, предполагают непрерывные внутривенные инфузии являются достаточными для поддержания концентрации в крови.

[394] Иммуногенные фармацевтические композиции на основе пептидов можно формулировать с использованием любой из хорошо известных техник, носителей и эксципиентов, как является подходящим и понятным в данной области. Полипептиды могут представлять собой смесь из нескольких полипептидов, содержащих одну и ту же последовательность, или смесь из нескольких копий разных полипептидов. Пептиды можно модифицировать, например, посредством липидации или присоединения к белку-носителю. Липидация может представлять собой ковалентное присоединение липидной группы к полипептиду. Липидированные пептиды или липидированные полипептиды могут стабилизировать структуры и могут повышать эффективность лечения.

[395] Липидацию можно разделить на несколько различных типов, таких как N-миристоилирование, пальмитоилирование, добавление GPI-якоря, пренилирование и несколько дополнительных типов модификаций. N-миристоилирование представляет собой ковалентное присоединение миристата, насыщенной C14 кислоты, к остатку глицина. Пальмитоилирование представляет собой тиоэфирную связь длинноцепочечных жирных кислот (С16) с остатками цистеина. Добавление GPI-якоря представляет собой связывание гликозил-фосфатидилинозитола (GPI) через амидную связь. Пренилирование представляет собой тиоэфирную связь изопреноидного липида (например, фарнезил (С-15), геранилгеранил (С-20)) с остатками цистеина. Дополнительные типы модификаций могут включать присоединение S-диацилглицерина атомом серы цистеинов, конъюгацию O-октаноила через сериновые или треониновые остатки, конъюгацию S-архаеола с остатками цистеина и присоединение холестерина.

[396] Жирные кислоты для получения липидированных пептидов могут включать C230насыщенные, мононенасыщенные или полиненасыщенные жирные ацильные группы. Иллюстративные жирные кислоты могут содержать пальмитоильную, миристоильную, стеароильную и деканоильную группы. В некоторых случаях липидный фрагмент, который обладает адъювантным свойством, присоединяют к представляющему интерес полипептиду, чтобы вызывать или усиливать иммуногенность в отсутствие внешнего адъюванта. Липидированный пептид или липопептид может обозначаться как самоадъювантный липопептид. Любая из жирных кислот, описанных выше и в других местах в настоящем описании, может вызывать или усиливать иммуногенность представляющего интерес полипептида. Жирная кислота, которая может вызывать или усиливать иммуногенность, может содержать пальмитоильную, миристоильную, стеароильную, лауроильную, октаноильную и деканоильную группы.

[397] Полипептиды, так как голые пептиды или липидированные пептиды можно вводить в липосому. В некоторых случаях, липидированные пептиды можно вводить в липосому. Например, липидная часть липидированного пептида может спонтанно встраиваться в липидный бислой липосомы. Таким образом, липопептид можно презентировать на "поверхности" липосомы.

[398] Иллюстративные липосомы, подходящие для включения в составы, включают, но не ограничиваются ими, многослойные везикулы (MLV), олиголамеллярные везикулы (OLV), однослойные везикулы (UV), небольшие однослойные везикулы (SUV), однослойные везикулы среднего размера (MUV), большие однослойные везикулы (LUV), гигантские однослойные везикулы (GUV), мультивезикулярные везикулы (MVV), одиночные или олиголамеллярные везикулы, получаемые способом обратного фазового испарения (REV), многослойные везикулы, получаемые способом обратного фазового испарения (MLV-REV), стабильные плюриламеллярные везикулы (SPLV), замороженные и размороженные MLV (FATMLV), получаемые везикулы (VET), везикулы, получаемые посредством пресс Френча (FPV), везикулы, получаемые посредством слияния (FUV), везикулы дегидратации-регидратации (DRV) и пузырьки (BSV).

[399] В зависимости от способа получения липосомы могут быть однослойными или многослойными и могут варьироваться по размеру с диаметрами в диапазоне приблизительно от 0,02 мкм до более чем приблизительно 10 мкм. Липосомы могут адсорбировать многие типы клеток, а затем высвобождать заключенное средство (например, описываемый в настоящем описании пептид). В некоторых случаях липосомы сливаются с клеткой-мишенью, в результате чего содержимое липосомы затем попадает в клетку-мишень. Липосома может подвергаться эндоцитироваться клетками, которые являются фагоцитами. Эндоцитоз может сопровождаться внутрилизосомной деградацией липосомных липидов и высвобождением инкапсулированных средств.

[400] Предоставленные в настоящем описании липосомы также могут содержать липиды-носители липид-носители. В определенных вариантах осуществления липиды-носители являются фосфолипидами. Липиды-носители, способные образовывать липосомы, включают, но не ограничиваются ими, дипальмитоилфосфатидилхолин (DPPC), фосфатидилхолин (PC; лецитин), фосфатидн кислота (PA), фосфатидилглицерин (ПГ), фосфатидилэтаноламин (PE), фосфатидилсерин (PS). Другие подходящие фосфолипиды дополнительно включают дистеароилфосфатидилхолин (DSPC), димиристоилфосфатидилхолин (DMPC), дипальмитоилфосфатидиглицерин (DPPG), дистеароилфосфатидиглицерин (DSPG), димиристоилфосфатидилглицерин (DMPG), дипальмитоилфосфатидн кислота (DPPA); димиристоилфосфатидн кислота (DMPA), дистеароилфосфатидн кислота (DSPA), дипальмитоилфосфатидилсерин (DPPS), димиристоилфосфатидилсерин (DMPS), дистеароилфосфатидилсерин (DSPS), дипальмитоилфосфатидиэтаноламин (DPPE), димиристоилфосфатидилэтаноламин (DMPE), дистеароилфосфатидилэтаноламин (DSPE) и т.п. или их сочетания. В определенных вариантах осуществления липосомы дополнительно содержат стерол (например, холестерин), который модулирует образование липосом. Липиды-носители могут быть любыми известными нефосфатными полярными липидами.

[401] Фармацевтическая композиция можно инкапсулировать в липосомы с использованием хорошо известной технологии. В качестве носителей для фармацевтических композиций по настоящему изобретению также можно использовать биоразлагаемые микросферы.

[402] Фармацевтическую композицию можно вводить в липосомах или микросферах (или микрочастицах). Способы получения липосом и микросфер для введения пациенту хорошо известны специалистам в данной области. По существу, вещество растворяют в водном растворе, при необходимости добавляют соответствующие фосфолипиды и липиды вместе с поверхностно-активными веществами, а вещество по необходимости диализуют или обрабатывают ультразвуком.

[403] Микросферы, образованные из полимеров или белков, хорошо известны специалистам в данной области и могут быть адаптированы для прохождения через желудочно-кишечный тракт непосредственно в кровоток. Альтернативно, соединение можно заключать и микросферы или композит из микросфер имплантировать для замедленного высвобождения в течение периода времени в диапазоне от суток до месяцев.

[404] Полипептид также можно присоединять к белку-носителю для доставки. Белок-носитель может представлять собой иммуногенный элемент носителя и его можно присоединять любой рекомбинантной технологией. Иллюстративные белки-носители включают гемоцианин морского блюдца марикультуры (mcKLH), пегилированный mcKLH, белки Blue Carrier*, бычий сывороточный альбумин (BSA), катионизированный BSA, овальбумин и бактериальные белки, такие как столбнячный токсин (TT).

[405] Полипептид также можно получать в виде нескольких антигенных пептидов (MAP). Пептиды можно присоединять на N-конце или С-конце к небольшим неиммуногенным ядрам. Пептиды, построенные на этом ядре, могут обеспечивать высоко локализованную плотность пептидов. Ядром может быть дендритный остаток ядра или матрица, состоящая из бифункциональных единиц. Подходящие молекулы ядра для конструирования MAP могут включать аммиак, этилендиамин, аспарагиновую кислоту, глутаминовую кислоту и лизин. Например, молекулу ядра лизина можно присоединять через пептидные связи через каждую из ее аминогрупп к двум дополнительным лизинам.

[406] Полипептид можно химически синтезировать или рекомбинантно экспрессировать в клеточной системе или в бесклеточной системе. Пептид можно синтезировать, например, путем жидкофазного синтеза, твердофазного синтеза или пептидного синтеза с помощью микроволнового излучения. Полипептид можно модифицировать, например, посредством ацилирования, алкилирования, амидирования, аргилирования, полиглутамилирования, полиглицилирования, бутирилирования, гамма-карбоксилирования, гликозилирования, малонилирования, гидроксилирования, иодирования, добавления нуклеотидов (например, ADP-рибозилирования), окисления, фосфорилирования, аденилирования, пропионилирования, S-глутатионилирования, S-нитрозилирования, сукцинилирования, сульфатирования, гликации, пальмитоилирования, миристоилирования, изопренилирования или пренилирования (например, фарнезилирования или геранилгеранилирования), глипирования, липоилирования, присоединения фрагмента флавина (например, FMN или FAD), присоединения гема C, фосфопантетеинилирования, ретинилиденового образования основания Шиффа, образования дихтамида, присоединения фосфоглицерина этаноламина, образования гипузина, биотинилирования, пэгирования, ISG-илирования, сумоилирования, убиквитинирования, недидирования, пупирования, цитруллинирования, дезамидирования, элиминалирования, карбамилирования или их сочетания.

[407] После получения полипептида полипептид можно подвергать одному или более стадиям этапов очистки для удаления примесей. Этап очистки может представлять собой этап хроматографии с применением способов разделения, таких как основанных на аффинности, основанных на размере, основанных на ионном обмене или т.п. В определенных случаях полипептид является не более 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99,9% или 100% чистым или без присутствия примесей. В определенных случаях полипептид является по меньшей мере на 30, 40, 50, 60, 70, 80, 90, 95, 99, 99,9 или 100% чистым или без присутствия примесей.

[408] Полипептид может содержать природные аминокислоты, неприродные аминокислоты или их сочетание. Аминокислотный остаток может относиться к молекуле, содержащей как аминогруппу, так и карбоксильную группу. Подходящие аминокислоты включают без ограничения как D-, так и L-изомеры природных аминокислот, а также неприродные аминокислоты, получаемые органическим синтезом или другими метаболическими путями. Как используют в настоящем описании, термин "аминокислота" включает, без ограничения, α-аминокислоты, природные аминокислоты, неприродные аминокислоты и аналоги аминокислот.

[409] Термин "α-аминокислота" может относиться к молекуле, содержащей как аминогруппу, так и карбоксильную группу, связанную с углеродом, который обозначен как α-углерод.

[410] Термин "β-аминокислота" может относиться к молекуле, содержащей как аминогруппу, так и карбоксильную группу в β-конфигурации.

[411] "Природная аминокислота" может относиться к любой из двадцати аминокислот, обычно встречающихся в пептидах, синтезируемых в природе, и известных по однобуквенным сокращениям A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y и V. Таблица, в которой приведено краткое описание свойств природных аминокислот, можно найти, например, в публикации патентной заявки США № 20130123169, которая включенной в настоящее описание посредством ссылки.

[412] Пептид, предоставленный в настоящем описании, может содержать одну или более гидрофобных, полярных или заряженных аминокислот. "Гидрофобные аминокислоты" включают небольшие гидрофобные аминокислоты и большие гидрофобные аминокислоты. "Малая гидрофобная аминокислота" может представлять собой глицин, аланин, пролин и их аналоги. "Большие гидрофобные аминокислоты" могут представлять собой валин, лейцин, изолейцин, фенилаланин, метионин, триптофан и их аналоги. "Полярные аминокислоты" могут представлять собой серин, треонин, аспарагин, глутамин, цистеин, тирозин и их аналоги. "Заряженные аминокислоты" могут представлять собой лизин, аргинин, гистидин, аспартат, глутамат и их аналоги.

[413] Пептид, предоставленный в настоящем описании, может содержать один или более аналогов аминокислот. "Аналог аминокислоты" может являться молекулой, которая является структурно подобной аминокислоте, и которую можно заменять аминокислотой при образовании пептидомиметического макроцикла. Аналоги аминокислот включают, без ограничения, β-аминокислоты и аминокислоты, где аминогруппу или карбоксигруппу заменяют аналогичной реакционноспособной группой (например, замена первичного амина вторичным или третичным амином, или замена карбоксигруппы эфиром).

[414] Пептид, предоставленный в настоящем описании, может содержать одну или более неприродных аминокислот. "Неприродная аминокислота" может быть аминокислотой, которая не является одной из 20 аминокислот, обычно встречающихся в пептидах, синтезируемых в природе, и известна по однобуквенным сокращениям A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y и V. Неприродные аминокислоты или аналоги аминокислот включают структуры, раскрытые, например, в публикации патентной заявки США № 20130123169, которая включена настоящее описание посредством ссылки.

[415] Аналоги аминокислот могут включать аналоги β-аминокислот. Примеры аналогов β-аминокислот и аналогов аланина, валина, глицина, лейцина, аргинина, лизина, аспарагиновых кислот, глутаминовых кислот, цистеина, метионина, фенилаланина, тирозина, пролина, серина, треонина и триптофана могут включать структуры, раскрытые, например, в публикации патентной заявки США № 20130123169, которая включена в настоящее описание посредством ссылки.

[416] Аналоги аминокислот могут являться рацемическими. В некоторых случаях используют D-изомер аналога аминокислоты. В некоторых случаях используется L-изомер аналога аминокислоты. В некоторых случаях аналог аминокислоты содержит хиральные центры, которые находятся в конфигурации R или S. Иногда аминогруппа(ы) аналога β-аминокислоты заменяют защитной группой, например, трет-бутилоксикарбонильной группой (BOC), 9-флуоренилметилоксикарбонилом (FMOC), тозилом и т.п. Иногда функциональную группу карбоновой кислоты аналога β-аминокислоты защищают, например, в виде ее сложноэфирного производного. В некоторых случаях используют соль аналога аминокислоты.

[417] "Заменимый" аминокислотный остаток может представлять собой остаток, который можно изменять в последовательности полипептида дикого типа без отмены или существенного изменения его основной биологической или биохимической активности (например, связывания или активации рецептора). "Незаменимые" аминокислотным остатком может являться остаток, который при изменении в последовательности полипептида дикого типа приводит к отмене или в значительной степени устранению основной биологической или биохимической активности полипептида.

[418]. "Консервативная замена аминокислот" может представлять собой "консервативную замену аминокислот", при которой аминокислотный остаток заменяют аминокислотным остатком, имеющим сходную боковую цепь. Семьи аминокислотных остатков, имеющих сходные боковые цепи, были определены в данной области. Эти семейства могут включать аминокислоты с основными боковыми цепями (например, K, R, H), кислыми боковыми цепями (например, D, E), незаряженными полярными боковыми цепи (например, G, N, Q, S, T, Y, C), неполярными боковыми цепами (например, A, V, L, I, P, F, M, W), бета-разветвленными боковыми цепями (например, T, V, I) и ароматическими боковыми цепями (например, Y, F, W, H). Таким образом, теоретически рассчитан заменимый аминокислотный остаток в полипептиде, например, можно заменять другим аминокислотным остатком из того же семейства боковой цепи. Другими примерами приемлемых замен могут являться замены на основе изостерических соображений (например, норлейцина для метионина) или других свойств (например, 2-тиенилаланин для фенилаланина или 6-Cl-триптофан для триптофана).

[419] Иммуногенные фармацевтические композиции на основе нуклеиновых кислот также можно вводить индивидууму. Иммуногенную фармацевтическую композицию на основе нуклеиновой кислоты можно формулировать с использованием любого из известных способов, носителей и эксципиентов в качестве подходящих и понятных в данной области. Нуклеиновая кислота может представлять собой ДНК, геномную ДНК или кДНК, РНК или гибрид, где нуклеиновая кислота может содержать комбинации дезоксирибо- и рибонуклеотидов и комбинации оснований, включая урацил, аденин, тимин, цитозин, гуанин, инозин, ксантин гипоксантин, изоцитозин и изогуанин. Нуклеиновые кислоты можно получать способами химического синтеза или рекомбинантными способами. Иммуногенная фармацевтическая композиция может представлять собой иммуногенную фармацевтическую композицию на основе ДНК, иммуногенную фармацевтическую композицию на основе РНК, иммуногенную фармацевтическую композицию на основе гибридной ДНК/РНК или гибридную фармацевтическую композицию на основе гибридной нуклеиновой кислоты/пептида. Пептид может представлять собой пептид, полученный из пептида в таблице 1 или 2, пептид, который имеет последовательность, которая является по меньшей мере на 40%, 50%, 60%, 70%, 80%, 90%, 95% или более гомологичной последовательности к пептиду в таблице 1 или 2, или пептид, который имеет последовательность, которая является не более на 40%, 50%, 60%, 70%, 80%, 90%, 95% или менее гомологичной последовательности пептида в таблице 1 или 2.

[420] Описываем в настоящем описании нуклеиновая кислота может содержать фосфодиэфирные связи, хотя в некоторых случаях, как описано ниже (например, при конструировании праймеров и зондов, таких как меченые зонды), включены аналоги нуклеиновых кислот, которые могут иметь альтернативные остовы, содержащие, например, фосфорамидные, фосфоротиоатные, O-метилфосфорамидитные связи и остовы и связи пептидных нуклеиновых кислот. Другие аналоги нуклеиновых кислот включают соединения с бициклическими структурами, включая закрытые нуклеиновые кислоты, положительные остовы и нерибозные остовы. Нуклеиновые кислоты, содержащие один или более карбоциклических сахаров, также входят в определение нуклеиновых кислот. Закрытые нуклеиновые кислоты (LNA) также включены в определение аналогов нуклеиновых кислот. LNA представляют собой класс аналогов нуклеиновой кислоты, в которых рибозное кольцо "закрыто" метиленовым мостиком, соединяющим атом 2'-О с атомом 4'-С. Эти модификации рибозо-фосфатного остова можно проводить для повышения стабильности и время полужизни таких молекул в физиологических средах. Например, гибриды ПНК:ДНК и ДНК-ДНК могут проявлять более высокую стабильность и, таким образом, их можно использовать в определенных вариантах осуществления. Нуклеиновые кислоты могут быть одноцепочечными или двухцепочечными, как указано, или содержать части двухцепочечной или одноцепочечной последовательности. В зависимости от применения нуклеиновые кислоты могут представлять собой ДНК (включая, например, геномную ДНК, митохондриальную ДНК и кДНК), РНК (включая, например, мРНК и рРНК) или гибрид, где нуклеиновая кислота содержит любую комбинацию дезоксирибо- и рибонуклеотидов и любую комбинацию оснований, включая урацил, аденин, тимин, цитозин, гуанин, инозин, ксатанин гипоксатанин, изоцитозин, изогуанин и т. д.

[421] Иммуногенные фармацевтические композиции на основе нуклеиновой кислоты могут находиться в форме вектора. Вектор может представлять собой кольцевую плазмиду или линейную нуклеиновую кислоту. Кольцевая плазмида или линейная нуклеиновая кислота могут направлять экспрессию конкретной нуклеотидной последовательности в соответствующей клетке индивидуума. Вектор может содержать промотор, функционально связанный с нуклеотидной последовательностью, кодирующей полипептид, которая может являться функционально связанной с сигналами терминации. Вектор может содержать последовательности, необходимые для правильной трансляции нуклеотидной последовательности. Вектор, содержащий представляющую интерес нуклеотидную последовательность, может быть химерным, что означает, что по меньшей мере один из его компонентов может являться гетерологичным по отношению по меньшей мере к одному из его других компонентов. Экспрессия нуклеотидной последовательности в экспрессионной кассете может находиться под контролем конститутивного промотора или индуцибельного промотора, который может инициировать транскрипцию только тогда, когда клетка-хозяин подвергается воздействию какого-либо определенного внутреннего или внешнего стимула.

[422] Вектор может представлять собой плазмиду. Плазмида может являться пригодной для трансфекции клеток нуклеиновой кислотой, кодирующей полипептид, и трансформированные клетки-хозяева можно культивировать и поддерживать в условиях, в которых происходит экспрессия полипептида.

[423] Плазмида может содержать последовательность нуклеиновой кислоты, которая кодирует один или более различных полипептидов, описываемых в настоящем описании. Одна плазмида может содержать кодирующую последовательность для одного полипептида или кодирующую последовательность для более чем одного полипептида. В некоторых случаях плазмида может дополнительно содержать кодирующую последовательность, которая кодирует адъювант, такой как иммуностимулирующая молекула, такая как цитокин.

[424] Плазмида может дополнительно содержать кодон инициации, который может находиться выше кодирующей последовательности, и стоп-кодон, который может находится ниже кодирующей последовательности. Кодон инициации и терминации может находиться в рамке считывания с кодирующей последовательностью. Плазмида может также содержать промотор, который функционально связан с кодирующей последовательностью, и энхансер перед кодирующей последовательностью. Энхансер может представлять собой актин человека, миозин человека, гемоглобин человека, креатин человека или энхансер вируса, такой как ЦМВ, FMDV, RSV или EBV.

[425] Плазмида также может содержать участок начала репликации млекопитающих для поддержания внехромосомной плазмиды и получения множества копий плазмиды в клетке. Плазмида может также содержать регуляторную последовательность, которая может хорошо подходить для экспрессии генов в клетке, в которую вводят плазмида. Кодирующая последовательность может содержать кодон, который может обеспечивать более эффективную транскрипцию кодирующей последовательности в клетке-хозяине.

[426] Иммуногенные фармацевтические композиции на основе нуклеиновой кислоты могут также представлять собой иммуногенную фармацевтическую композицию на основе линейной нуклеиновой кислотой или линейную экспрессирующую кассету, которая способна эффективно доставляться индивидууму посредством электропорации и экспрессировать один или более полипептидов, описываемых в настоящем описании.

[427] Иммуногенные фармацевтические композиции на основе клеток также можно вводить индивидууму. Например, иммуногенную фармацевтическую композицию на основе антигенпрезентирующей клетки (APC) можно формулировать с использованием любой из хорошо известных техник, носителей и эксципиентов, как общепринято, и как понятно в данной области. APC включают моноциты, получаемые из моноцитов клетки, макрофаги и дендритные клетки. В некоторых случаях иммуногенная фармацевтическая композиция на основе APC может представлять собой иммуногенную фармацевтическую композицию на основе дендритных клеток.

[428] Иммуногенную фармацевтическую композицию на основе дендритной клетки можно получить любыми способами, хорошо известными в данной области. В некоторых случаях иммуногенные фармацевтические композиции на основе дендритных клеток можно получать способом ex vivo или in vivo. Способ ex vivo может включать использование аутологичных примированных DC ex vivo с описываемыми в настоящем описании полипептидами для активации или нагрузки DC до введения пациенту. Способ in vivo может включать нацеливание специфических DC-рецепторов с использованием антител, связанных с описанными в настоящем описании полипептидами. Иммуногенная фармацевтическая композиция на основе DC может дополнительно содержать активаторы DC, такие как агонисты TLR3, TLR-7-8 и CD40. Иммуногенная фармацевтическая композиция на основе DC может дополнительно содержать адъюванты и фармацевтически приемлемый носитель.

[429] Адъювант можно использовать для усиления иммунного ответа (гуморального и/или клеточного), вызываемого у пациента, получающего иммуногенную фармацевтическую композицию. В некоторых случаях адъюванты могут вызывать ответ типа Th1. В других случаях адъюванты могут вызывать ответ типа Th2. Реакция типа Th1 можно охарактеризовать по продукции цитокинов, таких как IFN-γ, в отличие от ответа типа Th2, который можно охарактеризовать по продукции цитокинов, таких как IL-4, IL-5 и IL-10.

[430] В определенных аспектах адъюванты на основе липидов, такие как MPLA и MDP, можно использовать с описываемыми в настоящем описании иммуногенными фармацевтическими композициями. Монофосфориллипид A (MPLA), например, является адъювантом, который вызывает повышенную презентацию липосомального антигена специфическим Т-лимфоцитам. Кроме того, мурамиловый дипептид (MDP) также можно использовать в качестве подходящего адъюванта в сочетании с иммуногенными фармацевтическими составами, описываемыми в настоящем описании.

[431] Адъювант также может содержать стимулирующие молекулы, такие как цитокины. Неограничивающие примеры цитокинов включают: CCL20, a-интерферон (IFN-a), β-интерферон (IFN-β), γ-интерферон, тромбоцитарный фактор роста (PDGF), TNFα, TNFp, GM-CSF, эпидермальный рост фактор (EGF), хемокин, привлекающий Т-клетки кожи (CTACK), эпителиальный хемокин, экспрессируемый тимусом (TECK), эпителиальный хемокин (MEC), связанный со слизистой оболочкой, IL-12, IL-15, IL-28, MHC, CD80, CD86, IL-1, IL-2, IL-4, IL-5, IL-6, IL-10, IL-18, MCP-1, MIP-la, MIP-1-, IL-8, L-селектин, P-селектин, E-селектин, CD34, GlyCAM-1, MadCAM-1, LFA-1, VLA-1, Mac-1, pl50.95, PECAM, ICAM-1, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, мутантные формы IL-18, CD40, CD40L, фактор роста сосудов, фактор роста фибробластов, IL-7, фактор роста нервов, фактор роста эндотелия сосудов, Fas, рецептор TNF, Fit, Apo-1, p55, WSL-1, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DRS, KILLER, TRAIL-R2, TRICK2, DR6, каспазу ICE, Fos, c-jun, Sp-1, Ap-1, Ap-2, p38, p65Rel, MyD88, IRAK, TRAF6, IkB, неактивные NIK, SAP K, SAP-I, JNK, гены интерферонного ответа, NFkB, Bax, TRAIL, TRAILrec, TRAILrecDR5, TRAIL-R3, TRAIL-R4, RANK, RANK LIGAND, Ox40, Ox40 LIGAND, NKG2D, MICA, MICB, NKG2A, NKG2B, NKG2C, NKG2E, NKG2F, TAPI и TAP2.

[432] Дополнительные адъюванты включают: MCP-1, MIP-la, MIP-lp, IL-8, RANTES, L-селектин, P-селектин, E-селектин, CD34, GlyCAM-1, MadCAM-1, LFA-1, VLA-1, Mac-1, pl50.95, PECAM, ICAM-1, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, IL-4, мутантные формы IL-18, CD40, CD40L, фактор роста сосудов, фактор роста фибробластов, IL-7, IL-22, фактор роста нервов, фактор роста эндотелия сосудов, Fas, рецептор TNF, Fit, Apo-1, p55, WSL-1, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DR5, KILLER, TRAIL-R2, TRICK2, DR6, каспазу ICE, Fos, c-jun, Sp-1, Ap-1, Ap-2, p38, p65Rel, MyD88, IRAK, TRAF6, IkB, Inactive NIK, SAP K, SAP-1, JNK, гены интерферонного ответа, NFkB, Bax, TRAIL, TRAILrec, TRAILrecDRC5, TRAIL-R3, TRAIL-R4, RANK, лиганд RANK, Ox40, лиганд Ox40, NKG2D, MICA, MICB, NKG2A, NKG2B, NKG2C, NKG2E, NKG2F, TAP1, TAP2 и их функциональные фрагменты.

[433] В определенных аспектах адъювант может являться модулятором Toll-подобного рецептора. Примеры модуляторов Toll-подобных рецепторов включают агонисты TLR-9 и, не ограничиваются ими, низкомолекулярные модуляторы Toll-подобных рецепторов, такие как имихимод. Другие примеры адъювантов, которые используются в комбинации с иммуногенной фармацевтической композицией, описываемой в настоящем описании, могут включать и не ограничиваться ими сапонин, CpG ODN и т.д. В некоторых случаях адъювант выбирают из бактериальных токсинов, полиоксипропилен-полиоксиэтиленовых блокполимеров, солей алюминия, липосом, полимеров CpG, эмульсий типа "масло-в-воде" или их сочетания. В некоторых случаях адъювант представляет собой эмульсию "масло-в-воде". Эмульсия "масло-в-воде" может содержать по меньшей мере одно масло и по меньшей мере одно поверхностно-активное вещество, при этом масло(а) и поверхностно-активное вещество(а) являются биоразлагаемыми (метаболизируемыми) и биосовместимыми. Масляные капли в эмульсии могут составлять менее 5 мкм в диаметре и даже могут иметь субмикронный диаметр, причем такие небольшие размеры достигают с помощью микрожидкостного фильтра для обеспечения стабильных эмульсий. Капельки размером менее 220 нм можно подвергать стерилизации фильтром.

[434] В некоторых случаях иммуногенная фармацевтическая композиция может содержать носители и эксципиенты (включая, но, не ограничиваясь ими, буферы, углеводы, маннит, белки, полипептиды или аминокислоты, такие как глицин, антиоксиданты, бактериостатические средства, хелатирующие средства, суспендирующие средства, загустители и/или консерванты), воду, масла, в том числе масла, из нефти, животного, растительного или синтетического происхождения, такие как арахисовое масло, соевое масло, минеральное масло, кунжутное масло и т.п., солевые растворы, водные растворы декстрозы и глицерина, ароматизаторы, красители, уменьшающие липкость средства и другие приемлемые добавки, адъюванты или связывающие средства, другие фармацевтически приемлемые вспомогательные вещества, необходимые для аппроксимации физиологических условий, таких как средства для буферирования рН, регуляторы тоничности, эмульгаторы, средства для смачивания и т.д. Примеры наполнителей включают крахмал, глюкозу, лактозу, сахарозу, желатин, солод, рис, муку, мел, силикагель, стеарат натрия, моностеарат глицерина, тальк, хлорид натрия, сухое обезжиренное молоко, глицерин, пропилен, гликоль, воду, этанол и т.п. В других случаях фармацевтический препарат практически не содержит консервантов. В других случаях фармацевтический препарат может содержать по меньшей мере один консервант. Понятно, что, хотя любой подходящий носитель, известный специалистам в данной области, можно использовать для введения описанных в настоящем описании фармацевтических композиций, тип носителя будет варьироваться в зависимости от способа введения.

[435] Иммуногенная фармацевтическая композиция может содержать консерванты, такие как тиомерсал или 2-феноксиэтанол. В некоторых случаях иммуногенная фармацевтическая композиция по существу не содержит (например, <10 мкг/мл) ртутное вещество, например, не содержит тиомерсал. Сукцинат α-токоферола можно использован в качестве альтернативы ртутным соединениям.

[436] Для регуляции тоничности в иммуногенную фармацевтическую композицию можно вводить физиологическую соль, такую как натриевая соль. Другие соли могут включать хлорид калия, дигидрофосфат калия, динатрийфосфат и/или хлорид магния или т.п.

[437] Иммуногенная фармацевтическая композиция может иметь осмоляльность в диапазоне от 200 мОсм/кг до 400 мОсм/кг, диапазоне 240-360 мОсм/кг или в диапазоне 290-310 мОсм/кг.

[438] Иммуногенная фармацевтическая композиция может содержать один или более буферов, таких как трис-буфер; боратный буфер; сукцинатный буфер; гистидиновый буфер (особенно с адъювантом гидроксида алюминия); или цитратный буфер. Буферы, в некоторых случаях, входят в диапазон 5-20 мМ.

[439] Значение рН иммуногенной фармацевтической композиции может составлять приблизительно от 5,0 приблизительно до 8,5, приблизительно от 6,0 приблизительно до 8,0, приблизительно от 6,5 приблизительно до 7,5 или приблизительно от 7,0 приблизительно до 7,8.

[440] Иммуногенная фармацевтическая композиция может являться стерильной. Иммуногенная фармацевтическая композиция может не являться пирогенной, например, содержащей <1 ЕС (эндотоксиновая единица, стандартная мера) на дозу и может составлять <0,1 ЕС на дозу. Композиция может не содержать глютен.

[441] Иммуногенная фармацевтическая композиция может содержать детергент, например, поверхностно-активное вещество сложного эфира полиоксиэтиленсорбитана (известное как "Tweens") или октоксинол (такой как октоксинол-9 (Triton X-100) или t-октилфеноксиполиэтоксиэтанол). Детергент может присутствовать только в следовых количествах. Иммуногенная фармацевтическая композиция может содержать менее 1 мг/мл каждого из октоксинола-10 и полисорбата 80. Другими остаточными компонентами в следовых количествах могут являться антибиотики (например, неомицин, канамицин, полимиксин В).

[442] Иммуногенную фармацевтическую композицию можно формулировать в виде стерильного раствора или суспензии в подходящих носителях, хорошо известных в данной области. Фармацевтические композиции можно стерилизовать общепринятыми хорошо известными способами стерилизации или их можно стерилизовать. Полученные водные растворы можно упаковывать для применения в том виде как есть или в лиофилизированном виде, где лиофилизированный препарат объединяют со стерильным раствором перед введением.

[443] Иммуногенная фармацевтическая композиция можно формулировать с одной или более фармацевтически приемлемыми солями. Фармацевтически приемлемые соли могут включать фармацевтические соли неорганических ионов, такие как, например, натрий, калий, кальций, ионы магния и т.п. Такие соли могут включать соли с неорганическими или органическими кислотами, такими как соляная кислота, бромистоводородная кислота, фосфорная кислота, азотная кислота, серная кислота, метансульфоновая кислота, п-толуолсульфоновая кислота, уксусная кислота, фумаровая кислота, янтарная кислота, молочная кислота, миндальная кислота, яблочная кислота, лимонная кислота, винная кислота или малеиновая кислота. Кроме того, если средство(а) содержит карбоксигруппу или другую кислотную группу, ее можно превратить в фармацевтически приемлемую аддитивную соль с неорганическими или органическими основаниями. Примеры подходящих оснований включают гидроксид натрия, гидроксид калия, аммиак, циклогексиламин, дициклогексиламин, этаноламин, диэтаноламин, триэтаноламин и т.п.

[444] Фармацевтические композиции, содержащие, например, активное средство, такое как пептид, нуклеиновая кислота, антитело или их фрагменты и/или описываемые в настоящем описании APC, в комбинации с одним или более адъювантами можно формулировать так, чтобы они содержали определенные молярные отношения. Например, можно использовать молярные отношения приблизительно от 99:1 приблизительно до 1:99 активного средства, такого как пептид, нуклеиновая кислота, антитело или их фрагменты и/или описываемые в настоящем описании APC в комбинации с одним или более адъювантами. В некоторых случаях диапазон молярных соотношений активного агента, такого как пептид, нуклеиновая кислота, антитело или их фрагменты и/или описанный здесь АРС в сочетании с одним или несколькими адъювантами можно выбирать приблизительно от 80:20 приблизительно до 20:80; приблизительно 75:25 приблизительно до 25:75, приблизительно 70:30 приблизительно до 30:70, приблизительно 66:33 приблизительно до 33:66, приблизительно 60:40 приблизительно до 40:60; приблизительно 50:50 и приблизительно 90:10 приблизительно до 10:90. Молярное соотношение активного агента, такого как пептид, нуклеиновая кислота, антитело или их фрагменты и/или описываемый в настоящем описании APC в сочетании с одним или более адъювантами может составлять приблизительно 1:9, а в некоторых случаях может быть около 1:1. Активное средство, такое как пептид, нуклеиновая кислота, антитело или их фрагменты и/или описываемый в настоящем описании APC в комбинации с одним или несколькими адъювантами можно формулировать вместе в одной дозе, например, в одном флаконе, суппозитории, таблетке, капсуле, аэрозольном спреи; или каждое средство, форму и/или соединение можно формулировать в отдельных единицах, например, два флакона, суппозитория, таблетки, две капсулы, таблетки и флакон, аэрозольный спрей и т.п.

[445] В некоторых случаях иммуногенную фармацевтическую композицию можно вводить с дополнительным средством. Выбор дополнительного средства может зависеть, по крайней мере частично от состояния, подлежащего лечению. Дополнительное средство может включать, например, любые средства, имеющие терапевтический эффект в отношении инфекции патогена (например, вирусной инфекции), включая, например, лекарственные средства, используемые для лечения воспалительных состояний, такие как NSAID, например, ибупрофен, напроксен, ацетаминофен, кетопрофен или аспирин. В качестве другого примера, составы могут дополнительно содержать одно или несколько добавок, таких как витамин С, Е или другие антиоксиданты.

[446] Фармацевтическую композицию, содержащую активный агент, такой как пептид, нуклеиновая кислота, антитело или их фрагменты и/или описываемый в настоящем описании APC в комбинации с одним или несколькими адъювантами, можно формулировать общепринятым способом с использованием одного или более физиологически приемлемых носителей, содержащих эксципиенты, разбавители и/или вспомогательные вещества, например, которые облегчают обработку активных средств в препараты, которые можно вводить. Правильная состав может зависеть по меньшей мере частично от выбранного пути введения. Средство(а), описываемые в настоящем описании, можно доставлять пациенту с использованием нескольких путей или способов введения, включая пероральное, буккальное, местное, ректальное, внутрикожное, трансмукозальное, подкожное, внутривенное и внутримышечное применение, а также путем ингаляции.

[447] Активные средства можно формулировать для парентерального введения (например, путем инъекции, например, болюсной инъекции или непрерывной инфузии) и можно представлять в виде стандартной лекарственной форма в ампулах, предварительно заполненных шприцах, инфузии небольшого объема или в многодозовых контейнерах с добавленным консервантом. Композиции могут принимать такие формы, как суспензии, растворы или эмульсии в масляных или водных носителях, например, растворы в водном полиэтиленгликоле.

[448] Для инъекционных составов носитель можно выбирать из носителей, которые, как известно в данной области, являются подходящими, включая водные растворы или масляные суспензии, или эмульсии с кунжутным маслом, кукурузным маслом, хлопковым маслом или арахисовым маслом, а также эликсирами, маннит, декстроза или стерильный водный раствор и аналогичные фармацевтические носители. Состав также может содержать полимерные композиции, которые являются биосовместимыми, биоразлагаемыми, такими как сополимер молочной и гликолевой кислот. Эти вещества могут быть выполнены в микро- или наносферах, нагруженых лекарственным средством и дополнительно покрытых или дериватизированых для обеспечения превосходных характеристик длительного высвобождения. Носители, подходящие для пероокулярной или внутриглазной инъекции, включают, например, суспензии терапевтического средства в воде для инъекций, липосомы и носители, подходящие для липофильных веществ. Другие носители для пероокулярной или внутриглазной инъекции хорошо известны в данной области.

[449] В некоторых случаях фармацевтическую композицию формулируют в соответствии с общепринятыми способами в виде фармацевтической композиции, адаптированной для внутривенного введения человеку. Как правило, композиции для внутривенного введения представляют собой растворы в стерильном изотоническом водном буфере. При необходимости композиция может также содержать солюбилизатор и местный анестетик, такой как лидокаин, для облегчения боли в месте инъекции. Как правило, ингредиенты поставляют либо отдельно, либо смешивают друг с другом в стандартной лекарственной форме, например, в виде сухого лиофилизированного порошка или концентрата без воды в герметично закрытом контейнере, таком как ампула или саше, указывающая количество активного средства. В случае, когда композицию необходимо вводить путем инфузии, ее можно диспергировать в инфузионной бутылке, содержащей стерильную фармацевтическую воду или физиологический раствор. Когда композицию вводят путем инъекции, можно предоставлять ампулу стерильной воды для инъекций или физиологического раствора, таким образом, что ингредиенты можно смешивать пред введением.

[450] При введении путем инъекции активное средство можно формулировать в водных растворах, в частности, в физиологически совместимых буферах, таких как раствор Хэнкса, раствор Рингера или физиологический солевой буфер. Раствор может содержать вспомогательные средства, такие как суспендирующие, стабилизирующие и/или диспергирующие средства. Альтернативно, активное соединение может находиться в форме порошка для восстановления подходящим носителем, например, стерильной апирогенной водой, перед использованием. В другом варианте осуществления фармацевтическая композиция не содержит адъювант или какое-либо другое вещество, добавляемое для усиления иммунного ответа, стимулируемого пептидом. В другом варианте осуществления фармацевтическая композиция содержит вещество, которое ингибирует иммунный ответ на пептид.

[451] В дополнение к составам, описанным ранее, активные средства также можно формулировать в виде препарата депо. Такие составы длительного действия можно вводить посредством имплантации или чрескожной доставки (например, подкожно или внутримышечно), внутримышечной инъекции или использования трансдермального пластыря. Таким образом, например, средства можно формулировать с подходящими полимерными или гидрофобными веществами (например, в виде эмульсии в приемлемом масле) или ионообменными смолами или как малорастворимые производные, например, в виде малорастворимой соли.

[452] В тех случаях, когда фармацевтические композиции, содержащие один или более средств, оказывают местное и региональное действие при местном введении или инъекции в определенный участок инфекции или вблизи него. Прямое местное применение, например, вязкой жидкости, раствора, суспензии, растворов на основе диметилсульфоксида (ДМСО), липосомных составов, геля, желе, крема, лосьона, мази, суппозитория, пены или аэрозольного сперя, может использоваться для местного применения с получением, например, местных и/или региональных эффектов. Фармацевтически приемлемые носители для такого состава включают, например, низшие алифатические спирты, полигликоли (например, глицерин или полиэтиленгликоль), сложные эфиры жирных кислот, масла, жиры, силиконы и т.п. Такие препараты могут также включать консерванты (например, эфиры п-гидроксибензойной кислоты) и/или антиоксиданты (например, аскорбиновую кислоту и токоферол). Также см. Dermatological Formulations: Percutaneous absorption, Barry (Ed.), Marcel Dekker Incl, 1983. В другом варианте осуществления для лечения вирусных инфекций эпидермиса или слизистой оболочки используют локальные/местные препараты, содержащие ингибитор транспортера, носителя или ионных каналов.

[453] Фармацевтические композиции могут содержать косметически или дерматологически приемлемый носитель. Такие носители являются совместимыми с кожей, ногтями, слизистыми оболочками, тканями и/или волосами и могут включать любой общепринято используемый косметический или дерматологический носитель, отвечающий этим требованиям. Специалист в данной области может легко выбирать такие носители. При формулировании мази для кожи, средство или комбинация средств можно формулировать в масляной углеводородной основе, безводной абсорбирующей основе, абсорбирующей основе "вода-в-масле", удаляемой водой и/или водорастворимой основе "масло-в-воде". Примеры таких носителей и эксципиентов включают, но не ограничиваются ими, увлажнители (например, мочевину), гликоли (например, пропиленгликоль), спирты (например, этанол), жирные кислоты (например, олеиновую кислоту), поверхностно-активные вещества (например, изопропилмиристат и лаурилсульфатнатрия), пирролидоны, монолаурат глицерина, сульфоксиды, терпены (например, ментол), амины, амиды, алканы, алканолы, воду, карбонат кальция, фосфат кальция, различные сахара, крахмалы, производные целлюлозы, желатин и полимеры, такие как полиэтиленгликоли.

[454] Мази и кремы можно, например, формулировать с водной или масляной основой с добавлением подходящих загустителя и/или гелеобразующих средств. Лосьоны можно формулировать с водной или масляной основой, и в основном они также содержат один или более эмульгаторов, стабилизирующих агентов, диспергирующих агентов, суспендирующих агентов, загустителей или красителей. Конструирование и использование трансдермальных пластырей для доставки фармацевтических средств хорошо известны в данной области. Такие пластыри можно конструировать для непрерывной, пульсирующей или по требованию доставки фармацевтических средств.

[455] Смазочные средства, которые можно использовать для получения фармацевтических композиций и лекарственных форм, могут включать, но не ограничиваются ими, стеарат кальция, стеарат магния, минеральное масло, легкое минеральное масло, глицерин, сорбит, маннит, полиэтиленгликоль, другие гликоли, стеариновую кислоту, лаурилсульфат натрия, тальк, гидрогенизированное растительное масло (например, арахисовое масло, хлопковое масло, подсолнечное масло, кунжутное масло, оливковое масло, кукурузное масло и соевое масло), стеарат цинка, этилолеат, этиллаурет, агар или смеси его. Дополнительные смазочные средства включают, например, силоидный силикагель, коагулированный аэрозоль синтетического диоксида кремния или их смеси. Смазочное средство необязательно можно добавлять в количестве менее приблизительно 1 массовый процент от фармацевтической композиции.

[456] Фармацевтические композиции могут находиться в любой форме, подходящей для местного применения, включая водные, водно-спиртовые или масляные растворы, дисперсий в виде лосьона или сыворотки, водные, безводные или масляные гели, эмульсии, получаемые дисперсией жирной фазы в водной фазе (O/W или масло в воде) или наоборот (W/O или вода в масле), микроэмульсии или, альтернативно, микрокапсулы, микрочастицы или дисперсии липидных везикул ионного и/или неионного типа. Эти композиции можно получать общепринятыми способами. Количество различных составляющих композиций представляет собой количество, общепринято используемое в данной области. Эти композиции, в частности, представляют собой кремы для защиты, лечения или ухода, молочко, лосьоны, гели или пены для лица, для рук, для тела и/или для слизистых оболочек или для чистки кожи. Композиции могут также состоять из твердых препаратов, составляющих мыла или очищающих брусков.

[457] Фармацевтические композиции могут содержать адъюванты, такие как гидрофильные или липофильные гелеобразующие средства, гидрофильные или липофильные активные средства, консерванты, антиоксиданты, растворители, ароматизаторы, наполнители, солнцезащитные средства, поглотители запахов и красители. Количества этих различных адъювантов представляют собой количества общепринято используемые в данных областях и оставляют, например, приблизительно от приблизительно 0,01% приблизительно до 20% от общей массы композиции. В зависимости от их природы такие адъюванты можно вводить в жирную фазу, в водную фазу и/или в липидные везикулы.

[458] В случаях, связанных с местным/локальным применением, фармацевтические композиции могут содержать один или более усилителей впитывания. Например, составы могут содержать подходящие носители с твердой или гелевой фазовой или эксципиенты, которые увеличивают впитывание или облегчают доставку средств или комбинаций средств по изобретению через барьер проницаемости, например, кожу. Многие из этих усиливающих впитывание соединений известны в данной области местного состава и включают, например, воду, спирты (например, терпены, такие как метанол, этанол, 2-пропанол), сульфоксиды (например, диметилсульфоксид, дециметилсульфоксид, тетрадецилметилсульфоксид), пирролидоны (например, 2-пирролидон, N-метил-2-пирролидон, N-(2-гидроксиэтил)пирролидон), лаурокарам, ацетон, диметилацетамид, диметилформамид, тетрагидрофурфуриловый спирт, L-α-аминокислоты, анионные, катионные, амфотерные или неионные поверхностно-активные вещества (например, изопропилмиристат и лаурилсульфат натрия), жирные кислоты, жирные спирты (например, олеиновую кислоту), амины, амиды, амины клофибриновой кислоты, гексаметиленлаурамид, протеолитические ферменты, бисаболол, d-лимонен, мочевину и N, N-диэтил-м-толуамид и т.п. Дополнительные примеры включают увлажнители (например, мочевину), гликоли (например, пропиленгликоль и полиэтиленгликоль), монолаурат глицерина, алканы, алканолы, ORGELASE, карбонат кальция, фосфат кальция, различные сахара, крахмалы, производные целлюлозы, желатин и/или другие полимеры. В другом варианте осуществления фармацевтические композиции содержат один или более таких усилителей впитывания.

[459] Фармацевтические композиции для локального/местного применения могут содержать один или более противомикробных консервантов, таких как соединения четвертичного аммония, органические соединения ртути, п-гидроксибензоаты, ароматические спирты, хлорбутанол и т.п.

[460] Фармацевтические композиции можно формулировать в виде аэрозольных растворов, суспензий или сухих порошков. Аэрозоль можно вводить через дыхательную систему или носовые ходы. Например, специалист в данной области поймет, что композицию по настоящему изобретению можно суспендировать или растворять в подходящем носителе, например, фармацевтически приемлемом пропелленте, и вводить непосредственно в легкие с использованием назального спрея или ингалятора. Например, аэрозольный состав, содержащий ингибитор транспортера, носителя или ионных каналов, можно растворять, суспендировать или эмульгировать в пропелленте или смеси растворителя и пропеллента, например, для введения в виде назального спрея или ингалятора. Аэрозольные составы могут содержать любой приемлемый пропеллент под давлением, такой как косметически или дерматологически, или фармацевтически приемлемый пропеллент, как общепринято используют в данной области.

[461] Аэрозольный состав для назального введения, как правило, представляет собой водный раствор, предназначенный для введения в носовые проходы в каплях или спреях. Назальные растворы могут являться схожими с носовыми выделениями, поскольку они, как правило, являются изотоничными и незначительно забуферированными для поддержания рН приблизительно от 5,5 приблизительно до 6,5, хотя можно дополнительно использовать значения рН за пределами этого диапазона. Противомикробные средства или консерванты также можно вводить в состав.

[462] Аэрозольный состав для ингаляций и ингаляторов можно конструировать таким образом, что средство или комбинацию средств переносят в респираторное дерево индивидуума при введении через носового или пероральный дыхательный путь. Ингаляционные растворы можно вводить, например, посредством распылителя. Ингаляции или инсуффляции, содержащие мелкодисперсные или жидкие лекарственные средства, можно доставлять в респираторную систему в виде фармацевтического аэрозоля раствора или суспензии средства или комбинации средств в пропелленте, например, чтобы помогать в распределении. Пропелленты могут представлять собой сжиженные газы, ключая галогенуглероды, например, фторуглероды, такие как фторированные хлорированные углеводороды, гидрохлорфторуглероды и гидрохлоруглероды, а также углеводороды и эфиры углеводородов.

[463] Галоидоуглеводородные пропелленты могут включать фторуглеродные пропелленты, в которых все атомы водорода замещены фтором, хлорфторуглеродные пропелленты, в которых все атомы водорода замещены хлором и по меньшей мере одним фтором, водородсодержащие фторуглеродные пропелленты и водородсодержащие хлорфторуглеродные пропелленты. Углеводородные пропелленты, пригодные в изобретении, включают, например, пропан, изобутан, н-бутан, пентан, изопентан и неопентан. Смесь углеводородов также можно использовать в качестве пропеллента. Пропелленты на основе простого эфира включают, например, диметиловый эфир, а также простые эфиры. Аэрозольный состав по изобретению может также содержать более одного пропеллента. Например, аэрозольный состав может содержать более одного пропеллента из того же класса, такого как два или более фторуглерода; или более одного, более двух, более трех пропеллентов из разных классов, таких как фторуглеводород и углеводород. Фармацевтические композиции по настоящему изобретению также можно дозировать со сжатым газом, например, инертным газом, таким как диоксид углерода, закись азота или азот.

[464] Аэрозольные составы также могут содержать другие компоненты, например, этанол, изопропанол, пропиленгликоль, а также поверхностно-активные вещества или другие компоненты, такие как масла и детергенты. Эти компоненты могут служить для стабилизации состава и/или смазывания компонентов клапана.

[465] Аэрозольный состав можно упаковывать под давлением и можно формулировать в виде аэрозоля с использованием растворов, суспензий, эмульсий, порошков и полутвердых препаратов. Например, раствор аэрозольного состава может содержать раствор средства по изобретению, такой как ингибитор транспортера, носителя или ионных каналов (по существу) в чистом пропелленте или в виде смеси пропеллента и растворителя. Растворитель можно использовать для растворения средства и/или замедления испарения пропеллента. Растворители могут включать, например, воду, этанол и гликоли. Можно использовать любую комбинацию подходящих растворителей, необязательно в сочетании с консервантами, антиоксидантами и/или другими компонентами аэрозолей.

[466] Аэрозольный состав может представлять собой дисперсию или суспензию. Суспензионный аэрозольный состав может содержать суспензию средства или комбинации средств по настоящему изобретению, например, ингибитора транспортера, носителя или ионных каналов, и диспергирующего средства. Диспергирующие средства могут включать, например, триолеат сорбита, олеиловый спирт, олеиновую кислоту, лецитин и кукурузное масло. Суспензионный аэрозольный состав может также содержать смазывающие вещества, консерванты, антиоксидант и/или другие компонентами аэрозолей.

[467] Аэрозольный состав можно аналогичным образом формулировать в виде эмульсии. Эмульсионный аэрозольный состав может содержать, например, спирт, такой как этанол, поверхностно-активное вещество, воду и пропеллент, а также средство или комбинацию средств по изобретению, например, транспортер, носитель или ионный канал. Используемое поверхностно-активное вещество может являться неионным, анионным или катионным. Один из примеров эмульсионного аэрозольного состава содержит, например, этанол, поверхностно-активное вещество, воду и пропеллент. Другой пример эмульсионного аэрозольного состава содержит, например, растительное масло, глицерилмоностеарат и пропан.

[468] Фармацевтические соединения можно формулировать для введения в виде суппозиториев. Низкоплавкий воск, такой как смесь триглицеридов, глицеридов жирных кислот, Witepsol S55 (торговая марка Dynamite Nobel Chemical, Germany) или масло какао, сначала расплавляют, и гомогенно диспергируют активный компонент, например, перемешиванием. Затем расплавленную гомогенную смесь выливают в формы подходящего размера, оставляют охлаждаться и затвердевать.

[469] Фармацевтические композиции можно формулировать для вагинального введения. Пессарии, тампоны, кремы, гели, пасты, пены или спреи, содержащие в дополнение к активному ингредиенту такие носители, которые, как известно в данной области, являются подходящими.

[470] Фармацевтические композиции можно присоединять с возможностью разложения к биосовместимым полимерам для использования в составах с длительным высвобождением на, в или присоединенными к вкладышу для местного, внутриглазного, периокулярного или системного введения. Контролируемое высвобождение из биосовместимого полимера также можно использовать с водорастворимым полимером для образования капельного состава. Контролируемое высвобождение из биосовместимого полимера, такого как, например, микросферы PLGA или наносферы, можно использовать в составе, подходящем для внутриглазной имплантации или инъекции для введения с длительным высвобождением. Можно использовать любой подходящий биоразлагаемый и биосовместимый полимер.

IV. Комбинации пептидов CTL и пептидов HTL

[471] Иммуногенные или вакцинные композиции, содержащие неоантигенные полипептиды и полинуклеотиды, описываемые в настоящем описании, или их аналоги, которые обладают иммуностимулирующей активностью, можно модифицированы для получения желаемых характеристик, таких как улучшение время полувыведения из сыворотки, или для увеличения иммуногенности.

[472] Например, способность неоантигенных пептидов индуцировать активность CTL можно усиливать посредством связывания пептида с последовательностью, которая содержит по меньшей мере один эпитоп, который способен индуцировать ответ хелперных Т-клеток. В определенных вариантах осуществления конъюгаты эпитоп CTL/эпитоп HTL связывают с помощью спейсерной молекулы. Спейсер, как правило, состоит из относительно небольших нейтральных молекул, таких как аминокислоты или миметики аминокислот, которые по существу являются незаряженными в физиологических условиях. Спейсеры, как правило, выбирают, например, из Ala, Gly или других нейтральных спейсеров неполярных аминокислот или нейтральных полярных аминокислот. Следует понимать, что необязательно присутствующий спейсер необязательно должен содержать одни и те же остатки и, таким образом, может являться гетеро- или гомоолигомером. В случае присутствия спейсер, как правило, будет представлять собой по меньшей мере одни или два остатка, более, как правило, от трех до шести остатков. Альтернативно, пептид CTL можно связывать с Т-хелперным пептидом без спейсера.

[473] Хотя пептидный эпитоп CTL можно связывать непосредственно с эпитопом Т-хелперного пептида, конъюгаты эпитоп CTL/эпитоп HTL можно связывать с помощью спейсерной молекулы. Спейсер, как правило, состоит из относительно небольших нейтральных молекул, таких как аминокислоты или миметики аминокислот, которые по существу которые по существу являются незаряженными в физиологических условиях. Спейсеры, как правило, выбирают, например, из Ala, Gly или других нейтральных спейсеров неполярных аминокислот или нейтральных полярных аминокислот. Следует понимать, что необязательно присутствующий спейсер необязательно должен содержать одни и те же остатки и, таким образом, может являться гетеро- или гомоолигомером. В случае присутствия спейсер, как правило, будет представлять собой по меньшей мере одни или два остатка, более, как правило, от трех до шести остатков. Пептидный эпитоп CTL можно связывать с Т-хелперным пептидным эпитопом либо непосредственно, либо через спейсер с N-концом или C-концом пептида CTL. N-конец иммуногенного пептида ли Т-хелперного пептида может являться ацилированной.

[474] Пептидные эпитопы HTL также можно модифицировать для изменения их биологических свойств. Например, пептиды, содержащие эпитопы HTL, могут содержать D-аминокислоты для повышения их устойчивости к протеазам и, таким образом, можно продлевать время полувыведения из сыворотки. Кроме того, эпитопные пептиды можно конъюгировать с другими молекулами, такими как липиды, белки или сахара, или любыми другими синтетическими соединениями для увеличения их биологической активности. Например, Т-хелперный пептид можно конъюгировать с одной или более цепями пальмитиновой кислоты на N- или C-концах.

[475] В определенных вариантах осуществления Т-хелперный пептид представляет собой пептид, который распознается Т-хелперными клетками, присутствующими в большей части популяции. Это можно проводить путем выбора аминокислотных последовательностей, которые связываются со многими, большинством или всеми молекулами HLA II класса. Они известны как "слабо рестрицированные по HLA" или "промискуитетные" Т-хелперные последовательности. Примеры аминокислотных последовательностей, которые являются промискуитетными, включают последовательности из антигенов, таких как столбнячный токсин, в положениях 830-843 (QYIKANSKFIGITE), белок CS Plasmodium falciparum в положениях 378-398 (DIEKKIAKMEKASSVFNVVNS) и белок Streptococcus 18 кДа в положениях 116 (GAVDSILGGVATYGAA). Другие примеры включают пептиды, несущие супермотив DR 1-4-7 или любой из мотивов DR3.

[476] Альтернативно, можно получать синтетические пептиды, способные стимулировать Т-хелперные лимфоциты, в слабо рестрицированном по HLA виде, с использованием аминокислотных последовательностей, не встречающихся в природе (см., например, публикацию PCT WO 95/07707). Такие синтетические соединения, называемые Pan-DR-связывающими эпитопами (например, PADRE, Epimmune, Inc., San Diego, CA), конструируют с возможностью связываться с большинством молекул HLA-DR (HLA II класса человека). Например, выявлено, что пептид pan-DR-связывающего эпитопа, имеющий формулу: aKXVWANTLKAAa, где "X" представляет собой либо циклогексилаланин, фенилаланин, либо тирозин, и a является D-аланином или L-аланином, который связывается с большинством аллелей HLA-DR, и стимулирует реакцию Т-хелперных лимфоцитов у большинства индивидуумов, независимо от их типа HLA. Альтернатива pan-DR-связывающего эпитоп включает все "L"-природные аминокислоты и может быть предоставлена в виде нуклеиновых кислот, которые кодируют эпитоп.

[477] В определенных вариантах осуществления может являться желательным введение терапевтический препарат на основе неоантигена (например, пептидов, полинуклеотидов, TCR, CAR, клеток, содержащих TCR или CAR, содержащих полипептид дендритных клеток, дендритных клеток, содержащих полинуклеотид, антитело и т.д.) в фармацевтические композиции (например, иммуногенные композиции) по меньшей мере один компонент, который примирует цитотоксические Т-лимфоциты. Липиды были идентифицированы как средства, способные примировать CTL in vivo против вирусных антигенов. Например, остатки пальмитиновой кислоты можно присоединять к ε- и α-аминогруппам лизинового остатка, а затем связывать, например, с одним или более связующими остатками, такими как Gly, Gly-Gly-, Ser, Ser-Ser или т.п., с иммуногенным неоантигенным пептидом. Затем липидированный пептид можно вводить либо непосредственно в мицеллу или частицу, включенную в липосому, либо эмульгированную в адъюванте. В определенных вариантах осуществления особенно эффективная иммуногенная конструкция содержит пальмитиновую кислоту, присоединенную к ε- и α-аминогруппам Lys, которая присоединена посредством связывания, например, Ser-Ser, с аминоконцом иммуногенного пептида.

[478] В качестве еще одного примера примирования липидами ответов CTL можно использовать липопротеины E. coli, такие как трипалмитоил-S-глицерилцистеинтерилсерин (P3CSS), для примирования специфичных к вирусу CTL при ковалентном присоединении к соответствующему пептиду. (См., например, Deres, et al., Nature 342: 561, 1989). Неоантигенные пептиды, описываемые в настоящем описании, можно связывать, например, с P3CSS и липопептидом, вводимым индивидууму, для специфического примирования ответа CTL на антиген-мишень. Кроме того, поскольку индукцию нейтрализующих антител также можно примировать конъюгированными с P3CSS эпитопами, две такие композиции можно комбинировать, чтобы более эффективно вызывать как гуморальные, так и клеточно-опосредованные ответы на инфекцию.

[479] Как отмечено в настоящем описании, к концам неоантигенного пептида можно добавлять дополнительные аминокислоты, чтобы обеспечивать простоту связывания пептидов друг с другом, для связывания с подложкой носителя или более крупным пептидом, для модификации физических или химических свойств пептид или олигопептид, или т.п. Аминокислоты, такие как тирозин, цистеин, лизин, глутаминовая или аспарагиновая кислота или т.п., можно вводить на С- или N-конце пептида или олигопептида. Однако следует отметить, что модификация на С-конце Т-клеточного эпитопа может в некоторых случаях изменять характеристики связывания пептида. Кроме того, пептидные или олигопептидные последовательности могут отличаться от природной последовательности тем, что являются модифицированными путем ацилирования концевых NH2, например, алканоилом (C1-C20) или тиогликолильным ацетилированием, амидированием на C-конце, например, аммиаком, метиламином и т.д. В некоторых случаях эти модификации могут обеспечивать участки связывания с подложкой или другой молекулой.

[480] Вариант осуществления иммуногенной композиции, описываемый в настоящем описании, включает введение ex vivo смеси несущего эпитоп неоантигенного полипептида или полинуклеотидов в PBMC или выделенных из них DC из крови пациента. Можно использовать фармацевтическое средство для облегчения сбора дендритных клеток (DC), включая GM-CSF, IL-4, IL-6, IL-1β и TNFα. После нагрузки DC пептидами или полинуклеотидами, кодирующими пептиды, и до повторной инфузии пациентам DC промывают для удаления несвязавшихся пептидов. В этом варианте осуществления вакцинная или иммуногенная композиция содержит нагруженные пептидом DC, которые презентируют пептидные эпитопы, в комплексе с молекулами HLA на их поверхностях. Затем композицию вводят пациенту. В других вариантах осуществления такие нагруженные DC используют для стимуляции Т-клеток, пригодных для использования в T-клеточной терапии.

V. Многоэпитопые иммуногенные композиции

[481] Доступен ряд разных подходов, котоыре позволяют одновременную доставку нескольких эпитопов. Нуклеинов кислоты, кодирующие неоантигенные пептиды, описываемые в настоящем описании, являются особенно пригодным вариант осуществления изобретения. В определенных вариантах осуществления нуклеиновая кислота представляет собой РНК. В определенных вариантах осуществления используют минигеннные конструкции, кодирующие неоантигенный пептид, содержащий один или более эпитопов, описываемых в настоящем описании, для введения нуклеиновых кислот, кодирующих неоантигенные пептиды, описываемые в настоящем описании.

[482] Использование многоэпитопных минигенов описано у An L. and Whitton, J. L., J. Virol. 71: 2292, 1997; Thomson, S. A. et al., J. Immunol. 157: 822, 1996; Whitton, J. L. et al., J. Virol. 67: 348, 1993; Hanke, R. et al., Vaccine 16: 426, 1998. Например, можно конструировать плазмиду с многоэпитопной ДНК, кодирующей неоантигенные пептиды, несущие супермотив и/или мотив, универсальный хелперный Т-клеточный эпитоп (или несколько эпитопов опухолеассоциированного антигена HTL) и сигнальную последовательности транслокации эндоплазматического ретикулума.

[483] Иммуногенность мультиэпитопного минигена можно тестировать на трансгенных мышах для оценки величины иммунного ответа, индуцированного против тестируемых эпитопов. Кроме того, иммуногенность кодируемых ДНК эпитопов in vivo можно сопоставлять с ответами in vitro конкретных линий CTL против клеток-мишеней, трансфицированных плазмидной ДНК. Таким образом, эти эксперименты могут показать, что миниген служит для обеих целей: 1.) вызывает клеточно-опосредованный и/или гуморальный ответ и 2.) индуцированные иммунные клетки распознают клетки, экспрессирующие закодированные эпитопы.

[484] Например, для получения последовательности ДНК, кодирующей выбранные неоэпитопы (миниген) для экспрессии в клетках человека, аминокислотные последовательности эпитопов можно подвергать обратной трансляции. Для руководства в выборе кодонов для каждой аминокислоты можно использовать таблицу предпочтения кодонов человека. Эти кодирующие неоэпитоп последовательности ДНК можно непосредственно присоединять, таким образом, что при трансляции образуется непрерывная полипептидная последовательностью. Для оптимизации экспрессии и/или иммуногенности в конструкцию минигена можно вводить дополнительные элементы. Примеры аминокислотных последовательностей, которые можно подвергать обратной трансляции и вводить в последовательность минигена, включают: эпитопы HLA I класса, эпитопы HLA II класса, сигнальную последовательность убиквитинилирования и/или направляющий эндоплазматический ретикулум сигнал. Кроме того, презентация HLA эпитопов CTL и HTL можно улучшать введением синтетических (например, поли-аланин) или природных фланкирующих последовательностей, смежных с эпитопами CTL или HTL; такие более крупные пептиды, содержащие эпитоп(ы) входят в объем изобретения.

[485] Последовательность минигена можно преобразовывать в ДНК посредством сборки олигонуклеотидов, которые кодируют плюс и минус нити минигена. Перекрывающиеся олигонуклеотиды (длиной 30-100 оснований) можно синтезировать, фосфорилировать, очищать и отжигать в подходящих условиях с применением хорошо известных способов. Концы олигонуклеотидов можно соединять, например, с использованием ДНК-лигазы T4. Такой синтетический миниген, кодирующий эпитопный полипептид, может затем быть клонировать в желаемый экспрессирующий вектор.

[486] Для обеспечения экспрессии в клетках-мишенях в вектор можно вводить стандартные регуляторные последовательности, хорошо известные специалистам в данной области. Например, промотор с участком клонирования в прямом направлении для введения минигена; сигнал полиаденилирования для эффективной терминации транскрипции; участок начала репликации E. coli; и селективный маркер E. coli (например, резистентность к ампициллину или канамицину). Для этой цели можно использовать многие промоторы, например, промотор цитомегаловируса человека (hCMV). См., например, патенты США 5580859 и 5589466 для других подходящих промоторных последовательностей.

[487] Дополнительные модификации векторов можно использовать для оптимизации экспрессии минигенов и иммуногенности. В некоторых случаях интроны являются необходимыми для эффективной экспрессии гена, и в транскрибируемую область минигена можно вводить один или более синтетических или природных интронов. Для увеличения экспрессии минигена также можно предусматривать введение стабилизирующих мРНК последовательностей и последовательностей для репликации в клетках млекопитающих.

[488] После выбора экспрессирующего вектора миниген можно клонировать в полилинкерную область ниже промотора. Такую плазмиду трансформируют в подходящий штамм E. coli, и получают ДНК стандартными способами. Ориентация и последовательность ДНК минигена, а также всех других элементов, включенных в вектор, можно подтверждать с использованием рестрикционного картирования и анализа последовательности ДНК. Бактериальные клетки, содержащие правильную плазмиду, можно хранить в виде банка исходных клеток и банка рабочих клеток.

[489] Кроме того, иммуномодулирующие последовательности, по-видимому, играют роль в иммуногенности ДНК-вакцин. При желании для увеличения иммуногенности эти последовательности можно вводить в вектор вне кодирующей миниген последовательности. В определенных вариантах осуществления последовательности являются иммуностимулирующими. В другом варианте осуществления последовательности представляют собой ISS или CpG.

[490] В определенных вариантах осуществления можно использовать бицистронный экспрессирующий вектор, который позволяет получать кодируемые минигеном эпитопы и второй белок (введенный для усиления или ослабления иммуногенности). Примеры белков или полипептидов, которые могут существенно повысить иммунный ответ в случае совместной экспрессии включают цитокины (например, IL-2, IL-12, GM-CSF), молекулы, индуцирующие цитокины (например, LeIF), костимулирующие молекулы или для ответов HTL pan-DR-связывающие белки. Хелперные (HTL) эпитопы можно соединять с сигналами внутриклеточного нацеливания и экспрессировать отдельно от экспрессируемых эпитопов CTL; это позволяет направлять эпитопы HTL в клеточный компартмент, отличный от компартмента эпитопов CTL. При необходимости это может способствовать более эффективному введению эпитопов HTL по пути HLA II класса, тем самым улучшая индукцию HTL. В отличие от индукции HTL или CTL специфическое снижение иммунного ответа путем совместной экспрессии иммуносупрессивных молекул (например, TGF-β) может быть полезным при определенных заболеваниях.

[491] Терапевтические количества плазмидной ДНК можно получать, например, ферментацией в E. coli с последующей очисткой. Аликвоты из банка рабочих клеток используют для инокуляции среды для выращивания и выращивают до состояния насыщения в шейкерных колбах или биореакторе в соответствии с хорошо известными способами. Плазмидную ДНК можно очищать с использованием стандартных технологий биосепарации, таких как твердофазные анионообменные смолы, поставляемые QIAGEN, Inc. (Валенсия, Калифорния). Если требуется, сверхспиральную ДНК можно выделить из открытых кольцевых и линейных форм с использованием гель-электрофореза или других способов.

[492] Очищенную плазмидную ДНК можно подготавливать для инъекции с использованием различных составов. Простейшим из них является восстановление лиофилизированной ДНК в стерильном фосфатно-буферном солевом растворе (PBS). Этот подход, известный как "голая ДНК", в настоящее время используется для внутримышечного (в/м) введения в клинических испытаниях. Для максимального увеличения иммунотерапевтического действия ДНК-вакцин на основе минигена можно использовать альтернативный способ формулирования очищенной плазмидной ДНК. Описаны различные способы и новые способов могут стать доступными. В составе также можно использовать катионные липиды (см., например, WO 93/24640, Mannino & Gould-Fogerite, BioTechniques 6 (7): 682 (1988), патент США № 5 279 833, WO 91/06309 и Felgner et al., Proc. Nat'l Acad. Sci. USA, 84: 7413 (1987). Кроме того, гликолипиды, фузогенные липосомы, пептиды и соединения, которые в совокупности являются защитными, интерактивными, неконденсирующимися соединениями (ПИНК) также можно подвергать комплексообразованию с очищенной плазмидной ДНК, чтобы влиять на такие переменные, как стабильность, внутримышечное распределение или транспорт к определенным органам или типам клеток.

[493] В другом варианте осуществления нуклеиновая кислоту вводят в клетки с использованием высокоскоростной клеточной деформации. Во время высокоскоростной деформации клетки сжимают так, что в клеточной мембране возникают временные нарушения, что позволяет нуклеиновой кислоте проникать в клетку. Альтернативно, белок можно получать из экспрессирующих векторов - например, в бактериальном экспрессирующем векторе, и затем белки могут доставляться в клетку.

[494] Сенсибилизацию клеток-мишеней можно использована в качестве функционального анализа экспрессии и презентации HLA I класса кодированных минигеном эпитопов CTG. Например, плазмидную ДНК вводят в линию клеток млекопитающих, которая является подходящей в качестве мишени для стандартных анализов высвобождения хрома CTL. Используемый способ трансфекции зависит от конечного состава. Электропорацию можно использовать для "голой" ДНК, тогда как катионные липиды позволяют прямую трансфекцию in vitro. Плазмиду, экспрессирующую зеленый флуоресцентный белок (GFP), можно котрансфицировать, чтобы обеспечивать обогащение трансфицированных клеток с помощью активированной флуоресценцией сортировки (FACS). Затем такие клетки подвергают мечению хромом-51 (51Cr) и используют в качестве клеток-мишеней для специфичных к эпитопу линий CTL; цитолиза, проводят детекцию по высвобождению 51Cr, что указывает на продуцирование и предоставление HLA, кодируемых минигеном эпитопов CTG. Экспрессию эпитопов HTL можно оценивать аналогичным образом с использованием анализов для оценки активности HTL.

[495] Иммуногенность in vivo представляет собой второй подход функционального тестирования составов ДНК минигенов. Трансгенные мыши, экспрессирующие соответствующие белки HLA человека, иммунизируют продуктом ДНК. Доза и способ введения зависят от состава (например, в/м для ДНК в PBS, внутрибрюшинно (в/б) для ДНК, входящей в комплекс с липидом). Иллюстративный протокол является таким: через двадцать одни сутки после иммунизации спленоциты собирают и повторно стимулируют в течение 1 недели в присутствии пептидов, кодирующих каждый тестируемый эпитоп. Затем для эффекторных клеток CTL анализы проводят на цитолиз нагруженных пептидом меченных 51Cr клеток-мишеней стандартными способами. Лизис клеток-мишеней, которые были сенсибилизированы нагруженным пептидными эпитопами HLA, соответствующими эпитопам, кодированным минигеном, демонстрирует функцию ДНК-вакцины для индукции CTL in vivo. Иммуногенность эпитопов HTL оценивают у трансгенных мышей аналогичным образом.

[496] Альтернативно, нуклеиновые кислоты можно вводить с использованием баллистической доставки, как описано, например, в патенте США № 5204253. Этим способом вводят частицы, состоящие исключительно из ДНК. В другом альтернативном варианте осуществления ДНК может быть прикреплена к частицам, таким как частицы золота.

VI. Клетки для применения в изобретении

[497] В одном аспекте настоящее изобретение также относится к клеткам, экспрессирующим рецептор, распознающий неоантиген, который активирует иммуноположительную клетку (например, рецептор Т-клеток (TCR) или рецептор химерного антигена (CAR)) и к способам использования таких клеток для лечение заболевания, которое требует усиленного иммунного ответа.

[498] Такие клетки включают генетически модифицированные иммунореактивные клетки (например, Т-клетки, клетки естественные киллерные клетки (NK), цитотоксические Т-лимфоциты (CTL), клетки-хелперы-Т-лимфоцитов (HTL)), экспрессирующие антиген-распознающий рецептор (например, TCR или CAR), который связывает один из неоантигенных пептидов, описываемых в настоящем описании, и способы использования, следовательно, для лечения неоплазии и других патологий, где желательно увеличение антигенспецифического иммунного ответа. Активация Т-клеток опосредуется TCR или CAR, нацеленным на антиген.

[499] Настоящее изобретение относится к клеткам, экспрессирующим комбинацию рецептора, распознающего антиген, который активирует иммунореактивную клетку (например, TCR, CAR) и химерный ко-стимулирующий рецептор (CCR), и способам использования таких клеток для лечения заболевания, которое требует усиленного иммунного ответа. В определенных вариантах осуществления опухолевые антигенспецифические Т-клетки, NK-клетки, клетки CTL или другие иммуночувствительные клетки используют в качестве челноков для селективного обогащения одного или более ко-стимулирующих лигандов для лечения или профилактики неоплазии. Такие клетки вводят нуждающемуся в этом индивидууму, являющемуся человеком, для лечения или профилактики конкретной злокачественной опухоли.

[500] В определенных вариантах осуществления опухолевые антигенспецифические лимфоциты человека, которые можно использовать in способы по изобретению, включают, без ограничения, лимфоциты периферической крови доноров, генетически модифицированные для экспрессии рецепторов химерных антигенов (CAR) (Sadelain, M., et al. 2003 Nat Rev Cancer 3: 35-45), лимфоциты периферической крови доноров, генетически модифицированные для экспрессии полноразмерного распознающего опухолевый антиген Т-клеточного рецепторного комплекса, содержащего гетеродимер a и p (Morgan RA, et al., Science Science, 314: 126 -129), культуры лимфоцитов, получаемых из инфильтрационных опухолевых лимфоцитов (TIL) в биопсии опухолей (Panelli MC et al., 2000 J Immunol 164: 495-504, Panelli, MC, et al., 2000 J Immunol 164: 4382-4392) и селективно размноженные in vitro антигенспецифические лейкоциты периферической крови с использованием искусственных антигенпрезентирующих клеток (AAPC) или нагруженных дендритных клеток (Dupont, J., et al., 2005 Cancer Res., 65: 5417-5427; Papanicolaou, GA, et al. 2003 Blood 102: 2498-2505). Т-клетки могут быть аутологичными, аллогенными или производными in vitro из сконструированного предшественника или стволовых клеток.

[501] В определенных вариантах осуществления иммунотерапевтическое средство представляет собой сконструированный рецептор. В определенных вариантах осуществления сконструированный рецептор представляет собой химерный антигенный рецептор (CAR), Т-клеточный рецептор (TCR) или B-клеточный рецептор (BCR), адоптивную Т-клеточную терапию (ACT) или их производное. В других аспектах сконструированный рецептор представляет собой химерный антигенный рецептор (CAR). В некоторых аспектах CAR представляет собой CAR первого поколения. В других аспектах CAR представляет собой CAR второго поколения. В других аспектах CAR представляет собой CAR третьего поколения.

[502] В определенных аспектах CAR содержит внеклеточный участок, трансмембранный участок и внутриклеточный участок. В определенных аспектах внутриклеточный участок содержит по меньшей мере один костимулирующий домен Т-клеток. В определенных аспектах костимулирующий домен Т-клеток выбран из группы, состоящей из CD27, CD28, TNFRS9 (4-1BB), TNFRSF4 (OX40), TNFRSF8 (CD30), CD40LG (CD40L), ICOS, ITGB2 (LFA- 1), CD2, CD7, KLRC2 (NKG2C), TNFRS18 (GITR), TNFRSF14 (HVEM) или любого их сочетания.

[503] В определенных аспектах сконструированный рецептор связывается с мишенью. В определенных аспектах связывание является специфичным к пептиду, специфического для одного или нескольких индивидуумов, страдающих заболеванием или состоянием.

[504] В определенных аспектах иммунотерапевтическое средство представляет собой клетку, как подробно описано в настоящем описании. В определенных аспектах иммунотерапевтическое средство представляет собой клетку, содержащую рецептор, который специфически связывает пептид. В определенных аспектах иммунотерапевтическое средство представляет собой клетку, используемую в комбинации с пептидами/нуклеиновыми кислотами по настоящему изобретению. В определенных вариантах осуществления клетка является клеткой пациента. В определенных вариантах осуществления клетка представляет собой Т-клетку. В определенных вариантах осуществления клетка представляет собой инфильтрирующий опухоль лимфоцит.

[505] В определенных аспектах индивидуума с состоянием или заболеванием лечат в зависимости от репертуара Т-клеточного рецептора индивидуума. В определенных вариантах осуществления антигенную вакцину выбирают на основании репертуара Т-клеточного рецептора индивидуума. В определенных вариантах осуществления индивидуума лечат Т-клетками, экспрессирующими TCR, специфические к антигену или пептиду. В определенных вариантах осуществления индивидуума лечат антигеном или пептидом, специфичным к TCR, например, TCR, специфическими для индивидуума. В определенных вариантах осуществления индивидуума лечат антигеном или пептидом, специфичным к Т-клеткам, экспрессирующим TCR, например, TCR специфические для индивидуума. В определенных вариантах осуществления индивидуума лечат антигеном или пептидом, специфичным к TCR специфическим для индивидуума.

[506] В определенных вариантах осуществления иммуногенная антигенная композиция или вакцина выбрана на основе TCR, идентифицированных у одного или более индивидуумов. В определенных вариантах осуществления идентификация репертуара Т-клеток и тестирование в функциональных анализах используют для определения иммуногенной композиции или вакцины, которую необходимо вводить одному или более индивидуумам с состоянием или заболеванием. В определенных вариантах осуществления иммуногенная композиция представляет собой антигенную вакцину. В определенных вариантах осуществления антигенная вакцина содержит специфические для индивидуума антигенные пептиды. В определенных вариантах осуществления антигенные пептиды, которые необходимо вводить в антигенную вакцину, выбирают на основе количественного определения специфических для индивидуума TCR, которые связываются с антигенами. В определенных вариантах осуществления антигенные пептиды выбирают на основе аффинности связывания пептида с TCR. В определенных вариантах осуществления выбор основан на комбинации, как количества, так и аффинности связывания. Например, TCR, который сильно связывает антиген в функциональном анализе, но который в значительной степени представлен в репертуаре TCR, может быть хорошим кандидатом для антигенной вакцины, т.к. преимущественно Т-клетки, экспрессирующие TCR, будут размножаться.

[507] В определенных вариантах осуществления изобретения антигены выбирают для введения одному или более индивидуумам на основании связывания с TCR. В определенных вариантах осуществления можно размножать Т-клетки, такие как Т-клетки от индивидуума с заболеванием или состоянием. Размноженные Т-клетки, которые экспрессируют TCR, специфичные к иммуногенному антигенному пептиду, можно вводить обратно индивидууму. В определенных вариантах осуществления подходящие клетки, например, РВМС, трансдуцируют или трансфицируют полинуклеотидами для экспрессии TCR, специфичных к иммуногенному антигенному пептиду, и вводят индивидууму. Т-клетки, экспрессирующие TCR, специфичные к иммуногенному антигенному пептиду, можно размножать и вводить обратно индивидууму. В определенных вариантах осуществления Т-клетки, которые экспрессируют TCR, специфичные к иммуногенному антигенному пептиду, которые приводят к цитолитической активности при инкубации с аутологичной пораженной тканью, можно размножать и вводить пациенту. В определенных вариантах осуществления Т-клетки, используемые в функциональных анализах, приводящих к связыванию с иммуногенным антигенным пептидом, можно размножать и вводить пациенту. В определенных вариантах осуществления TCR, которые, как было определено, связываются со специфическими для индивидуума иммуногенными антигенными пептидами, можно экспрессировать в Т-клетках и вводить индивидууму.

Костимулирующие лиганды

[508] В определенных вариантах осуществления предоставлены клетки по изобретению по меньшей мере с одним костимулирующим лигандом, который не является антигенспецифическим сигналом, важным для полной активации иммунной клетки. Костимулирующие лиганды включают, но не ограничиваются ими, лиганды фактора некроза опухоли (TNF), цитокины (такие как IL-2, IL-12, IL-15 или IL21) и суперсемейство лигандов иммуноглобулина (Ig).

[509] Фактор некроза опухоли (TNF) представляет собой цитокин, участвующий в системном воспалении и стимулирующий острофазовую реакцию. Его основная роль заключается в регуляции иммунных клеток. Лиганды фактора некроза опухоли (TNF) имеют ряд общих черт. Большинство лигандов синтезируются как трансмембранные белки II типа, содержащие короткий цитоплазматический сегмент и относительно длинный внеклеточный участок. Лиганды TNF включают, без ограничения, фактор роста нервов (NGF), CD4OL (CD4OL)/CD154, CD137L/4-1BBL, фактор некроза опухоли альфа (TNFα), CD134L/OX4OL/CD252, CD27L/CD70, лиганд Fas (FasL), CD3OL/CD153, фактор некроза опухолей β (TNF β)/лимфотоксин-альфа (LTa), лимфотоксин-бета (ур (3), клеточный активирующий фактор CD257/B (BAFF)/Blys/THANK/Ta11-1, индуцированный апоптозом лиганд TNF (TRAIL), LIGHT (TNFSF14). Суперсемейство иммуноглобулина (Ig) представляет собой большую группу белков клеточной поверхности и растворимых белков, которые участвуют в распознавании, связывания или адгезии клеток. Эти белки имеют общие структурные особенности с иммуноглобулинами - они содержат иммуноглобулиновым доменом (складку). Суперсемейство лигандов иммуноглобулинов включают, без ограничения, CD80 и CD86, оба лиганда для CD28.

[510] Композиции, содержащие генетически модифицированные иммунореактивные клетки по изобретению, можно предоставлять системно или непосредственно индивидууму для лечения неоплазии. В определенных вариантах осуществления клетки по изобретению непосредственно инъецируют в представляющий интерес орган (например, орган, пораженный опухолью). Альтернативно, композиции, содержащие генетически модифицированные иммунореактивные клетки, предоставляют непосредственно в представляющий интерес орган, например, посредством введения в систему кровообращения (например, сосудистую систему опухоли). Стимулирующие размножение средства и дифференцировку можно предоставлять до, во время или после введения клеток для увеличения продукции Т-клеток, NK-клеток или клеток CTL in vitro или in vivo.

[511] Модифицированные клетки можно вводить в любом физиологически приемлемом носителе, обычно интраваскулярно, хотя их также можно вводить в кости или в другой удобный участок, где клетки могут найти подходящий участок для регенерации и дифференцировки (например, тимус). Генетически модифицированные иммунореактивные клетки по изобретению могут содержать популяцию очищенных клеток. Специалисты в данной области могут легко определить процент генетически модифицированных иммунореактивных клеток в популяции с использованием различных известных способов, таких как активированная флуоресценцией сортировка клеток (FACS). Специалисты в данной области могут легко подбирать дозировки (например, уменьшение чистоты может требовать увеличения дозы). Клетки можно вводить посредством инъекции, катетера и т.п. При желании также можно вводить факторы, включая, но не ограничиваясь ими, интерлейкины, например, IL-2, IL-3, IL-6 и IL-11, а также другие интерлейкины, колониестимулирующие факторы, такие как G-, M- и GM-CSF, интерфероны, например, интерферон γ и эритропоэтин.

[512] Композиции по изобретению включают фармацевтические композиции, содержащие генетически модифицированные иммунореактивные клетки или их предшественников и фармацевтически приемлемый носитель. Введение может быть аутологичным или гетерологичным. Например, иммунореактивные клетки или предшественники можно получать от одного индивидуума и вводить одному и тому же индивидууму или другому совместимому индивидууму. Получаемые из периферической крови иммунореактивные клетки по изобретению или их потомство (например, in vivo, ex vivo или in vitro) можно вводить посредством локализованной инъекции, включая введение катетера, системную инъекцию, локализованную инъекцию, внутривенную инъекцию или парентерального введения. При введении терапевтической композиции по настоящему изобретению (например, фармацевтической композиции, содержащей генетически модифицированную иммунореактивную клетку) ее, как правило, формулируют в виде стандартной инъецируемой дозы (раствора, суспензии, эмульсии).

VII. Способы использования и фармацевтические композиции

[513] Терапевтические средства на основе неоантигена (например, пептиды, полинуклеотиды, TCR, CAR, клетки, содержащие TCR или CAR, дендритные клетки, содержащие полипептид, дендритные клетки, содержащие полинуклеотид, антитело и т.д.), описываемые в настоящем описании, являются пригодными в ряде применений, включая, но, не ограничиваясь ими, способы терапевтического лечения, такие как лечение злокачественной опухоли. В определенных вариантах осуществления способы терапевтического лечения включают иммунотерапию. В определенных вариантах осуществления неоантигеновый пептид является пригодным для активации, стимуляция, увеличения и/или усиления иммунного ответа, перенаправления существующего иммунного ответа на новую мишень, увеличения иммуногенности опухоли, ингибирования роста опухоли, уменьшения объема опухоли, увеличения апоптоза опухолевых клеток и/или уменьшение онкогенности опухоли. Способы применения могут быть in vitro, ex vivo или in vivo.

[514] В определенных аспектах настоящее изобретение относится к способам активации иммунного ответа у индивидуума с использованием терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления изобретение относится к способам стимуляции иммунного ответа у индивидуума с использованием терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления изобретение относится к способам повышения иммунного ответа у индивидуума с использованием неоантигенного пептида, описываемого в настоящем описании. В определенных вариантах осуществления изобретение относится к способам усиления иммунного ответа с использованием неоантигенного пептида. В определенных вариантах осуществления активация, стимуляция, увеличение и/или усиление иммунного ответа включает увеличение клеточного иммунитета. В определенных вариантах осуществления активация, стимуляция, увеличение и/или усиление иммунного ответа включает увеличение активности T-клеток или гуморального иммунитет. В определенных вариантах осуществления активация, стимуляция, увеличение и/или усиление иммунного ответа включает увеличение активности CTL или HTL. В определенных вариантах осуществления активация, стимуляция, увеличение и/или усиление иммунного ответа включает увеличение активности NK клеток. В определенных вариантах осуществления активация, стимуляция, увеличение и/или усиление иммунного ответа включает увеличение активности T-клеток и увеличение активности NK клеток. В определенных вариантах осуществления активация, стимуляция, увеличение и/или усиление иммунного ответа включает увеличение активности CTL и увеличение активности NK клеток. В определенных вариантах осуществления активация, стимуляция, увеличение и/или усиление иммунного ответа включает ингибирование или понижение супрессивной активность Treg. В определенных вариантах осуществления иммунный ответ является результатом антигенной стимуляции. В определенных вариантах осуществления антигенная стимуляция представляет собой опухолевую клетку. В определенных вариантах осуществления антигенная стимуляция представляет собой злокачественную опухоль.

[515] В определенных вариантах осуществления изобретение относится к способам активации, стимуляции, увеличении и/или усилении иммунного ответа с использованием терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, которое доставляет неоантигенный полипептид или полинуклеотид в опухолевую клетку. В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, которое связывается с опухолеассоциированным антиген и интернализуется опухолевой клеткой. В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества неоантигеного полипептида, который интенализуется опухолевой клеткой, и неоантигенный пептид процессируется клеткой. В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества неоантигеного полипептида, который интенализуется опухолевой клеткой, и антигенный пептид презентируется на поверхности опухолевой клетки. В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества неоантигеного полипептида, который интенализуется опухолевой клеткой, процессируется клеткой, и антигенный пептид презентируется на поверхности опухолевой клетки.

[516] В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества неоантигеного полипептида или полинуклеотида, описываемого в настоящем описании, который доставляет экзогенный полипептид, содержащий по меньшей мере один антигенный пептид, в опухолевую клетку, где антигенный пептид презентируется на поверхности опухолевой клетки. В определенных вариантах осуществления антигенный пептид презентируется на поверхности опухолевой клетки в комплексе с молекулой MHC I класса. В определенных вариантах осуществления антигенный пептид презентируется на поверхности опухолевой клетки в комплексе с молекулой MHC II класса.

[517] В определенных вариантах осуществления способ включает приведение опухолевой клетки в контакт с неоантигенным полипептидом или полинуклеотидом, описываемым в настоящем описании, который доставляет экзогенный полипептид, содержащий по меньшей мере один антигенный пептид, в опухолевую клетку, где антигенный пептид презентируется на поверхности опухолевой клетки. В определенных вариантах осуществления антигенный пептид презентируется на поверхности опухолевой клетки в комплексе с молекулой MHC I класса. В определенных вариантах осуществления антигенный пептид презентируется на поверхности опухолевой клетки в комплексе с молекулой MHC II класса.

[518] В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества неоантигеного полипептида или полинуклеотида, описываемого в настоящем описании, который доставляет экзогенный полипептид, содержащий по меньшей мере один антигенный пептид, в опухолевую клетку, где антигенный пептид презентируется на поверхности опухолевой клетки, и индуцируется иммунный ответ против опухолевой клетки. В определенных вариантах осуществления иммунный ответ против опухолевой клетки повышается. В определенных вариантах осуществления неоантиген полипептид или полинуклеотид доставляет экзогенный полипептид, содержащий по меньшей мере один антигенный пептид, в опухолевую клетку, где антигенный пептид презентируется на поверхности опухолевой клетки, и ингибируют рост опухоли.

[519] В определенных вариантах осуществления способ включает введение нуждающемуся в этом индивидууму терапевтически эффективного количества неоантигеного полипептида или полинуклеотида, описываемого в настоящем описании, который доставляет экзогенный полипептид, содержащий по меньшей мере один антигенный пептид, в опухолевую клетку, где антигенный пептид презентируется на поверхности опухолевой клетки, и индуцируется цитотоксическая активность T-клеток, направленная против опухолевой клетки. В определенных вариантах осуществления цитотоксическая активность T-клеток, направленная против опухолевой клетки, усиливается. В определенных вариантах осуществления цитотоксическая активность T-клеток, направленная против опухолевой клетки, увеличивается.

[520] В определенных вариантах осуществления способ повышения иммунного ответа у индивидуума включает введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, описываемого в настоящем описании, где средство представляет собой антитело, которое специфически связывается с неоантигеном, описываемым в настоящем описании. В определенных вариантах осуществления способ повышения иммунного ответ у индивидуума включает введение индивидууму терапевтически эффективного количества антитела.

[521] Настоящее изобретение относится к способам перенаправления существующего иммунного ответа на опухоль. В определенных вариантах осуществления способ перенаправления существующего иммунного ответа на опухоль включает введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления существующий иммунный ответ направлен против вируса. В определенных вариантах осуществления вирус выбран из группы, состоящей из: вируса кори, вируса варицелла-зостер (VZV; вируса ветряной оспы), вируса гриппа, вируса эпидемического паротита, полиовируса, вируса краснухи, ротавируса, вируса гепатита A (HAV), вируса гепатита B (HBV), вируса Эпштейна-Барр (EBV) и цитомегаловируса (CMV). В определенных вариантах осуществления вирус представляет собой вирус варицелла-зостер. В определенных вариантах осуществления вирус представляет собой цитомегаловирус. В определенных вариантах осуществления вирус представляет собой вирус кори. В определенных вариантах осуществления существующий иммунный ответ был приобретен после естественной инфекции вирусом. В определенных вариантах осуществления существующий иммунный ответ был приобретен после вакцинации против вируса. В определенных вариантах осуществления существующий иммунный ответ представляет собой клеточно-опосредованный ответ. В определенных вариантах осуществления существующий иммунный ответ включает цитотоксические T-клетки (CTL) или HTL.

[522] В определенных вариантах осуществления способ перенаправления существующего иммунного ответа на опухоль у индивидуума включает введение слитого белка, содержащего (i) антитело, которое специфически связывается с неоантигеном, и (ii) по меньшей мере один неоантигенный пептид, описываемый в настоящем описании, где (a) слитый белок интернализуется опухолевой клеткой после связывания с опухолеассоциированным антигеном; (b) неоантигенный пептид процессируется и презентируется на поверхности опухолевой клетки, связанной с молекулой MHC I класса; и (c) комплекс неоантигенный пептид/MHC I класса распознается цитотоксическими T-клетками. В определенных вариантах осуществления цитотоксические T-клетки представляют собой T-клетки памяти. В определенных вариантах осуществления T-клетки памяти являются результатом вакцинации неоантигенным пептидом.

[523] Настоящее изобретение относится к способам повышения иммуногенности опухоли. В определенных вариантах осуществления способ повышения иммуногенности опухоли включает приведение опухоли или опухолевых клеток в контакт с эффективным количеством терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления способ повышения иммуногенности опухоли включает введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, описываемого в настоящем описании.

[524] Настоящее изобретение также относится к способам ингибирования роста опухоли с использованием терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления способ ингибирования роста опухоли включает приведение смеси клеток в контакт с терапевтическим средством на основе неоантигена in vitro. Например, иммортализованную линию клеток или линию злокачественных клеток, смешанных с иммунными клетками (например, T-клетками) культивируют в среде, к которой добавляют неоантигенный пептид. В определенных вариантах осуществления опухолевые клетки выделяют из образца от пациента, например, биопсии ткани, плеврального выпота или образца крови, смешивают с иммунными клетками (например, T-клетками) и культивируют в среде, к которой добавляют терапевтическое средство на основе неоантигена. В определенных вариантах осуществления терапевтическое средство на основе неоантигена увеличивает, стимулирует и/или усиливает активность иммунных клеток. В определенных вариантах осуществления терапевтическое средство на основе неоантигена ингибирует рост опухолевой клетки. В определенных вариантах осуществления терапевтическое средство на основе неоантигена активирует цитолиз опухолевых клеток.

[525] В определенных вариантах осуществления индивидуум является человеком. В определенных вариантах осуществления индивидуум страдает опухолью, или индивидуум страдал опухолью, которую по меньшей мере частично удалили.

[526] В определенных вариантах осуществления способ ингибирования роста опухоли включает перенаправление существующего иммунного ответа на новую мишень, включающее введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, где существующий иммунный ответ направлен против антигенного пептида, доставляемого в опухолевую клетку неоантигенным пептидом.

[527] В определенных вариантах осуществления опухоль содержит злокачественные стволовые клетки. В определенных вариантах осуществления частота встречаемости злокачественных стволовых клеток в опухоли снижается в результате введения неоантигенного терапевтического средства. В определенных вариантах осуществления предоставлен способ снижения частоты встречаемости злокачественных стволовых клеток в опухоли у индивидуума, включающий введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена.

[528] Кроме того, в определенных аспектах изобретение относится к способу уменьшения онкогенность опухоли у индивидуума, включающему введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления опухоль содержит злокачественные стволовые клетки. В определенных вариантах осуществления онкогенность опухоли снижают путем уменьшения частоты встречаемости злокачественных стволовых клеток в опухоли. В определенных вариантах осуществления способы включают использование терапевтического средства на основе неоантигена, описываемого в настоящем описании. В определенных вариантах осуществления частоту встречаемости злокачественных стволовых клеток в опухоли уменьшают введением терапевтического средства на основе неоантигена, описываемого в настоящем описании.

[529] В определенных вариантах осуществления опухоль представляет собой солидную опухоль. В определенных вариантах осуществления опухоль представляет собой опухоль, выбранную из группы, состоящей из: колоректальной опухоли, опухоли поджелудочной железы, опухоли легкого, опухоли яичника, опухоли печени, опухоли молочной железы, опухоли почки, опухоли предстательной железы, нейроэндокринной опухоли, желудочно-кишечной опухоли, опухоли в виде меланомы, опухоли шейки матки, опухоли мочевого пузыря, глиобластомы и опухоли головы и шеи. В определенных вариантах осуществления опухоль представляет собой колоректальную опухоль. В определенных вариантах осуществления опухоль представляет собой опухоль яичника. В определенных вариантах осуществления опухоль представляет собой опухоль молочной железы. В определенных вариантах осуществления опухоль представляет собой опухоль легкого. В определенных вариантах осуществления опухоль представляет собой опухоль поджелудочной железы. В определенных вариантах осуществления опухоль представляет собой опухоль в виде меланомы. В определенных вариантах осуществления опухоль представляет собой солидную опухоль.

[530] Настоящее изобретение дополнительно относится к способам лечения злокачественной опухоли у индивидуума, включающим введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, описываемого в настоящем описании.

[531] В определенных вариантах осуществления способ лечения злокачественной опухоли включает перенаправление существующего иммунного ответа на новую мишень, где способ включает введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, где существующий иммунный ответ направлен против антигенного пептида, доставляемого в злокачественную клетку неоантигенным пептидом.

[532] Настоящее изобретение относится к способам лечения злокачественной опухоли, включающим введение индивидууму терапевтически эффективного количества терапевтического средства на основе неоантигена, описываемого в настоящем описании, (например, нуждающемуся в лечении индивидууму). В определенных вариантах осуществления индивидуум является человеком. В определенных вариантах осуществления индивидуум страдает злокачественной опухолью. В определенных вариантах осуществления индивидуум страдал опухолью по меньшей мере частично удаленной.

[533] В определенных вариантах осуществления злокачественная опухоль представляет собой злокачественную опухоль, выбранную из группы, состоящей из колоректального рака, рака поджелудочной железы, рака легких, рака яичника, рака печени, рака молочной железы, рака почки, рака предстательной железы, желудочно-кишечного рака, меланомы, рака шейки матки, нейроэндокринного рака, рака мочевого пузыря, глиобластомы и рака головы и шеи. В определенных вариантах осуществления злокачественная опухоль представляет собой рак поджелудочной железы. В определенных вариантах осуществления злокачественная опухоль представляет собой рак яичника. В определенных вариантах осуществления злокачественная опухоль представляет собой колоректальный рак. В определенных вариантах осуществления злокачественная опухоль представляет собой рак молочной железы. В определенных вариантах осуществления злокачественная опухоль представляет собой рак предстательной железы. В определенных вариантах осуществления злокачественная опухоль представляет собой рак легких. В определенных вариантах осуществления злокачественная опухоль представляет собой меланому. В определенных вариантах осуществления злокачественная опухоль представляет собой солидную злокачественную опухоль. В определенных вариантах осуществления злокачественная опухоль содержит солидную опухоль.

[534] В определенных вариантах осуществления злокачественная опухоль представляет собой гематологическую злокачественную опухоль. В определенном варианте осуществления злокачественная опухоль выбрана из группы, состоящей из: острого миелогенного лейкоза (AML), лимфомы Ходжкина, множественной миеломы, T-клеточного острого лимфобластного лейкоза (T-ALL), хронического лимфоцитарного лейкоза (CLL), волосатоклеточного лейкоза, хронического миелогенного лейкоза (CML), неходжкинской лимфомы, диффузной крупноклеточной B-клеточной лимфомы (DLBCL), лимфомы мантийных клеток (MCL) и T-клеточной лимфомы кожи (CTCL).

[535] В определенных вариантах осуществления терапевтическое средство на основе неоантигена вводят в виде комбинированного лечения. В комбинированном лечении двумя или более терапевтическими средствами используют средства, которые работают по различным механизмам действия, хотя это не является необходимым. Комбинированное лечение с использованием средства с различными механизмами действия может приводить к аддитивным или синергическим эффектам. Комбинированное лечение может обеспечивать возможность более низкой дозы каждого средства, чем используют в монотерапии, таким образом, уменьшая токсические побочные эффекты и/или увеличивая терапевтических индекс средства(в). Комбинированное лечение может снижать вероятность того, что устойчивые злокачественные клетки будут развиваться. В определенных вариантах осуществления комбинированное лечение включает терапевтическое средство, которое действует на иммунный ответ (например, усиливает или активирует ответ), и терапевтическое средство, которое действует (например, ингибирует или уничтожает) на опухоль/злокачественные клетки.

[536] Злокачественные опухоли включают, но не ограничиваются ими, B-клеточную злокачественную опухоль, например, множественную миелому, макроглобулинемию Вальденстрема, болезни тяжелых цепей, такую как, например, болезнь альфа-тяжелых цепей, болезнь гамма-тяжелых цепей и болезнь мю-тяжелых цепей, доброкачественную моноклональную гаммапатию и иммуноцитарный амилоидоз, меланомы, рак молочной железы, рак легких, рак бронхов, колоректальный рак, рак предстательной железы (например, метастатический, гормонорезистентный рак предстательной железы), рак поджелудочной железы, рак желудка, рак яичника, рак мочевого пузыря, злокачественную опухоль головного мозга или центральной нервной системы, злокачественную опухоль периферической нервной системы, рак пищевода, рак шейки матки, рак матка или эндометрия, рак ротовой полости или глотки, рак печени, рак почки, рак яичка, рак желчных протоков, рак тонкого кишечника или аппендикса, рак слюнных желез, рак щитовидной железы, рак надпочечников, остеосаркому, хондросаркому, злокачественную опухоль гематологических тканей и т.п. Другие неограничивающие примеры типов злокачественных опухолей, применимых к способам, входящих в настоящее изобретение, включают саркомы и карциномы человека, например, фибросаркому, миксосаркому, липосаркому, хондросаркому, остеогенную саркому, хордому, ангиосаркому, эндотелиосаркому, лимфангиосаркому, лимфангиоэндотелиосаркому, синовиому, мезотелиому, опухоль Юинга, лейомиосаркому, рабдомиосаркому, карциному толстой кишки, колоректальный рак, рак поджелудочной железы, рак молочной железы, рак яичника, плоскоклеточную карциному, базально-клеточную карциному, аденокарциному, карциному потовых желез, карциному сальных желез, папиллярную карциному, папиллярные аденокарциномы, цистаденокарциному, медуллярную карциному, бронхогенную карциному, почечноклеточную карциному, гепатому, карциному желчных протоков, рак печени, хориокарциному, семиному, эмбриональную карциному, опухоль Вильмса, рак шейки матки, рак кости, опухоль головного мозга, рак яичка, карциному легкого, мелкоклеточную карциному легкого, карциному мочевого пузыря, эпителиальную карциному, глиому, астроцитому, медуллобластому, краниофарингиому, эпендимому, пинеалому, гемангиобластому, неврому слухового нерва, олигодендроглиому, менингиому, меланому, нейробластому, ретинобластому; лейкозы, например, острый лимфоцитарный лейкоз и острый миелоцитарный лейкоз (миелобластный, промиелоцитарный, миеломоноцитарный, моноцитарный и эритролейкоз); хронический лейкоз (хронический миелоцитарный (гранулоцитарный) лейкоз и хронический лимфоцитарный лейкоз) и истинную полицитемию, лимфому (болезнь Ходжкина и неходжкинскую лимфому), множественную миелому, макроглобулинемию Вальденстрема и болезнь тяжелых цепей. В определенных вариантах осуществления злокачественная опухоль, фенотип которой определяют способом по изобретению, представляет собой эпителиальную злокачественную опухоль, такую как, но, не ограничиваясь ими рак мочевого пузыря, рак молочной железы, рак шейки матки, рак толстого кишечника, гинекологический рак, рак почки, рак гортани, рак легких, злокачественную опухоль ротовой полости, рак рака головы и шеи, рак яичника, рак поджелудочной железы, рак предстательной железы или рак кожи. В других вариантах осуществления злокачественная опухоль представляет собой рак молочной железы, рак предстательной железы, рак легких или рак толстого кишечника. В других вариантах осуществления эпителиальная злокачественная опухоль представляет собой немелкоклеточный рак легких, непапиллярную почечноклеточную карциному, карциному шейки матки, карциному яичника (например, серозную карциному яичника) или карциному молочной железы. Эпителиальные злокачественные опухоли можно характеризовать рядом других способов, включая, но, не ограничиваясь ими, серозные, эндометриоидные, слизеобразующие, светлоклеточные, Бреннера или недифференцированные. В определенных вариантах осуществления настоящее изобретение используют при лечении, диагностики и/или прогноза лимфомы или ее подтипов включая, но, не ограничиваясь ими, лимфому мантийных клеток. Лимфопролиферативные нарушения также считаются пролиферативными заболеваниями.

[537] В определенных вариантах осуществления комбинация средства, описываемого в настоящем описании, и по меньшей мере одного дополнительного терапевтического средства приводит к аддитивным или синергическим результатам. В определенных вариантах осуществления комбинированное лечение приводит к увеличению терапевтического индекса средства. В определенных вариантах осуществления комбинированное лечение приводит к увеличению терапевтического индекса дополнительного терапевтического средства(в). В определенных вариантах осуществления комбинированное лечение приводит к уменьшению токсичности и/или побочных эффектов средства. В определенных вариантах осуществления комбинированное лечение приводит к уменьшению токсичности и/или побочных эффектов дополнительного терапевтического средства(в).

[538] В определенных вариантах осуществления в дополнение к введению терапевтическое средство на основе неоантигена, описываемого в настоящем описании, способ или лечение дополнительно включает введение по меньшей мере одного дополнительного терапевтического средства. Дополнительное терапевтическое средство можно вводить до, одновременно и/или после введения средства. В определенных вариантах осуществления по меньшей мере одно дополнительное терапевтическое средство включает 1, 2, 3 или более дополнительных терапевтических средств.

[539] Терапевтические средства, которые можно вводить в комбинации с терапевтическим средством на основе неоантигена, описываемого в настоящем описании, включают химиотерапевтические средства. Таким образом, в определенных вариантах осуществления способ или лечение включает введение средства, описываемого в настоящем описании, в комбинации с химиотерапевтическим средством или в комбинации со смесью химиотерапевтических средств. Лечение средством можно проводить до, одновременно или вслед за проведением химиотерапии. Комбинированное введение может включать совместное введение в одном фармацевтическом составе или с использованием отдельных составов, или последовательное введение в любом порядке, но, как правило, в течение такого периода времени, что все активные средства могут проявлять виды своей биологической активности одновременно. Получение и схемы дозирования каждого из химиотерапевтических средств можно использовать по инструкциям производителя или как эмпирически определяет практикующий специалист. Препарат и схемы дозирования для каждой химиотерапии также описаны в The Chemotherapy Source Book, 4th Edition, 2008, M. C. Perry, Editor, Lippincott, Williams & Wilkins, Philadelphia, PA.

[540] Пригодные классы химиотерапевтическихих средств включают, например, антитубулиновые средства, ауристатины, связывающие малую бороздку ДНК средства, ингибиторы репликации ДНК, алкилирующие средства (например, комплексы платины, такие как цисплатин, моно(платина), биз(платина) и трехядерные комплексы платины и карбоплатин), антрациклины, антибиотики, антифолаты, антиметаболиты, сенсибилизирующее вещество для химиотерапии, дуокармицин, этопозиды, фторсодержащий пиримидины, ионофоры, лекситропсины, нитрозомочевины, платинолы, антиметаболиты пурина, пуромицины, сенсибилизирующее вещество для облучения, стероиды, таксаны, ингибиторы топоизомеразы, алкалоиды барвинка или т.п. В определенных вариантах осуществления второе терапевтическое средство представляет собой алкилирующее средство, антиметаболит, антимитотическое средство, ингибитор топоизомеразы или ингибитор ангиогенеза.

[541] Химиотерапевтические средства пригодные в настоящем изобретении включают, но не ограничиваются ими, алкилирующие средства, такие как тиотепа и циклофосфамид (CYTOXAN); алкилсульфонаты, такие как бусульфан, импросульфан и пипосульфан; азиридины, такие как бензодопа, карбоквон, метуредопа и уредопа; этиленимины и метиламелаинин, включая алтретамин, триэтиленмеламин, триэтиленфосфорамид, триэтилентиофосфарамид и триметилoлмеламин; азотистые иприты, такие как хлорамбуцил, хлорнафазин, холофосфамид, эстрамустин, ифосфамид, мехлоретамин, гидрохлорид оксида мехлорэтамина, мелфалан, новэмбихин, фенестеин, преднимустин, трофосфамид, урамустин; нитрозомочевины, такие как кармустин, хлорзотоцин, фотемустин, ломустин, нимустин, ранимустин; антибиотики, такие как аклациномизины, актиномицин, аутрамицин, азасерин, блеомицины, кактиномицин, калихимицин, карабицин, каминомицин, карзинофилин, хромомицины, дактиномицин, даунорубицин, детоубицин, 6-диазо-5-оксо-L-норлейцин, доксорубицин, эпирубицин, эзорубицин, идарубицин, марцелломицин, митомицины, микофеноловую кислоту, ногаламицин, оливомицины, пепломицин, порфиромицин, пиромицин, квеламицин, родорубицин, стрептонигрин, стрептозоцин, туберцидин, убенимекс, зиностатин, зорубицин; антиметаболиты, такие как метотрексат и 5-фторурацил (5-FU); аналоги фолиевой кислоты, такие как деноптерин, метотрексат, птероптерин, триметриксат; аналоги пуринов, такие как флударабин, 6-меркаптопурин, тиамиприн, тиогуанин; аналоги пиримидинов, такие как анцитабин, азацитидин, 6-азауридин, кармофур, цитозинарабинозид, дидезоксиуридин, доксифлуридин, эноцитабин, флоксуридин, 5-FU; андрогены, такие как калустерон, дромостанолон пропионат, эпитиостанол, мепитиостан, тестолактон; противонадпочечниковые средства, такие как аминоглютетимид, митотан, трилостан; пополнители фолиевой кислоты, такие как флориновая кислота; ацеглатон; гликозид альдофосфамид аминолевулиновую кислоту; амсакрин; бестрабуцил; бисантрен, эдатраксат; дефофамин; демекольцин; диазиквон; эльфорнитин; эллиптина ацетат; этоглюцид; нитрат галлия; гидроксимочевину; лентинан; лонидаинин; митагуазон; митоксантрон; мопиданмол; нитракрин; пентостатин; фенамет; пирарубицин; лозоксантрон; подофиллиновую кислоту; 2-этилгидразид; прокарбазин; PSK; разоксан; сизофиран; спирогерманий; тенуазоновую кислоту; триазиквон; 2,2',2"-трихлортриэтиламин; уретан; виндезин; дакарбазин; манномустин; митобронитол; митолактол; пипоброман; гацитозин; арабинозид (Ara-С); таксоиды, например, паклитаксел (ТАКСОЛ) и доцетаксел (ТАКСОТЕР); хлорамбуцил; гемцитабин; 6-тиогуанин; меркаптопурин; аналоги платины, такие как цисплатин и карбоплатин; винбластин; платина; этопозид (VP-16); ифосфамид; митомицин C; митоксантрон; винкристин; винорелбин; навельбин; новантрон; тенипозид; дауномицин; аминоптерин; ибандронат; CPT11; ингибитор топоизомеразы RFS 2000; дифторметилорнитин (DMFO); ретиноевую кислоту; эсперамицины; капецитабин (КСЕЛОДА) и фармацевтически приемлемые соли, кислоты или производные любого из перечисленных выше соединений. Химиотерапевтические средства также включают противогормональные средства, которые действуют, регулируя или ингибируя действие гормона на опухоли, такие как антиэстрогены, включая, например, тамоксифен, ралоксифен, ингибирующие ароматазу 4(5)-имидазолы, 4-гидрокситамоксифен, триоксифен, кеоксифен, LY117018, онапристон и торемифен (ФАРЕСТОН), и антиандрогены, такие как флутамид, нилутамид, бикалутамид, лейпролид и гозерелин, и фармацевтически приемлемые соли, кислоты или производные любого из перечисленных выше соединений. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой цисплатин. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой карбоплатин.

[542] В определенных вариантах осуществления химиотерапевтическое средство представляет собой ингибитор топоизомеразы. Ингибиторы топоизомеразы представляют собой химиотерапевтические средства, которые мешают действию фермента топоизомеразы (например, топоизомеразы I или II). Ингибиторы топоизомеразы включают, но не ограничиваются ими, доксорубицин HCl, даунорубицина цитрат, митоксантрон HCl, актиномицин D, этопозид, топотекан HCl, тенипозид (VM-26) и иринотекан, а также фармацевтически приемлемые соли, кислоты или производные любого из указанных выше соединений. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой иринотекан.

[543] В определенных вариантах осуществления химиотерапевтическое средство представляет собой антиметаболит. Антиметаболит представляет собой химическое соединение со структурой, которая является схожей с метаболитом, необходимым для нормальных биохимических реакций, но достаточно различный, чтобы препятствовать одой или более нормальным функциям клеток, таким как деление клеток. Антиметаболиты включают, но не ограничиваются ими, гемцитабин, фторурацил, капецитабин, метотрексат натрия, ралитрексед, пеметрексед, тегафур, цитозинарабинозид, тиогуанин, 5-азацитидин, 6 меркаптопурин, азатиоприн, 6-тиогуанин, пентостатин, фосфат флударабина и кладрибин, а также фармацевтически приемлемые соли, кислоты или производные любого из указанных выше соединений. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой гемцитабин.

[544] В определенных вариантах осуществления химиотерапевтическое средство представляет собой антимитотическое средство, включая, но, не ограничиваясь ими, средства, которые связывают тубулин. В определенных вариантах осуществления средство представляет собой таксан. В определенных вариантах осуществления средство представляет собой паклитаксел или доцетаксел, или фармацевтически приемлемую соль, кислоту или производное паклитаксела или доцетаксела. В определенных вариантах осуществления средство представляет собой паклитаксел (ТАКСОЛ), доцетаксел (ТАКСОТЕР), связанный с альбумином паклитаксел (АБРАКСАН), DHA-паклитаксел или PG-паклитаксел. В определенных альтернативных вариантах осуществления антимитотическое средство содержит алкалоид барвинка, такой как винкристин, винбластин, винорелбин или виндезин, или их фармацевтически приемлемые соли, кислоты или производные. В определенных вариантах осуществления антимитотическое средство представляет собой ингибитор кинезина Eg5 или ингибитор митотической киназы, такой как Aurora A или Plk1. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой паклитаксел. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой связанный с альбумином паклитаксел.

[545] В определенных вариантах осуществления дополнительное терапевтическое средство включает средство, такое как низкомолекулярное соединение. Например, лечение может включать комбинированное введение средства по настоящему изобретению с низкомолекулярным соединением, которое действует как ингибитор против опухолеассоциированных антигенов, включая, но, не ограничиваясь ими, EGFR, HER2 (ErbB2) и/или VEGF. В определенных вариантах осуществления средство по настоящему изобретению вводят в комбинации с ингибитором протеинкиназы, выбранным из группы, состоящей из: гефитиниба (ИРЕССА), эрлотиниба (ТАРЦЕВА), сунитиниба (СУТЕНТ), лапатаниба, вандетаниба (ЗАКТИМА), AEE788, CI-1033, седираниба (РЕСЕНТИН), сорафениба (НЕКСАВАР) и пазопаниба (GW786034B). В определенных вариантах осуществления дополнительное терапевтическое средство содержит ингибитор mTOR. В другом варианте осуществления дополнительное терапевтическое средство представляет собой химиотерапию или другие ингибиторы, которые уменьшают количество Treg-клеток. В определенных вариантах осуществления терапевтическое средство представляет собой циклофосфамид или антитело к CTLA4. В другом варианте осуществления дополнительное терапевтическое средство снижает присутствие миелоидных супрессорных клеток. В дополнительном варианте осуществления дополнительное терапевтическое средство представляет собой карботаксол. В другом варианте осуществления дополнительное терапевтическое средство сдвигает клетки в сторону ответа T-хелперов 1. В дополнительном варианте осуществления дополнительное терапевтическое средство представляет собой ибрутиниб.

[546] В определенных вариантах осуществления дополнительное терапевтическое средство содержит биологическую молекулу, такую как антитело. Например, лечение может включать комбинированное введение средства по настоящему изобретению с антителами к опухолеассоциированных антигенам, включая, но, не ограничиваясь ими, антитела, которые связывают EGFR, HER2/ErbB2 и/или VEGF. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело, специфическое к маркерам злокачественных стволовых клеток. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело, которое является ингибитором ангиогенезы (например, антитело к VEGF или рецептору VEGF). В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой бевацизумаб (АВАСТИН), рамуцирумаб, трастузумаб (ГЕРЦЕПТИН), пертузумаб (ОМНИТАРГ), панитумумаб (ВЕКТИБИКС), нимотузумаб, залутумумаб или цетуксимаб (ЭРБИТУКС).

[547] Предоставленные в настоящем описании средства и композиции можно использовать отдельно или в комбинации с общепринятыми схемами лечения, такими как хирургическая операция, облучение, химиотерапия и/или трансплантация костного мозга (аутологичная, сингенная, аллогенная или неродственная). Набор опухолевых антигенов может являться пригодным, например, в большой доле пациентов со злокачественными опухолями.

[548] В определенных вариантах осуществления по меньшей мере одно или более химиотерапевтических средств можно вводить в дополнение к композиции, содержащей иммуногенную вакцину. В определенных вариантах осуществления одно или более химиотерапевтических средств может принадлежать к различным классам химиотерапевтических средств.

[549] Примеры химиотерапевтических средств включают, но не ограничиваются ими, алкилирующие средства, такие как азотистые иприты (например, мехлоретамин (азотистый иприт), хлорамбуцил, циклофосфамид (Cytoxan®), ифосфамид и мелфалан); нитрозомочевины (например, N-нитро-N-метилмочевина, стрептозоцин, кармустин (BCNU), ломустин и семустин); алкилсульфонаты (например, бусульфан); тетразины (например, дакарбазин (DTIC), митозоломид и темозоломид (Temodar®)); азиридины (например, тиотепа, митомицин и диазиквон); лекарственные средства на основе платины (например, цисплатин, карбоплатин и оксалиплатин); неклассические алкилирующие средства, такие как прокарбазин и алтретамин (гексаметилмеламин); антиметаболиты, такие как 5-фторурацил (5-FU), 6-меркаптопурин (6-MP), капецитабин (Xeloda®), кладрибин, хлофарабин, цитарабин (Ara-C®), дефитабин, флоксуридин, флударабин, неларабин, гемцитабин (Gemzar®), гидроксимочевину, метотрексат, пеметрексед (Alimta®), пентостатин, тиогуанин, видаза; средства против микротрубочек, такие как алкалоиды барвинка (например, винкристин, винбластин, винорелбин, виндезин и винфлунин); таксаны (например, паклитаксел (Taxol®), доцетаксел (Taxotere®)); подофиллотоксин (например, этопозид и тенипозид); эпотилоны (например, иксабепилон (Ixempra®)); эстрамустин (Emcyt®); противоопухолевые антибиотики, такие как антрациклины (например, даунорубицин, доксорубицин (Adriamycin®, эпирубицин, идарубицин); актиномицин D и блеомицин; ингибиторы топоизомеразы I, такте как топотекан и иринотекан (CPT-11); ингибиторы топоизомеразы II, такие как этопозид (VP-16), тенипозид, митоксантрон, новобиоцин, мербарон и акларубицин; кортикостероиды, такие как преднизон, метилпреднизолон (Solumedrol®) и дексаметазон (Decadron®); L-аспарагиназу; бортезомиб (Velcade®); иммунотерапевтические средства, такие как ритуксимаб (Rituxan®), алемтузумаб (Campath®), талидомид, леналидомид (Revlimid®), BCG, интерлейкин-2, интерферон-альфа и вакцины против злокачественных опухолей, такие как Provenge®; гормональные терапевтические средства, такие как фулвестрант (Faslodex®), тамоксифен, торемифен (Fareston®), анастрозол (Arimidex®), эксеместан (Aromasin®), летрозол ((Femara®), мегестролацетат (Megace®), эстрогены, бикалутамид (Casodex®), флутамид (Eulexin®), нилутамид (Nilandron®), лейпролид (Lupron®) и гозерелин (Zoladex®); средства дифференцировки, такие как ретиноиды, третиноин (ATRA или Atralin®), бексаротен (Targretin®) и триоксид мышьяка (Arsenox®) и направленные терапевтические средства, такие как иматиниб (Gleevec®), гефитиниб (Iressa®) и сунитиниб (Sutent®). В определенных вариантах осуществления химиотерапия представляет собой "коктейльную" терапию. Примеры "коктейльной" терапии включают, но не ограничиваются ими, CHOP/R-CHOP (ритуксан, циклофосфамид, гидроксидоксорубицин, винкристин и преднизон), EPOCH (этопозид, преднизон, винкристин, циклофосфамид, гидроксидоксорубицин), Hyper-CVAD (циклофосфамид, винкристин, гидроксидоксорубицин, дексаметазон), FOLFOX (фторурацил (5-FU), лейковорин, оксалиплатин), ICE (ифосфамид, карбоплатин, этопозид), DHAP (в высокой дозе цитарабин [ara-C], дексаметазон, цисплатин), ESHAP (этопозид, метилпреднизолон, цитарабин [ara-C], цисплатин) и CMF (циклофосфамид, метотрексат, фторурацил).

[550] В определенных вариантах осуществления дополнительное терапевтическое средство содержит второе иммунотерапевтическое средство. В определенных вариантах осуществления дополнительное иммунотерапевтическое средство включает, но не ограничивается ими, колониестимулирующий фактор, интерлейкин, антитело, которое блокирует иммуносупрессивные функции (например, антитело к CTLA-4, антитело к CD28, антитело к CD3, антитело к PD-1, антитело к PD-L1, антитело к TIGIT), антитело, которое усиливает функции иммунных клеток (например, антитело к GITR, антитело к OX-40, антитело к CD40 или антитело к 4-1BB), Toll-подобный рецептор (например, TLR4, TLR7, TLR9), растворимый лиганд (например, GITRL, GITRL-Fc, OX-40L, OX-40L-Fc, CD40L, CD40L-Fc, лиганд 4-1BB или лиганд-Fc 4-1BB) или представитель семейства B7 (например, CD80, CD86). В определенных вариантах осуществления дополнительное иммунотерапевтическое средство направлено на CTLA-4, CD28, CD3, PD-1, PD-L1, TIGIT, GITR, OX-40, CD-40 или 4-1BB.

[551] В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой ингибитор иммунной контрольной точки. В определенных вариантах осуществления ингибитор иммунных контрольных точек представляет собой антитело к PD-1, антитело к PD-L1, антитело к CTLA-4, антитело к CD28, антитело к TIGIT, антитело к LAG3, антитело к TIM3, антитело к GITR, антитело к 4-1BB или антитело к OX-40. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело к TIGIT. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело к PD-1, выбранное из группы, состоящей из: ниволумаба (ОПДИВО), пемобролизумаба (КИТРУДА), пидилзумаба, MEDI0680, REGN2810, BGB-A317 и PDR001. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело к PD-L1, выбранное из группы, состоящей из: BMS935559 (MDX-1105), атексолизумаб (MPDL3280A), дурвалумаб (MEDI4736) и авелумаб (MSB0010718C). В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело к CTLA-4, выбранное из группы, состоящей из: ипилимумаба (ЕРВОЙ) и тремелимумаба. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело к LAG-3, выбранное из группы, состоящей из: BMS-986016 и LAG525. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело к OX-40, выбранное из группы, состоящей из: MEDI6469, MEDI0562 и MOXR0916. В определенных вариантах осуществления дополнительное терапевтическое средство представляет собой антитело к 4-1BB, выбранное из группы, состоящей из: PF-05082566.

[552] В определенных вариантах осуществления терапевтическое средство на основе неоантигена можно вводить в комбинации с биологической молекулой, выбранной из группы, состоящей из: адреномедуллина (AM), ангиопоэтина (Ang), BMP, BDNF, EGF, эритропоэтина (EPO), FGF, GDNF, гранулоцитарного колониестимулирующего фактора (G-CSF), гранулоцитарно-макрофагального колониестимулирующего фактора (GM-CSF), макрофагального колониестимулирующего фактора (M-CSF), фактора стволовых клеток (SCF), GDF9, HGF, HDGF, IGF, фактора стимуляции миграции, миостатин (GDF-8), NGF, нейротрофинов, PDGF, тромбопоэтина, TGFα, TGFβ, TNFα, VEGF, PlGF, гамма-IFN, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-12, IL-15 и IL-18.

[553] В определенных вариантах осуществления лечение терапевтическим средством на основе неоантигена, описываемого в настоящем описании, может сопровождаться хирургическим удалением опухолей, удалением злокачественных клеток, или любой другой хирургической терапией, которую считает необходимой лечащий врач.

[554] В определенных вариантах осуществления лечение включает введение терапевтического средства на основе неоантигена, описываемого в настоящем описании, в комбинации с лучевой терапией. Лечение средством можно проводить до, одновременно или последовательно с проведением лучевой терапии. Врач-терапевт в данной области может определять схемы дозирования такой лучевой терапии.

[555] Комбинированное введение может включать совместное введение в одном фармацевтическом составе или с использованием отдельных составов, или последовательное введение в любом порядке, но, как правило, в течение такого периода времени, что все активные средства могут проявлять свои виды биологической активности одновременно.

[556] Следует понимать, что комбинацию терапевтического средства на основе неоантигена, описываемого в настоящем описании, и по меньшей мере одного дополнительного терапевтического средства можно вводить в любом порядке или одновременно. В определенных вариантах осуществления средство вводят пациентам, которые ранее получали лечение вторым терапевтическим средством. В других определенных вариантах осуществления терапевтическое средство на основе неоантигена и второе терапевтическое средство вводят по существу одновременно или совместно. Например, индивидуум может получать средство во время курса лечения вторым терапевтическим средством (например, химиотерапией). В определенных вариантах осуществления терапевтическое средство на основе неоантигена вводят в течение 1 года лечения вторым терапевтическим средством. Далее будет понятно, что два (или более) средства или вида лечения можно вводить индивидууму в пределах часов или минут (т.е. по существу одновременно).

[557] Для лечения заболевания подходящая доза терапевтического средства на основе неоантигена, описываемого в настоящем описании, зависит от типа заболевания, подлежащего лечению, тяжести и течения заболевания, ответной реакции заболевания, вводят ли средство для терапевтических или профилактических целей, предыдущая терапия, клиническая история пациента и т. д., все по усмотрению лечащего врача. Терапевтическое средство на основе неоантигена можно вводить один раз или в течение серии циклов лечения продолжительностью от нескольких суток до нескольких месяцев или до тех пор, пока не будет проведено лечение или не получают уменьшение состояния болезни (например, уменьшение размера опухоли). Оптимальные схемы дозирования рассчитывают на основании измерений накопления лекарственного средства в организме пациента, и они изменяются в зависимости от относительной активности индивидуального средства. Проводящий введение врач может определять оптимальные дозы, способы дозирования и частоту повторений.

[558] В определенных вариантах осуществления терапевтическое средство на основе неоантигена можно вводить при начальной более высокой "нагрузочной" дозе с последующим введением одной или нескольких более низких доз. В определенных вариантах осуществления частоту введение также можно изменять. В определенных вариантах осуществления режим дозирования может включать введение начальной дозы с последующим введением дополнительных доз (или "поддерживающих" доз) один раз в неделю, один раз каждые две недели, один раз каждые три недели или один раз каждый месяц. Например, режим дозирования может включать введение начальной ударной дозы с последующим введением раз в неделю поддерживающей дозы, например, половины от начальной дозы. Или режим дозирования может включать введение начальной ударной дозы с последующим введением поддерживающих доз, например, половины от начальной дозы через неделю. Или режим дозирования могут включать введение трех начальных доз в течение 3 недель с последующим введением поддерживающих доз, например, в том же количестве через неделю.

[559] Как известно специалистам в данной области, введение любого терапевтического средства может приводить к побочным эффектам и/или токсичности. В некоторых случаях побочные эффекты и/или токсичности являются настолько тяжелыми, что исключают введение конкретного средства в терапевтически эффективной дозе. В некоторых случаях терапия должна быть прекращена, и можно попробовать другие средства. Однако многие средства того же терапевтического класса характеризуются аналогичными побочными эффектами и/или токсичностями, что означает, что пациент или должен прекратить терапию, или если возможно страдать от неприятных побочных эффектов, связанных с терапевтическим средством.

[560] В определенных вариантах осуществления схему дозирования можно ограничивать конкретным числом введений или "циклов". В определенных вариантах осуществления средство вводят в течение 3, 4, 5, 6, 7, 8 или более циклов. Например, средство вводят каждые 2 недели в течение 6 циклов, средство вводят каждые 3 недели в течение 6 циклов, средство вводят каждые 2 недели в течение 4 циклов, средство вводят каждые 3 недели в течение 4 циклов и т.д. Схемы дозирования можно определять, а затем специалисты в данной области могут модифицировать ее.

[561] Настоящее изобретение относится к способам введения индивидууму терапевтического средства на основе неоантигена, описываемого в настоящем описании, включающим использование стратегии периодического дозирования для введения один или более средств, которые могут снижать побочные эффекты и/или токсичности, связанные с введением средства, химиотерапевтического средства и т.д. В определенных вариантах осуществления способ лечения злокачественной опухоли у являющегося человеком индивидуума включает введение индивидууму терапевтически эффективной дозы терапевтического средства на основе неоантигена в комбинации с терапевтически эффективной дозой химиотерапевтического средства, где один или оба средства вводят в соответствии со стратегией периодического дозирования. В определенных вариантах осуществления способ лечения злокачественной опухоли у являющегося человеком индивидуума включает введение индивидууму терапевтически эффективной дозы терапевтического средства на основе неоантигена в комбинации с терапевтически эффективной дозой второго иммунотерапевтического средства, где одно или оба средства вводят в соответствии со стратегией периодического дозирования. В определенных вариантах осуществления стратегия периодического дозирования включает введение начальной дозы терапевтического средства на основе неоантигена индивидууму и введение последующих доз средства приблизительно один раз каждые 2 недели. В определенных вариантах осуществления стратегия периодического дозирования включает введение начальной дозы терапевтического средства на основе неоантигена индивидууму, и введение последующих доз средства приблизительно один раз каждые 3 недели. В определенных вариантах осуществления стратегия периодического дозирования включает введение начальной дозы терапевтического средства на основе неоантигена индивидууму и введение последующих доз средства приблизительно один раз каждые 4 недели. В определенных вариантах осуществления средство вводят с использованием стратегия периодического дозирования и дополнительное терапевтическое средство вводят раз в неделю.

[562] Настоящее изобретение относится к композициям, содержащим терапевтическое средство на основе неоантигена, описываемого в настоящем описании. Настоящее изобретение также относится к фармацевтическим композициям, содержащим терапевтическое средство на основе неоантигена, описываемым в настоящем описании, и фармацевтически приемлемый носитель. В определенных вариантах осуществления фармацевтические композиции находят применение в иммунотерапии. В определенных вариантах осуществления композиции находят применение в ингибировании роста опухоли. В определенных вариантах осуществления фармацевтические композиции находят применение в ингибировании роста опухоли у индивидуума (например, являющегося человеком пациента). В определенных вариантах осуществления композиции находят применение в лечении злокачественной опухоли. В определенных вариантах осуществления фармацевтические композиции находят применение в лечении злокачественной опухоли у индивидуума (например, являющегося человеком пациента).

[563] Составы получают для хранения и использования путем объединения терапевтического средства на основе неоантигена по настоящему изобретению с фармацевтически приемлемым носителем (например, носителем или эксципиентом). Специалисты в данной области, как правило, считают, что фармацевтически приемлемые носители, эксципиенты и/или стабилизаторы являются неактивными ингредиентами состава или фармацевтической композиции. Иллюстративные составы приведены в WO 2015/095811.

[564] Подходящие фармацевтически приемлемые носители включают, но не ограничиваются ими, нетоксические буферы, такие как фосфатный, цитратный и другие органические кислоты; соли, такие как хлорид натрия; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты, такие как хлорид октадецилдиметилбензиламмония, хлорид гексаметония, хлорид бензалкония, хлорид бензетония, фенол, бутиловый или бензиловый спирт, алкилпарабены, такие как метилпарабен или пропилпарабен, катехол, резорцинол, циклогексанол, 3-пентанол и м-крезол; низкомолекулярные полипептиды (например, менее приблизительно 10 аминокислотных остатков); белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин или лизин; углеводы, такие как моносахариды, дисахариды, глюкоза, манноза или декстрины; хелатирующие средства, такие как EDTA; сахара, такие как сахароза, маннит, трегалоза или сорбит; образующие соль противоионы, такие как натрий; комплексные соединения с металлами, такие как комплексы Zn-белок; и неионные поверхностно-активные вещества, такие как TWEEN или полиэтиленгликоль (PEG). (Remington: The Science and Practice of Pharmacy, 22st Edition, 2012, Pharmaceutical Press, London). В определенных вариантах осуществления носитель представляет собой 5% декстрозу в воде.

[565] Фармацевтические композиции, описываемые в настоящем описании, можно вводить любым количеством путей для местного или системного лечения. Введение может быть местными посредством эпидермальных или трансдермальных пластырей, мазей, лосьонов, кремов, гелей, каплей, суппозиториев, спреев, жидкостей и порошков; легочным посредством ингаляции или инсуффляции порошков или аэрозолей, включая посредством распылителя, интратрахеальным и интраназальным; пероральным или парентеральным, включая внутривенное, внутриартериальное, внутриопухолевое, подкожное, интраперитонеальное, внутримышечное (например, инъекция или инфузия) или внутричерепное (например, интратекальное или внутрижелудочковое).

[566] Терапевтический состав может находится в стандартной лекарственной форме. Такие составы включают таблетки, пилюли, капсулы, порошки, гранулы, растворы или суспензии в воде или неводных средах, или суппозитории.

[567] Неоантигенные пептиды, описываемые в настоящем описании, также можно заключать в микрокапсулы. Такие микрокапсулы получают, например, способами коацервации или посредством интерфазной полимеризации, например, микрокапсулы из гидроксиметилцеллюлозы или желатина и микрокапсулы из поли(метилметакрилата), соответственно, в коллоидных системах доставки лекарственного средства (например, липосомы, альбуминовые микросферы, микроэмульсии, наночастицы и нанокапсулы) или в микроэмульсиях, как описано в Remington: The Science and Practice of Pharmacy, 22st Edition, 2012, Pharmaceutical Press, London.

[568] В определенных вариантах осуществления фармацевтические составы содержат терапевтическое средство на основе неоантигена, описываемое в настоящем описании, в комплексе с липосомами. Способы получения липосом известны специалистам в данной области. Например, некоторые липосомы можно получать обращенно-фазовым выпариванием с липидной композицией, содержащей фосфатидилхолин, холестерин и дериватизированный PEG фосфатидилэтаноламин (PEG-PE). Липосомы можно продавливать через фильтры с определенным размером пор с получением липосом с желаемым диаметром.

[569] В определенных вариантах осуществления можно получать препараты с длительным высвобождением, содержащие неоантигенные пептиды, описываемые в настоящем описании. Подходящие примеры препаратов с длительным высвобождением включают полупроницаемые матрицы твердых гидрофобных полимеров, содержащие средство, где матрицы находятся в форме профилированных изделий (например, пленок или микрокапсул). Примеры матриц с длительным высвобождение включают сложные полиэфиры, гидрогели, такие как поли(2-гидроксиэтилметакрилат) или поли(виниловый спирт), полилактиды, сополимеры L-глутаминовой кислоты и 7-этил-L-глутамината, неразлагаемые сополимеры этилен-винилацетат, разлагаемые молочной кислоты-гликолевой кислоты, такие как LUPRON DEPOT™ (инъецируемые микросферы, состоящие из сополимера молочной кислоты-гликолевой кислоты и лейпролида ацетата), изобутират ацетата сахарозы и поли-D-(-)-3-гидроксимасляную кислоту.

[570] Настоящее изобретение относится к способам лечения, включающим иммуногенную вакцину. Предоставлены способы лечения заболевания (такого как злокачественная опухоль или вирусная инфекция). Способ может включать введение индивидууму эффективного количества композиции, содержащей иммуногенный антиген. В определенных вариантах осуществления антиген представляет собой вирусный антиген. В определенных вариантах осуществления антиген представляет собой опухолевый антиген.

[571] Неограничивающие примеры вакцин, которые можно получать, включают вакцина на основе пептидов, вакцина на основе нуклеиновых кислот, вакцина на основе антител, вакцина на основе T-клеток и вакцина на основе антигенпрезентирующих клеток.

[572] Вакцинные композиции можно формулировать с использованием одного или более физиологически приемлемых носителей, включая эксципиенты и вспомогательные средства, которые облегчают обработку активных средств в препараты, которые можно использовать в фармацевтических целях. Правильный состав можно выбирать в зависимости от пути введения. Любой из известных способов, носителей и эксципиентов можно использовать в качестве подходящих и понятных в данной области.

[573] В некоторых случаях вакцинную композицию формулируют в виде вакцины на основе пептида, вакцины на основе нуклеиновой кислоты, вакцины на основе антитела или вакцины на основе клеток. Например, вакцинная композиция может содержать голую кДНК в катионных липидных составах; липопептиды (например, Vitiello A. et al., J. Clin. Invest. 95:341, 1995), голую кДНК или пептиды, инкапсулированные, например, в микросферы из поли(DL-лактидкогликолида) ("PLG") (см., например, Eldridge, et al., Molec. Immunol. 28:287-294, 1991: Alonso et al, Vaccine 12:299-306, 1994; Jones et al, Vaccine 13:675-681, 1995); пептидную композицию, содержащуюся в иммуностимулирующих комплексах (ISCOMS) (например, Takahashi et al, Nature 344:873-875, 1990; Hu et al, Clin Exp Immunol. 113:235-243, 1998); или системы множественных антигенных пептидов (MAP) (см., например, Tam, J. P., Proc. Natl Acad. Sci. U.S.A. 85:5409-5413, 1988; Tarn, J.P., J. Immunol. Methods 196:17-32, 1996). В некоторых случаях вакцину формулируют в виде вакцины на основе пептидов или вакцины на основе нуклеиновых кислот, в которых нуклеиновая кислота кодирует полипептиды. В некоторых случаях вакцину формулируют в виде вакцины на основе антител. В некоторых случаях вакцину формулируют в виде вакцины на основе клеток.

[574] Аминокислотную последовательность идентифицированного специфического для заболевания иммуногенного неоантигенного пептида можно использовать для разработки фармацевтически приемлемой композиции. Источником антигена могут являться, но, не ограничиваясь ими, природные или синтетические белки, включая гликопротеины, пептиды и суперантигены; комплексы антитело/антиген; липопротеины; РНК или ее продукт трансляции и ДНК или полипептид, кодируемый ДНК. Источник антигена также может содержать нетрансформированные, трансформированные, трансфицированные или трансдуцированные клетки или линии клеток. Клетки можно трансформировать, трансфицировать или трансдуцировать с использованием любого из ряда экспрессирующих или ретровирусных векторов, известных специалистам в данной области, которые можно использовать для экспрессии рекомбинантных антигенов. Экспрессию также можно получать в любой подходящей клетке-хозяине, которую трансформировали, трансфицировали или трансдуцировали экспрессирущим или ретровирусным вектором, содержащим молекулу ДНК, кодирующую рекомбинантный антиген(ы). Можно использовать любое количество протоколов трансфекции, трансформации и трансдукция, известных специалистам в данной области. Рекомбинантные векторы на основе оспавакцины и клетки, инфицированные вектором на основе оспавакцины, можно использовать в качестве источника антигена.

[575] Композиция может содержать синтетический специфический для заболевания иммуногенный неоантигенный пептид. Композиция может содержать два или более специфических для заболевания иммуногенных неоантигенных пептидов. Композиция может содержать предшественник специфического для заболевания иммуногенного пептида (такой белок, пептид, ДНК и РНК). Предшественник специфического для заболевания иммуногенного пептида может образовывать или образовываться в идентифицированном специфическом для заболевания иммуногенном неоантигенном пептиде. В определенных вариантах осуществления терапевтическая композиция содержит предшественник иммуногенного пептида. Предшественник специфического для заболевания иммуногенного пептида может представлять собой пролекарство. В определенных вариантах осуществления композиция, содержащая специфический для заболевания иммуногенный неоантигенный пептид, может дополнительно содержать адъювант. Например, неоантигенный пептид можно использовать в качестве вакцины. В определенных вариантах осуществления иммуногенная вакцина может содержать фармацевтически приемлемый иммуногенный неоантигенный пептид. В определенных вариантах осуществления иммуногенная вакцина может содержать фармацевтически приемлемый предшественник иммуногенного неоантигенного пептида (такой как белок, пептид, ДНК и РНК). В определенных вариантах осуществления способ лечения включает введение индивидууму эффективного количества антитела, специфически распознающего иммуногенный неоантигенный пептид. В определенных вариантах осуществления способ лечения включает введение индивидууму эффективного количества растворимого TCR или аналога TCR, специфически распознающего иммуногенный неоантигенный пептид.

[576] Способы, описываемые в настоящем описании, являются особенно пригодными в рамках персонализированной медицины, где иммуногенные неоантигенные пептиды используют для разработки терапевтических средств (таких как вакцины или терапевтические антитела) для одного и того же индивидуума. Таким образом, способ лечения заболевания у индивидуума может включать идентификацию иммуногенного неоантигенного пептида у индивидуума способами, описываемыми в настоящем описании; и синтез пептида (или его предшественника); и введение пептида или антитела, специфически распознающего пептид индивидууму. В определенных вариантах осуществления профиль экспрессии иммуногенного неоантигена может служить в качестве главной основы для получения персонализированных вакцины для конкретного пациента. В определенных вариантах осуществления профиль экспрессии иммуногенного неоантигена может служить в качестве главной основы для получения вакцин для группы пациентов с конкретным заболеванием. Таким образом, конкретные заболевания, например, конкретные типы опухолей, можно избирательно лечить в группе пациентов.

[577] В определенных вариантах осуществления пептиды, описываемые в настоящем описании, являются структурно нормальными ("разделяемыми") антигенами, которые могут распознаваться аутологичными T-клетками, направленными против заболевания, в большой группе пациентов. В определенных вариантах осуществления определяют профиль экспрессии антигенов группы болеющих индивидуумов, при заболевании которых экспрессируются структурно нормальные ("разделяемые") неоантигены.

[578] Существует ряд способов получения иммуногенных неоантигенов. Белки или пептиды можно получать любым способом, известным специалистам в данной области, включая экспрессию белков, полипептидов или пептидов стандартными способами молекулярной биологии, путем выделения белков или пептидов из природных источников, трансляции in vitro или химического синтеза белков или пептидов. В основном, такие специфические для заболевания неоантигены можно получать in vitro или in vivo. Иммуногенные неоантигены можно получать in vitro в виде пептидов или полипептидов, которые затем можно формулировать в персонализированной вакцине или иммуногенной композиции и вводить индивидууму. Получение in vitro иммуногенных неоантигенов может включать пептидный синтез или экспрессию пептида/полипептида из молекулы ДНК или РНК в любой из ряда бактериальных, эукариотических или вирусных рекомбинантных экспрессирующих систем с последующей очисткой экспрессированного пептида/полипептида. Альтернативно, иммуногенные неоантигены можно получать in vivo путем введения молекул (например, ДНК, РНК и вирусных экспрессирующих систем), которые кодируют иммуногенный неоантиген индивидууму, после чего экспрессируются кодируемые иммуногенные неоантигены. В определенных вариантах осуществления полинуклеотид, кодирующий иммуногенный неоантигенный пептид, можно использовать для получения неоантигенного пептида in vitro.

[579] В определенных вариантах осуществления полинуклеотид содержит последовательность по меньшей мере с 60%, 65%, 70%l, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентичностью к полинуклеотиду, кодирующему иммуногенный неоантиген.

[580] Полинуклеотид может представлять собой, например, ДНК, кДНК, ПНК, ЦНК, РНК, одноцепочечные и/или двухцепочечные, нативные или стабилизированные формы полинуклеотидов или их сочетания. Нуклеиновая кислота, кодирующая иммуногенный неоантигенный пептид, может содержать или может не содержать интроны при условии, что она кодирует пептид. В определенных вариантах осуществления для получения пептида используют трансляцию in vitro.

[581] Также предусматривают экспрессирующие векторы, содержащие последовательности, кодирующие неоантиген, а также клетки-хозяева, содержащие экспрессирующие векторы. Экспрессирующие векторы, пригодные для использования в настоящем изобретении могут содержать по меньшей мере один элемент контроля экспрессии, функционально связанный с последовательностью нуклеиновой кислоты. Элементы контроля экспрессии вводят в вектор для контроля и регуляции экспрессии последовательности нуклеиновой кислоты. Примеры элементов контроля экспрессии хорошо известны в данной области и включают, например, систему lac, операторные и промоторные области фага лямбда, дрожжевые промоторы и промоторы, получаемые из вируса полиомы, аденовируса, ретровируса или SV40. Дополнительные функциональные элементы включают, но не ограничиваются ими, лидерные последовательности, кодоны терминации, сигналы полиаденилирования и любые другие последовательности, необходимые или предпочтительные для соответствующей транскрипции и последующей трансляции последовательности нуклеиновой кислоты в системе-хозяине. Специалисту в данной области следует понимать, что правильная комбинация элементов контроля экспрессии будет зависеть от выбранной системы-хозяина. Далее будет понятно, что экспрессирующий вектор должен содержать дополнительные элементы, необходимые для переноса и последующей репликации экспрессирующего вектора, содержащего последовательность нуклеиновой кислоты в системе-хозяине. Примеры таких элементов включают, но не ограничиваются ими, участки начала репликации и селективные маркеры.

[582] Неоантигенные пептиды можно предоставлять в форме молекул РНК или кДНК, кодирующих желаемые неоантигенные пептиды. Один или более неоантигенных пептидов по изобретению могут кодироваться одним экспрессирующим вектором. Как правило, ДНК вводят в экспрессирующий вектор, такой как плазмида, в правильной ориентации и правильной рамке считывания для экспрессии, при необходимости ДНК можно связывать с подходящими регуляторными контрольными нуклеотидными последовательностями для транскрипции и трансляции, распознаваемые желаемым хозяином (например, бактериями), хотя такие контроли, как правило, являются доступными в экспрессирующем векторе. Затем вектор вводят в бактерии-хозяева для клонирования стандартными способами. Пригодные экспрессирующие векторы для эукариотических хозяев особенно млекопитающих или людей включают, например, векторы, содержащие последовательности контроля экспрессии из SV40, вируса папилломы крупного рогатого скота, аденовируса и цитомегаловируса. Пригодные экспрессирующие векторы для бактериальных хозяев включают известные бактериальные плазмиды, такие как плазмиды из E. coli, включая pCR 1, pBR322, pMB9 и их производные, плазмиды с более широким диапазоном хозяев, такие как M13, и одноцепочечные ДНК нитевидных фагов.

[583] В вариантах осуществления последовательность ДНК, кодирующую полипептид, представляющий интерес, можно конструировать путем химического синтеза с использованием олигонуклеотидного синтезатора. Такие олигонуклеотиды можно конструировать на основании аминокислотной последовательности желаемого полипептида и выбирать такие кодоны, которые являются предпочтительными в клетке-хозяине, в которой получают представляющий интерес рекомбинантный полипептид. Стандартные способы можно применять для синтеза выделенной полинуклеотидной последовательности, кодирующей выделенный представляющий интерес полипептид.

[584] Подходящие клетки-хозяева для экспрессии полипептида включают клетки прокариот, дрожжей, насекомых или высших эукариот под контролем подходящих промоторов. Прокариоты включают грамотрицательные или грамположительные организмы, например, E. coli или bacilli. Клетки высших эукариот включают разработанные линии клеток, происходящие от млекопитающих. Можно применять бесклеточные трансляционные системы. Подходящие клонирующие и экспрессирующие векторы для использования с клетками-хозяевами бактерий, грибов, дрожжей и млекопитающих хорошо известны в данной области. Для экспрессии рекомбинантного белка можно применять различные системы культивирования клеток млекопитающих или насекомых. Иллюстративные линии клеток-хозяев млекопитающих включают, но не ограничиваются ими, линии клеток COS-7, L-клетки, C127, 3T3, яичника китайского хомяка (CHO), 293, HeLa и BHK. Экспрессирующие векторы млекопитающих могут содержать нетранскрибируемые элементы, такие как участок начала репликации, подходящие промотор и энхансер, связанные с геном, который необходимо экспрессировать, и другие 5'- или 3'-фланкирующие нетранскрибируемые последовательности, и 5'- или 3'-нетранслируемые последовательности, такие как необходимые участки связывания рибосомы, участки полиаденилирования, участки донора и акцептора сплайсинга и последовательности терминации транскрипции.

[585] Белки, продуцируемые трансформированным хозяином, можно очищать любым подходящим способом. Такие стандартные способы включают хроматографию (например, ионообменную, аффинную и колоночную хроматографию с распределением по размеру и т.п.), центрифугирование, дифференциальную растворимость или любой другой стандартный способ очистки белка. Аффинные метки, такие как гексагистидин, связывающий мальтозу домен, грипп coat последовательность оболочки вируса гриппа, глутатион-S-трансферазу и т.п. можно присоединять к белку для обеспечения простоты очистки путем пропускания через подходящую аффинную колонку. Выделенные белки также можно охарактеризовать физически с использованием таких способов как протеолиз, ядерный магнитный резонанс и рентгеноструктурная кристаллография.

[586] Вакцина может содержать структуру, которая связывается с полипептидной последовательностью, описываемой в настоящем описании. Структура может представлять собой антитело. Вакцину на основе антител можно формулировать с использованием любого из хорошо известных способов, носителей и эксципиентов, как общепринято и понятно в данной области. В определенных вариантах осуществления пептиды, описываемые в настоящем описании, можно использовать для получения неоантигенспецифических терапевтических средств, таких как терапевтические средства на основе антител. Например, неоантигены можно использовать для индукции и/или идентификации антител, специфически распознающих неоантигены. Эти антитела можно использовать в качестве терапевтических средств. Антитело может представлять собой природное антитело, химерное антитело, гуманизированное антитело или может представлять собой фрагмент антитела. Антитело может распознавать один или более полипептидов, описываемых в настоящем описании. Антитело может распознавать полипептид, который содержит последовательность, которая является не более чем на 40%, 50%, 60%, 70%, 80%, 90%, 95% или менее гомологичной последовательности полипептида, описываемого в настоящем описании. Антитело может распознавать полипептид, который содержит последовательность, которая является по меньшей мере на 40%, 50%, 60%, 70%, 80%, 90%, 95% или более гомологичной последовательности полипептида, описываемого в настоящем описании. Антитело может распознавать полипептид с длиной последовательности по меньшей мере 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% или более от длины последовательности полипептида, описываемого в настоящем описании. Антитело может распознавать полипептид с длиной последовательности, которая составляет не более 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% или менее от длины последовательности полипептида, описываемого в настоящем описании.

[587] Настоящее изобретение также предусматривает использование молекул нуклеиновой кислоты в качестве носителей для доставки неоантигенных пептидов/полипептидов нуждающемуся в этом индивидууму in vivo в форме, например, ДНК-/РНК-вакцин.

[588] В определенных вариантах осуществления вакцина представляет собой вакцину на основе нуклеиновой кислоты. В определенных вариантах осуществления неоантигены можно вводить индивидууму с использованием плазмиды. Плазмиды можно вводить в ткани животных рядом различных способов, например, инъекцией или аэрозольной инстилляцией голой ДНК на поверхности слизистой, такой как слизистая оболочка носа и легких. В определенных вариантах осуществления можно использовать физическую доставку, такую как с использованием "генной пушки". Точный выбор экспрессирующих векторов может зависеть от пептидов/полипептидов, которые необходимо экспрессировать, и находится в компетенции специалиста в данной области.

[589] В определенных вариантах осуществления нуклеиновая кислота кодирует иммуногенный пептид или предшественник пептида. В определенных вариантах осуществления вакцина на основе нуклеиновой кислоты содержит последовательности, фланкирующие последовательность, кодирующую иммуногенный пептид или предшественник пептида. В определенных вариантах осуществления вакцина на основе нуклеиновой кислоты содержит более чем один иммуногенный эпитоп. В определенных вариантах осуществления вакцина на основе нуклеиновой кислоты представляет собой вакцину на основе ДНК. В определенных вариантах осуществления вакцина на основе нуклеиновой кислоты представляет собой вакцину на основе РНК. В определенных вариантах осуществления вакцина на основе РНК содержит иРНК. В определенных вариантах осуществления вакцина на основе РНК содержит голую иРНК. В определенных вариантах осуществления вакцина на основе РНК содержит модифицированную иРНК (например, иРНК, защищенную от разложения с использованием протоамина, иРНК, содержащей модифицированную структуру 5'-CAP, или иРНК, содержащая модифицированные нуклеотиды). В определенных вариантах осуществления вакцина на основе РНК содержит одноцепочечную иРНК.

[590] Полинуклеотид могут являться по существу чистыми или содержаться в подходящем векторе или системе доставки. Подходящие векторы и системы доставки включают вирусные, такие как системы, основанные на аденовирусе, вирусе оспавакцины, ретровирусах, вирусе герпеса, аденоассоциированном вирусе или гибридах, содержащих элементы более чем одного вируса. Невирусные системы доставки включают катионные липиды и катионные полимеры (например, катионные липосомы).

[591] Один или более неоантигенных пептидов можно кодировать и экспрессировать in vivo с использованием систем на основе вирусов. Вирусные векторы можно использовать в качестве рекомбинантных векторов в настоящем изобретении, где участок вирусного генома удаляют для введения новых генов, не нарушая инфекционной способности вируса. Вирусный вектор по настоящему изобретению представляет собой непатогенный вирус. В определенных вариантах осуществления вирусный вектор обладает тропизмом к конкретному типу клеток у млекопитающего. В другом варианте осуществления вирусный вектор по настоящему изобретению способен инфицировать профессиональные антигенпрезентирующие клетки, такие как дендритные клетки и макрофаги. В еще одном варианте осуществления настоящего изобретения вирусный вектор способен инфицировать любую клетку у млекопитающего. Вирусный вектор также может инфицировать опухолевые клетки. Вирусные векторы, используемые в настоящем изобретении, включают, но не ограничиваются ими поксвирус, такой как вирус оспавакцины, вирус оспы птиц, вирус куриной оспы и сильно аттенуированный вирус оспавакцины (Ankara или MVA), ретровирус, аденовирус, бакуловирус и т.п.

[592] Вакцину можно доставлять различными путями. Пути доставки могут включать пероральный (включая буккальный и сублингвальный), ректальный, назальный, местный, трансдермальный пластырь, легочный, вагинальный, суппозиторий или парентеральный (включая внутримышечное, внутриартериальное, интратекальное, внутрикожное, внутрибрюшинное, подкожное и внутривенное) введение или в форме, подходящей для введения посредством аэрозолизации, ингаляции или инсуффляции. Общую информацию о системах доставки лекарственных средств можно найти у Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems (Lippencott Williams & Wilkins, Baltimore Md. (1999). Вакцину, описываемую в настоящем описании, можно вводить в мышцу или можно вводить посредством внутрикожных или подкожных инъекций, или трансдермально, таким образом, как посредством ионтофореза. Можно применять эпидермальное введение вакцины.

[593] В некоторых случаях вакцина также можно формулировать для введения через носовые проходы. Составы, подходящие для назального введения, где носитель является жидкостью, могут содержать грубый порошок с размером частиц, например, в диапазоне приблизительно от 10 приблизительно до 500 микрометров, который вводится способом, которым принимают табак, т.е. путем быстрого вдыхания через носовой проход из контейнера порошка, удерживаемого близко к носу. Состав может представлять собой назальный спрей, назальные капли или его можно вводить путем аэрозольного введения посредством распылителя. Состав может содержать водные или масляные растворы вакцины.

[594] Вакцина может представлять собой жидкий препарат, такой как суспензия, сироп или эликсир. Вакцина также может представлять собой препарат для парентерального, подкожного, внутрикожного, внутримышечного или внутривенного введение (например, инъекционного введения), такой как стерильная суспензия или эмульсия.

[595] Вакцина может содержать вещество для однократной иммунизации, или может содержать вещество для многократных иммунизаций (т.е. набор "многократных доз"). В многодозовые упаковки предпочтительно вводить консервант. В качестве альтернативны (или кроме того) введению консерванта в многодозовые композиции, композиции может содержаться в контейнере с асептическим адаптером для удаления вещества.

[596] Вакцину можно вводить в объеме дозы приблизительно 0,5 мл, хотя детям можно вводить половину дозы (т.е. приблизительно 0,25 мл). В некоторых случаях вакцину можно вводить в более высокой дозе, например, приблизительно 1 мл.

[597] Вакцина можно вводить по схеме лечения с 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более курсовых доз. В некоторых случаях вакцина вводят по схеме лечения с 1, 2, 3 или 4 курсовых доз. В некоторых случаях вакцину вводят по схеме лечения с 1 курсовой дозой. В некоторых случаях вакцину вводят по схеме лечения с 2 курсовыми дозами.

[598] Введение первой дозы и второй дозы можно проводить раздельно с интервалом приблизительно 0 суток, 1 сутки, 2 суток, 5 суток, 7 суток, 14 суток, 21 сутки, 30 суток, 2 месяца, 4 месяца, 6 месяцев, 9 месяцев, 1 год, 1,5 года, 2 года, 3 года, 4 года или более.

[599] Вакцину, описываемую в настоящем описании, можно вводить каждые 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 или более лет. В некоторых случаях вакцину, описываемую в настоящем описании, вводят каждые 2, 3, 4, 5, 6, 7 или более лет. В некоторых случаях вакцину, описываемую в настоящем описании, вводят каждые 4, 5, 6, 7 или более лет. В некоторых случаях вакцину, описываемую в настоящем описании, вводят один раз.

[600] Примеры дозировки не являются ограничивающими и используются только для иллюстрации конкретных режимов дозирования для введения вакцины, описанной здесь. Эффективное количество для применения у людей можно определять на моделях на животных. Например, можно формулировать дозу для людей для достижения циркулирующих, печеночных, местных и/или желудочно-кишечных концентраций, которые, как выявлено, были эффективными у животных. Основываясь на данных о животных и других типах подобных данных, специалисты в данной области могут определять эффективные количества вакцинной композиции, подходящей для людей.

[601] Эффективное количество со ссылкой на средство или комбинацию средств, как правило, означает режимы дозирования, способы введения, составы и т.д., которые рекомендовала или одобрила любая из различных регулирующих или консультативных организаций в медицинской или фармацевтической области (например, FDA, AMA) или изготовителем, или поставщиком.

[602] В определенных аспектах вакцину и набор, описываемые в настоящем описании, можно хранить от 2°C до 8°C. В некоторых случаях, вакцину не хранят в замороженном виде. В некоторых случаях, вакцину хранят при температурах, таких как -20°C или -80°C. В некоторых случаях вакцину хранят без доступа света.

VIII. Наборы

[603] Терапевтическое средство на основе неоантигена, описываемого в настоящем описании, можно предоставлять в форме набора совместно с инструкциями по введению. Как правило, набор содержит желаемое терапевтическое средство на основе неоантигена в контейнере, в стандартной лекарственной форме и инструкции по введению. Дополнительное терапевтическое средства, например, цитокины, лимфокины, ингибиторы контрольных точек, антитела, также могут входить в набор. Другие компоненты набора, которые также желательно включать, представляют собой, например, стерильный шприц, дозы для повторного введения и другие желаемые эксципиенты.

[604] В настоящем описании также предоставлены наборы и промышленные изделия для использования с одни или более способами, описываемыми в настоящем описании. Наборы могут содержать один или более неоантигенных полипептидов. Наборы также могут содержать нуклеиновые кислоты, которые кодируют один или более полипептидов, описываемых в настоящем описании, антитела, которые распознают один или более полипептидов, описываемых в настоящем описании, или клетки на основе APC, активированные один или более полипептидами, описываемыми в настоящем описании. Наборы может дополнительно содерждать адъюванты, реагенты и буферы, необходимые для составления и доставки вакцин.

[605] Наборы также могут содержать носитель, упаковку или контейнер, который разделен на отсеки, чтобы получать один или более контейнеров, таких как флаконы, пробирки и т.п., где каждый из контейнера(ов) содержит один из отдельных элементов, таких как полипептиды и адъюванты для использования в способе, описываемом в настоящем описании. Подходящие контейнеры включают, например, бутылки, флаконы, шприцы и тестовые пробирки. Контейнеры можно изготавливать из различных материалов, таких как стекло или пластик.

[606] Промышленные изделия, предоставленные в настоящем описании, содержат упаковочные материалы. Примеры фармацевтических упаковочных материалов включают, но не ограничиваются ими, блистерные упаковки, бутылки, пробирки, мешки, контейнеры, бутылки и любой упаковочный материал, подходящих для отобранного состава и предполагаемого способа введения и лечения. Набор, как правило, содержит этикетки с перечислением содержимого и/или инструкций по использованию и вкладыши в упаковку с инструкциями по использованию. Набор инструкций, как правило, тоже включают.

[607] Изобретение более подробно описано посредством конкретных примеров. Следующие ниже примеры предоставлены в иллюстративных целях, и не предназначены для ограничения изобретение каким-либо образом. Специалисты в данной области легко узнают различные некритические параметры, которые можно изменять или модифицировать для получения альтернативных вариантов осуществления изобретения. Все патенты, патентные заявки и приведенные публикации, перечисляемые в настоящем описании, полностью включены в настоящее описание посредством ссылки.

ПРИМЕРЫ

Пример 1: Идентификация мутантных последовательностей с иммуногенным потенциалом

[608] Заявители открыли мутации, которые часто встречаются у пациентов со злокачественными опухолями. См. таблицы 1 и 2.

[609] Неоантигенные пептиды, описываемые в настоящем описании, можно получать из мутаций, приведенных в таблицах 1 и 2. Например, неоантигенный пептид можно получать мутацией замены, например, мутацией KRAS G12V. Неоантигенный пептид может представлять собой пептид, содержащий 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90 или 100 аминокислотных остатков белка, например, KRAS, включая замену (G12V). Замены могут располагаться в любом месте по всей длине неоантигенного пептида. Например, она может располагаться в трети N-конца неоантигенного пептида, центральной трети неоантигенного пептида или в трети C-конца неоантигенного пептида. В другом примере, замещенный остаток располагается в 2-5 остатках от N-конца или в 2-5 остатках от C-конца. Неоантигенные пептиды можно подобным образом получать из специфических для опухолей мутаций, где неоантигенный пептид содержит один или более, или все введенные остатки.

[610] Неоантигенные пептиды также можно получать из мутации сдвига рамки считывания, слитых полипептидов, делеции в рамке считывания и вариантов сплайсинга. Опухолеспецифические полипептиды, получаемые в результате этих мутаций, можно охарактеризовать наличием точки перехода между полипептидной последовательностью, кодируемой зародышевой линией, и опухолеспецифическим мутантным полипептидом, кодируемым опухолеспецифической мутацией. Неоантигенный пептид может представлять собой пептид приблизительно 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90 или 100 аминокислотных остатков, которые охватывают тоску перехода между нативной последовательностью, кодируемой зародышевой линией, и опухолеспецифической полипептидной последовательностью. Точка перехода может располагаться в любом месте по всей длине неоантигенного пептида. Например, она может располагаться в трети N-конца неоантигенного пептида, ы центральной трети неоантигенного пептида или в трети C-конца неоантигенного пептида. В другом примере точка перехода располагается в 2-5 остатках от N-конца или в 2-5 остатках от C-конца. Неоантигенный пептид, получаемый в результате мутации сдвига рамки считывания, и варианты сплайсинга также могут представлять собой пептид, состоящий из опухолеспецифических мутантных остатков.

[611] Для каждого события мутации, приведенного в таблицах 1 и 2, получали полноразмерную аминокислотную последовательность мутантного белка. Любые составные компоненты из 9 мономерных звеньев или 10 мономерных звеньев, не встречающиеся в белковой последовательности зародышевой линии, отметали как нео-пептид и оценивали на способность связываться на шести общих аллелях HLA (HLA-A01:01, HLA-A02:01. HLA-A03:01, HLA-A11:01, HLA-A24:02, HLA-B07:02 и HLA-B08:01) с использованием доступных алгоритмов. Любой пептид набирающий более 1000 нМ выделяли. Выделенные пептиды приведены в таблицах 1 и 2 с последующим аллелем HLA с высоким баллом в скобках.

Таблица 1

Ген Иллюстративное изменение белка Контекст последовательности с мутацией Пептиды (пример(ы) аллеля HLA ) Иллюстративные заболевания
ТАБЛИЦА 1A ТОЧЕЧНАЯ МУТАЦИЯ 1
ABL1 E255K VADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGKVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVC GQYGKVYEG (A02.01) GQYGKVYEGV (A02.01) KLGGGQYGK (A03.01) KLGGGQYGKV (A02.01) KVYEGVWKK (A02.01, A03.01)
KVYEGVWKKY (A03.01)
QYGKVYEGV (A24.02)
QYGKVYEGVW (A24.02)
Хронический миелолейкоз (CML), острый лимфоцитарный лейкоз (ALL), желудочно-кишечные стромальные опухоли (GIST)
ABL1 E255V VADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGVVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVC GQYGVVYEG (A02.01)
GQYGVVYEGV (A02.01)
KLGGGQYGV (A02.01)
KLGGGQYGVV (A02.01)
QYGVVYEGV (A24.02)
QYGVVYEGVW (A24.02)
VVYEGVWKK (A02.01, A03.01)
VVYEGVWKKY (A03.01)
Хронический миелолейкоз (CML), острый лимфоцитарный лейкоз (ALL), желудочно-кишечные стромальные опухоли (GIST)
ABL1 M351T LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSATEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF ATQISSATEY (A01.01)
ISSATEYLEK (A03.01)
SSATEYLEK (A03.01)
TQISSATEYL (A02.01)
YMATQISSAT (A02.01)
Хронический миелолейкоз (CML), острый лимфоцитарный лейкоз (ALL), желудочно-кишечные стромальные опухоли (GIST)
ABL1 T315I SLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLA FYIIIEFMTY (A24.02)
IIEFMTYGNL (A02.01)
IIIEFMTYG (A02.01)
IIIEFMTYGN (A02.01)
YIIIEFMTYG (A02.01)
Хронический миелолейкоз (CML), острый лимфоцитарный лейкоз (ALL), желудочно-кишечные стромальные опухоли (GIST)
ABL1 Y253H STVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQHGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLG GQHGEVYEGV (A02.01)
KLGGGQHGEV (A02.01)
Хронический миелолейкоз (CML), острый лимфоцитарный лейкоз (ALL), желудочно-кишечные стромальные опухоли (GIST)
ALK G1269A SSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIADFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLL KIADFGMAR (A03.01)
RVAKIADFGM (A02.01, B07.02)
NSCLC
ALK L1196M QVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFI FILMELMAGG (A02.01)
ILMELMAGG (A02.01)
ILMELMAGGD (A02.01)
LMELMAGGDL (A02.01)
LPRFILMEL (B07.02, B08.01)
LPRFILMELM (B07.02)
LQSLPRFILM (A02.01, B08.01)
SLPRFILMEL (A02.01, A24.02, B07.02, B08.01)
NSCLC
BRAF V600E MIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELM LATEKSRWS (A02.01, B08.01)
LATEKSRWSG (A02.01, B08.01)
CRC, GBM, KIRP, LUAD, SKCM, THCA
BTK C481S MIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGSLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVND EYMANGSLL (A24.02)
MANGSLLNY (A01.01, A03.01, A11.01)
MANGSLLNYL (A02.01, B07.02, B08.01)
SLLNYLREM (A02.01, B07.02, B08.01)
YMANGSLLN (A02.01)
YMANGSLLNY (A01.01, A03.01, A11.01)
CLL
EEF1B2 S43G MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGAT GPPPADLCHAL (B07.02) BLCA, KIRP, PRAD, SKCM
EGFR S492R SLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIRNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLL IIRNRGENSCK (A03.01) CRC
EGFR T790M IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA CLTSTVQLIM (A01.01, A02.01)
IMQLMPFGC (A02.01)
IMQLMPFGCL (A02.01, A24.02, B08.01)
LIMQLMPFG (A02.01)
LIMQLMPFGC (A02.01)
LTSTVQLIM (A01.01)
MQLMPFGCL (A02.01, B07.02, B08.01)
MQLMPFGCLL (A02.01, A24.02, B08.01)
QLIMQLMPF (A02.01, A24.02, B08.01)
QLIMQLMPFG (A02.01)
STVQLIMQL (A02.01)
VQLIMQLMPF (A02.01, A24.02, B08.01)
NSCLC, PRAD
ERBB3 V104M ERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRMVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDK CRC, рак желудка
ESR1 D538G HLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEA GLLLEMLDA (A02.01)
LYGLLLEML (A24.02)
NVVPLYGLL (A02.01)
PLYGLLLEM (A02.01)
PLYGLLLEML (A02.01, A24.02)
VPLYGLLLEM (B07.02)
VVPLYGLLL (A02.01, A24.02)
Рак молочной железы
ESR1 S463P NQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLPSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSH FLPSTLKSL (A02.01, A24.02, B08.01)
GVYTFLPST (A02.01)
GVYTFLPSTL (A02.01, A24.02)
TFLPSTLKSL (A24.02)
VYTFLPSTL (A24.02)
YTFLPSTLK (A03.01)
Рак молочной железы
ESR1 Y537C IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLCDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE NVVPLCDLL (A02.01)
NVVPLCDLLL (A02.01)
PLCDLLLEM (A02.01)
PLCDLLLEML (A02.01)
VPLCDLLLEM (B07.02)
VVPLCDLLL (A02.01, A24.02)
Рак молочной железы
ESR1 Y537N IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLNDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE NVVPLNDLL (A02.01)
NVVPLNDLLL (A02.01)
PLNDLLLEM (A02.01)
PLNDLLLEML (A02.01)
VPLNDLLLEM (B07.02)
Рак молочной железы
ESR1 Y537S IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGE NVVPLSDLL (A02.01)
NVVPLSDLLL (A02.01)
PLSDLLLEM (A02.01)
PLSDLLLEML (A02.01)
VPLSDLLLEM (B07.02)
VVPLSDLLL (A02.01, A24.02)
Рак молочной железы
FGFR3 S249C HRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERCPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVG VLERCPHRPI (A02.01, B08.01)
YTLDVLERC (A02.01)
BLCA, HNSC, KIRP, LUSC
FRG1B L52S AVKLSDSRIALKSGYGKYLGINSDELVGHSDAIGPREQWEPVFQNGKMALSASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAEKETKKKDDIPEEDKG FQNGKMALS (A02.01) GBM, KIRP, PRAD, SKCM
HER2 V777 л
(Resistance)
GSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGLGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCM VMAGLGSPYV (A02.01, A03.01) BRCA
IDH1 R132H RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM KPIIIGHHA (B07.02) BLCA, GBM, PRAD
IDH1 R132C RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGCHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM KPIIIGCHA (B07.02) BLCA, GBM, PRAD
IDH1 R132G RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGGHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM KPIIIGGHA (B07.02) BLCA, BRCA, CRC, GBM, HNSC, LUAD, PAAD, PRAD, UCEC
IDH1 R132S RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGSHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGM KPIIIGSHA (B07.02) BLCA, BRCA, GBM, HNSC, LIHC, LUAD, LUSC, PAAD, SKCM, UCEC
НАБОР T670I VAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVIIEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE IIEYCCYGDL (A02.01)
TIGGPTLVII (A02.01)
VIIEYCCYG (A02.01)
желудочно-кишечные стромальные опухоли (GIST)
НАБОР V654A VEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIANLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYK HMNIANLLGA (A02.01)
IANLLGACTI (A02.01)
MNIANLLGA (A02.01)
YLGNHMNIA (A02.01, B08.01)
YLGNHMNIAN (A02.01)
желудочно-кишечные стромальные опухоли (GIST)
MEK C121S ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHESNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI VLHESNSPY (A03.01)
VLHESNSPYI (A02.01)
Меланома
MEK P124 л LGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSLYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVI LQVLHECNSL (A02.01, B08.01)
LYIVGFYGAF (A24.02)
NSLYIVGFY (A01.01)
QVLHECNSL (A02.01, B08.01)
SLYIVGFYG (A02.01)
SLYIVGFYGA (A02.01)
VLHECNSLY (A03.01)
VLHECNSLYI (A02.01, A03.01)
Меланома
MYC E39D MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSDLQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGG FYQQQQQSDL (A24.02)
QQQSDLQPPA (A02.01)
QQSDLQPPA (A02.01)
YQQQQQSDL (A02.01, B08.01)
лимфоидная злокачественная опухоль; лимфома Беркита
MYC P57S FTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLSTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLG FELLSTPPL (A02.01, B08.01)
LLSTPPLSPS (A02.01)
лимфоидная злокачественная опухоль
MYC T58I TNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPIPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGG FELLPIPPL (A02.01)
IWKKFELLPI (A24.02)
LLPIPPLSPS (A02.01, B07.02)
LPIPPLSPS (B07.02)
Нейробластома
PDGFRa T674I VAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIIIEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSYVILS IIEYCFYGDL (A02.01)
IIIEYCFYG (A02.01)
IYIIIEYCF (A24.02)
IYIIIEYCFY (A24.02)
YIIIEYCFYG (A02.01)
Хронический эозинофильный лейкоз
PIK3CA E542K IEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSKITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPP KITEQEKDFL (A02.01) BLCA, BRCA, CESC, CRC, GBM, HNSC, KIRC, KIRP, LIHC, LUAD, LUSC, PRAD, UCEC
PIK3CA E545K HANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITKQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKP STRDPLSEITK (A03.01)
DPLSEITK (A03.01)
BLCA, BRCA, CESC, CRC, GBM, HNSC, KIRC, KIRP, LIHC, LUAD, LUSC, PRAD, SKCM, UCEC
PIK3CA H1047R LFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDARHGGWTTKMDWIFHTIKQHALN BRCA, CESC, CRC, GBM, HNSC, LIHC, LUAD, LUSC, PRAD, UCEC
POLE P286R QRGGVITDEEETSKKIADQLDNIVDMREYDVPYHIRLSIDIETTKLPLKFRDAETDQIMMISYMIDGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFN LPLKFRDAET (B07.02) Колоректальная аденокарцинома; аденокарциномы матки/эндометрия; Колоректальная аденокарцинома, MSI+; аденокарциномы матки/эндометрия, MSI+; эндометроидная карцинома; серозная карцинома эндометрия Карциносаркома эндометрия-злокачественная мезодермальная смешанная опухоль; Глиома; астроцитома; GBM
PTEN R130Q KFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGQTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY QTGVMICAYL (A02.01) BRCA, CESC, CRC, GBM, KIRC, LUSC, UCEC
RAC1 P29S MQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGET AFSGEYIPTV (A02.01, A24.02) Меланома
TP53 G245S IRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGSMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEP SMNRRPILT (A02.01, B08.01)
YMCNSSCMGS (A02.01)
BLCA, BRCA, CRC, GBM, HNSC, LUSC, PAAD, PRAD
TP53 R175H TYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRHCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEV BLCA, BRCA, CRC, GBM, HNSC, LUAD, PAAD, PRAD, UCEC
TP53 R248Q EGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNQRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHE GMNQRPILT (A02.01) BLCA, BRCA, CRC, GBM, HNSC, KIRC, LIHC, LUSC, PAAD, PRAD, UCEC
TP53 R248W EGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNWRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHE GMNWRPILT (A02.01) BLCA, BRCA, CRC, GBM, HNSC, LIHC, LUSC, PAAD, SKCM, UCEC
TP53 R273C PEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVCVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPL LLGRNSFEVC (A02.01) BLCA, BRCA, CRC, GBM, HNSC, LUSC, PAAD, UCEC
ТАБЛИЦА 1B MSI-СВЯЗАННЫЙ СДВИГ РАМКИ СЧИТЫВАНИЯ 1
ACVR2A D96fs; +1 GVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKRQP* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
ACVR2A D96fs; -1 GVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKTALKYIFVAVRAICVMKSFLIFRRWKSHSPLQIQLHLSHPITTSCSIPWCHLC* ALKYIFVAV (A02.01, B08.01)
ALKYIFVAVR (A03.01)
AVRAICVMK (A03.01)
AVRAICVMKS (A03.01)
CVEKKTALK (A03.01)
CVEKKTALKY (A01.01)
CVMKSFLIF (A24.02, B08.01)
CVMKSFLIFR (A03.01)
FLIFRRWKS (A02.01, B08.01)
FRRWKSHSPL (B08.01)
FVAVRAICV (A02.01, B08.01)
FVAVRAICVM (B08.01)
IQLHLSHPI (A02.01)
KSFLIFRRWK (A03.01)
KTALKYIFV (A02.01)
KYIFVAVRAI (A24.02)
RWKSHSPLQI (A24.02)
TALKYIFVAV (A02.01, B08.01)
VAVRAICVMK (A03.01)
VMKSFLIFR (A03.01)
VMKSFLIFRR (A03.01)
YIFVAVRAI (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
C15ORF40 L132fs; +1 TAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKVGLALFFFFFETKSCSVAQAGVQWRSLGSLQPPPPGFKLFSCLSFLSSWDYRRMPPCLANFCIFNRDGVSPCWSGWS* ALFFFFFET (A02.01)
ALFFFFFETK (A03.01)
AQAGVQWRSL (A02.01)
CLANFCIFNR (A03.01)
CLSFLSSWDY (A01.01, A03.01)
FFETKSCSV (B08.01)
FFFETKSCSV (A02.01)
FKLFSCLSFL (A02.01)
FLSSWDYRRM (A02.01)
GFKLFSCLSF (A24.02)
KLFSCLSFL (A02.01, A03.01)
KLFSCLSFLS (A02.01, A03.01)
LALFFFFFET (A02.01)
LFFFFFETK (A03.01)
LSFLSSWDY (A01.01)
LSFLSSWDYR (A03.01)
RMPPCLANF (A24.02)
RRMPPCLANF (A24.02)
SLQPPPPGFK (A03.01)
VQWRSLGSL (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
CNOT1 L1544fs; +1 LSVIIFFFVYIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFSVIFSTRCLTDSRYPNICWFK* FFFSVIFST (A02.01)
MSVCFFFFSV (A02.01)
SVCFFFFSV (A02.01, B08.01)
SVCFFFFSVI (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
CNOT1 L1544fs; -1 LSVIIFFFVYIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFCYILNTMFDR* FFCYILNTMF (A24.02)
MSVCFFFFCY (A01.01)
SVCFFFFCYI (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
EIF2B3 A151fs; -1 VLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKQWSSVTSLEWTAQERGCSSWLMKQTWMKSWSLRDPSYRSILEYVSTRVLWMPTSTV* KQWSSVTSL (A02.01)
VLWMPTSTV (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
EPHB2 K1020fs; -1 SIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKREWEKRKQILGGGGKYKEYFLKRILIRKAMTVLAGDKKGLGRFMRCVQSETKAVSLQLPLGR* ILIRKAMTV (A02.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
ESRP1 N512fs; +1 LDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKKHEGQIC* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
ESRP1 N512fs; -1 LDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKT* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
FAM111B A273fs; -1 GALCKDGRFRSDIGEFEWKLKEGHKKIYGKQSMVDEVSGKVLEMDISKKKHYNRKISIKKLNRMKVPLMKLITRV* RMKVPLMK (A03.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
GBP3 T585fs; -1 RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKPRDICRIS* TLKKKPRDI (B08.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
JAK1 P861fs; +1 VNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLKTSN* LIEGFEALLK (A03.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
JAK1 K860fs; -1 CRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKNQQLKWTPHILKSAS* QQLKWTPHI (A02.01)
QLKWTPHILK (A03.01)
IVSEKNQQLK (A03.01)
QLKWTPHILK (A03.01)
QQLKWTPHI (A24.02)
NQQLKWTPHIL (B08.01)
NQQLKWTPHI (B08.01)
QLKWTPHIL (B08.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
LMAN1 E305fs; +1 DDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKRGIPEGPPRPPRAACGGNI* GPPRPPRAAC (B07.02)
PPRPPRAAC (B07.02)В
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
LMAN1 E305fs; -1 DDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKRNSRRATPTSKGSLRRKYLRV* SLRRKYLRV (B08.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
MSH3 N385fs; +1 TKSTLIGEDVNPLIKLDDAVNVDEIMTDTSTSYLLCISENKENVRDKKKGQHFYWHCGSAACHRRGCV* SAACHRRGCV (B08.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
MSH3 K383fs; -1 LYTKSTLIGEDVNPLIKLDDAVNVDEIMTDTSTSYLLCISENKENVRDKKRATFLLALWECSLPQARLCLIVSRTLLLVQS* ALWECSLPQA (A02.01)
CLIVSRTLL (B08.01)
CLIVSRTLLL (A02.01, B08.01)
FLLALWECS (A02.01)
FLLALWECSL (A02.01, B08.01)
IVSRTLLLV (A02.01)
LIVSRTLLL (A02.01, B08.01)
LIVSRTLLLV (A02.01)
LLALWECSL (A02.01, B08.01)
LPQARLCLI (B08.01, B07.02)
LPQARLCLIV (B08.01)
NVRDKKRATF (B08.01)
SLPQARLCLI (A02.01, B08.01)
MSI+CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
NDUFC2 A70fs; +1 LPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFCWILSCKT* FFCWILSCK (A03.01)
FFFCWILSCK (A03.01)
ITAFFFCWI (A02.01)
LYITAFFFCW (A24.02)
YITAFFFCWI (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
NDUFC2 F69fs; -1 SLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFLLDIIL* ITAFFLLDI (A02.01)
LLYITAFFL (A02.01, B08.01)
LLYITAFFLL (A02.01, A24.02)
LYITAFFLL (A24.02)
LYITAFFLLD (A24.02)
YITAFFLLDI (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
RBM27 Q817; +1 NQSGGAGEDCQIFSTPGHPKMIYSSSNLKTPSKLCSGSKSHDVQEVLKKKTGSNEVTTRYEEKKTGSVRKANRMPKDVNIQVRKKQKHETRRKSKYNEDFERAWREDLTIKR* GSNEVTTRY (A01.01)
MPKDVNIQV (B07.02)В В
TGSNEVTTRY (A01.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
RPL22 K16fs; +1 MAPVKKLVVKGGKKKEASSEVHS* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
RPL22 K15fs; -1 MAPVKKLVVKGGKKRSKF* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
SEC31A I462fs; +1 MPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKN* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
SEC31A I462fs; -1 MPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKLMLLRLNLRKMCGPF* KKLMLLRLNL (A02.01)
KLMLLRLNL (A02.01, A03.01, B07.02, B08.01)
KLMLLRLNLR (A03.01)
LLRLNLRKM (B08.01)
LMLLRLNL (B08.01)
LMLLRLNLRK (A03.01)
LNLRKMCGPF (B08.01)
MLLRLNLRK (A03.01)
MLLRLNLRKM (A02.01, A03.01, B08.01)
NLRKMCGPF (B08.01)
NYCQKKLMLL (A24.02)
YCQKKLMLL (B08.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
SEC63 K530fs; +1 AEVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKETFKKKTYTCAITTVKATETKAGKWSRWE* FKKKTYTCAI (B08.01)
ITTVKATETK (A03.01)
KSKKKETFK (A03.01)
KSKKKETFKK (A03.01)
KTYTCAITTV (A02.01, A24.02)
TFKKKTYTC (B08.01)
TYTCAITTV (A24.02)
TYTCAITTVK (A03.01)
YTCAITTVK (A03.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
SEC63 K529fs; -1 MAEVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKRNL* TAKSKKRNL (B08.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
SLC35F5 C248fs; -1 NIMEIRQLPSSHALEAKLSRMSYPVKEQESILKTVGKLTATQVAKISFFFALCGFWQICHIKKHFQTHKLL* FALCGFWQI (A02.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
SMAP1 K172fs; +1 YEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKGREKERKGARKAGKTTYS* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
SMAP1 K171fs; -1 KYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKRKRKREKRSQKSRQNHLQLKSCRRKISNWSLKKVPALKKLRSPLWIF* LKKLRSPL (B08.01)
SLKKVPAL (B08.01)
RKISNWSLKK (A03.01)
VPALKKLRSPL (B07.02)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
TFAM E148fs; +1 IYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKRVNTAWKTKKTSFSL* KRVNTAWKTK (A03.01)
MTKKKRVNTA (B08.01)
RVNTAWKTK (A03.01)
RVNTAWKTKK (A03.01)
TKKKRVNTA (B08.01)
WKTKKTSFSL (B08.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
TFAM E148fs; -1 IYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKS* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
TGFBR2 P129fs; +1 KPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKAW* MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
TGFBR2 K128fs: -1 EKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKNITPAILTCC* ALMSAMTTS (A02.01)
AMTTSSSQK (A03.01, A11.01)
AMTTSSSQKN (A03.01)
CIMKEKKSL (B08.01)
CIMKEKKSLV (B08.01)
IMKEKKSL (B08.01)
IMKEKKSLV (B08.01)
KSLVRLSSCV (A02.01)
LVRLSSCVPV (A02.01)
RLSSCVPVA (A02.01, A03.01)
RLSSCVPVAL (A02.01)
SAMTTSSSQK (A03.01, A11.01)
SLVRLSSCV (A02.01)
VPVALMSAM (B07.02)
VRLSSCVPVA (A02.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
THAP5 K99fs; -1 VPSKYQFLCSDHFTPDSLDIRWGIRYLKQTAVPTIFSLPEDNQGKDPSKKNPRRKTWKMRKKYAQKPSQKNHLY* KMRKKYAQK (A03.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
TTK R854fs; -1 GTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGESHNSSSSKTFEKKGEKNDLQLFVMSDTTYKIYWTVILLNPCGNLHLKTTSL* FVMSDTTYK (A03.01)
FVMSDTTYKI (A02.01)
KTFEKKGEK (A03.01)
LFVMSDTTYK (A03.01)
MSDTTYKIY (A01.01)
VMSDTTYKI (A02.01)
VMSDTTYKIY (A01.01)
MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
XPOT F126fs; -1 QQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFLTFSQ* YLTKWPKFFL (A02.01) MSI+ CRC, MSI+ рак матки/эндометрия, MSI+ рак желудка, синдрома Линча
ТАБЛИЦА 1C СДВИГ РАМКИ СЧИТЫВАНИЯ 1
APC V1352fs
F1354fs
Q1378fs
S1398fs
AKFQQCHSTLEPNPADCRVLVYLQNQPGTKLLNFLQERNLPPKVVLRHPKVHLNTMFRRPHSCLADVLLSVHLIVLRVVRLPAPFRVNHAVEW* FLQERNLPP (A02.01)
FRRPHSCLA (B08.01)
LIVLRVVRL (B08.01)
LLSVHLIVL (A02.01, B08.01)
CRC, LUAD, UCEC, STAD
APC S1421fs
R1435fs
T1438fs
P1442fs
P1443fs
V1452fs
P1453fs
K1462fs
E1464fs
APVIFQIALDKPCHQAEVKHLHHLLKQLKPSEKYLKIKHLLLKRERVDLSKLQ* EVKHLHHLL (B08.01)
HLHHLLKQLK (A03.01)
HLLLKRERV (B08.01)
KIKHLLLKR (A03.01)
KPSEKYLKI (B07.02)
KYLKIKHLL (A24.02)
KYLKIKHLLL (A24.02)
LLKQLKPSEK (A03.01)
LLKRERVDL (B08.01)
LLLKRERVDL (B08.01)
QLKPSEKYLK (A03.01)
YLKIKHLLL (A02.01, B08.01)
YLKIKHLLLK (A03.01)
CRC, LUAD, UCEC, STAD
APC T1487fs
H1490fs
L1488fs
MLQFRGSRFFQMLILYYILPRKVLQMDFLVHPA* ILPRKVLQM (B08.01)
KVLQMDFLV (A02.01, A24.02)
LPRKVLQMDF (B07.02, B08.01)
LQMDFLVHPA (A02.01)
QMDFLVHPA (A02.01)
YILPRKVLQM (A02.01, B08.01)
CRC, LUAD, UCEC, STAD
ARID1A Q1306fs
S1316fs
Y1324fs
T1348fs
G1351fs
G1378fs
P1467fs
ALGPHSRISCLPTQTRGCILLAATPRSSSSSSSNDMIPMAISSPPKAPLLAAPSPASRLQCINSNSRITSGQWMAHMALLPSGTKGRCTACHTALGRGSLSSSSCPQPSPSLPASNKLPSLPLSKMYTTSMAMPILPLPQLLLSADQQAAPRTNFHSSLAETVSLHPLAPMPSKTCHHK* APSPASRLQC (B07.02)
HPLAPMPSKT (B07.02)
ILPLPQLLL (A02.01)
LLLSADQQA (A02.01)
LPTQTRGCI (B07.02)
LPTQTRGCIL (B07.02)
RISCLPTQTR (A03.01)
SLAETVSLH (A03.01)
TPRSSSSSS (B07.02)
TPRSSSSSSS (B07.02)
STAD, UCEC, BLCA, BRCA, LUSC, CESC, KIRC, UCS
ARID1A S674fs
P725fs
R727fs
I736fs
AHQGFPAAKESRVIQLSLLSLLIPPLTCLASEALPRPLLALPPVLLSLAQDHSRLLQCQATRCHLGHPVASRTASCILP* ALPPVLLSL (A02.01)
ALPPVLLSLA (A02.01)
ALPRPLLAL (A02.01)
ASRTASCIL (B07.02)
EALPRPLLAL (B08.01)
HLGHPVASR (A03.01)
HPVASRTAS (B07.02)
HPVASRTASC (B07.02)
IIQLSLLSLL (A02.01)
IQLSLLSLL (A02.01)
IQLSLLSLLI (A02.01, A24.02)
LLALPPVLL (A02.01)
LLIPPLTCL (A02.01)
LLIPPLTCLA (A02.01)
LLSLLIPPL (A02.01)
LLSLLIPPLT (A02.01)
LPRPLLALPP (B07.02)
QLSLLSLLI (A02.01)
RLLQCQATR (A03.01)
RPLLALPPV (B07.02)
RPLLALPPVL (B07.02)
SLAQDHSRL (A02.01)
SLAQDHSRLL (A02.01)
SLLIPPLTCL (A02.01)
SLLSLLIPP (A02.01)
SLLSLLIPPL (A02.01, B08.01)
STAD, UCEC, BLCA, BRCA, LUSC, CESC, KIRC, UCS
ARID1A G414fs
Q473fs
H477fs
S499fs
P504fs
Q548fs
P549fs
PILAATGTSVRTAARTWVPRAAIRVPDPAAVPDDHAGPGAECHGRPLLYTADSSLWTTRPQRVWSTGPDSILQPAKSSPSAAAATLLPATTVPDPSCPTFVSAAATVSTTTAPVLSASILPAAIPASTSAVPGSIPLPAVDDTAAPPEPAPLLTATGSVSLPAAATSAASTLDALPAGCVSSAPVSAVPANCLFPAALPSTAGAISRFIWVSGILSPLNDLQ* AAATSAASTL (B07.02)
AAIPASTSAV (B07.02)
AIPASTSAV (A02.01)
ALPAGCVSSA (A02.01)
APLLTATGSV (B07.02)
APVLSASIL (B07.02)
ATLLPATTV (A02.01)
ATVSTTTAPV (A02.01)
AVPANCLFPA (A02.01)
CLFPAALPST (A02.01)
CPTFVSAAA (B07.02)
FPAALPSTA (B07.02)
FPAALPSTAG (B07.02)
GAECHGRPL (B07.02)
GAISRFIWV (A02.01)
ILPAAIPAST (A02.01)
IWVSGILSPL (A24.02)
LLTATGSVSL (A02.01)
LLYTADSSL (A02.01)
LPAAATSAA (B07.02)
LPAAATSAAS (B07.02)
LPAAIPAST (B07.02)
LPAGCVSSA (B07.02)
LPAGCVSSAP (B07.02)
LYTADSSLW (A24.02)
QPAKSSPSA (B07.02)
QPAKSSPSAA (B07.02)
RFIWVSGIL (A24.02)
RPQRVWSTG (B07.02)
RVWSTGPDSI (A02.01)
SAVPGSIPL (B07.02)
SILPAAIPA (A02.01)
SLPAAATSA (A02.01)
SLPAAATSAA (A02.01)
SLWTTRPQR (A03.01)
SLWTTRPQRV (A02.01)
SPSAAAATL (B07.02)
SPSAAAATLL (B07.02)
TLDALPAGCV (A02.01)
TVSTTTAPV (A02.01)
VLSASILPA (A02.01)
VLSASILPAA (A02.01)
VPANCLFPA (B07.02)
VPANCLFPAA (B07.02)
VPDPSCPTF (B07.02)
VPGSIPLPA (B07.02)
VPGSIPLPAV (B07.02)
WVSGILSPL (A02.01)
YTADSSLWTT (A02.01)
STAD, UCEC, BLCA, BRCA, LUSC, CESC, KIRC, UCS
ARID1A T433fs
A441fs
Y447fs
P483fs
P484fs
P504fs
S519fs
H544fs
P549fs
P554fs
Q563fs
PCRAGRRVPWAASLIHSRFLLMDNKAPAGMVNRARLHITTSKVLTLSSSSHPTPSNHRPRPLMPNLRISSSHSLNHHSSSPLSLHTPSSHPSLHISSPRLHTPPSSRRHSSTPRASPPTHSHRLSLLTSSSNLSSQHPRRSPSRLRILSPSLSSPSKLPIPSSASLHRRSYLKIHLGLRHPQPPQ* APAGMVNRA (B07.02)
ASLHRRSYL (B08.01)
ASLHRRSYLK (A03.01)
FLLMDNKAPA (A02.01)
HPRRSPSRL (B07.02, B08.01)
HPSLHISSP (B07.02)
HRRSYLKIHL (B08.01)
HSRFLLMDNK (A03.01)
KLPIPSSASL (A02.01)
KVLTLSSSSH (A03.01)
LIHSRFLLM (B08.01)
LLMDNKAPA (A02.01)
LMDNKAPAGM (A02.01)
LPIPSSASL (B07.02)
MPNLRISSS (B07.02, B08.01)
MPNLRISSSH (B07.02)
NLRISSSHSL (B07.02, B08.01)
PPTHSHRLSL (B07.02)
RAGRRVPWAA (B08.01)
RARLHITTSK (A03.01)
RISSSHSLNH (A03.01)
RLHTPPSSR (A03.01)
RLHTPPSSRR (A03.01)
RLRILSPSL (A02.01, B07.02, B08.01)
RPLMPNLRI (B07.02)
RPRPLMPNL (B07.02)
SASLHRRSYL (B07.02, B08.01)
SLHISSPRL (A02.01)
SLHRRSYLK (A03.01)
SLHRRSYLKI (B08.01)
SLIHSRFLL (A02.01)
SLIHSRFLLM (A02.01, B08.01)
SLLTSSSNL (A02.01)
SLNHHSSSPL (A02.01, B07.02, B08.01)
SLSSPSKLPI (A02.01)
SPLSLHTPS (B07.02)
SPLSLHTPSS (B07.02)
SPPTHSHRL (B07.02)
SPRLHTPPS (B07.02)
SPRLHTPPSS (B07.02)
SPSLSSPSKL (B07.02)
SYLKIHLGL (A24.02)
TPSNHRPRPL (B07.02, B08.01)
TPSSHPSLHI (B07.02)
STAD, UCEC, BLCA, BRCA, LUSC, CESC, KIRC, UCS
ARID1A A2137fs
P2139fs
L1970fs
V1994fs
RTNPTVRMRPHCVPFWTGRILLPSAASVCPIPFEACHLCQAMTLRCPNTQGCCSSWAS* CVPFWTGRIL (B07.02)
HCVPFWTGRIL (B07.02)
ILLPSAASV (A02.01)
ILLPSAASVC (A02.01)
LLPSAASVCPI (A02.01)
LPSAASVCPI (B07.02)
MRPHCVPF (B08.01)
RILLPSAASV (A02.01)
RMRPHCVPF (A24.02, B07.02, B08.01)
RMRPHCVPFW (A24.02)
RTNPTVRMR (A03.01)
SVCPIPFEA (A02.01)
TVRMRPHCV (B08.01)
TVRMRPHCVPF (B08.01)
VPFWTGRIL (B07.02)
VPFWTGRILL (B07.02)
VRMRPHCVPF (B08.01)
STAD, UCEC, BLCA, BRCA, LUSC, CESC, KIRC, UCS
ARID1A N756fs
S764fs
T783fs
Q799fs
A817fs
TNQALPKIEVICRGTPRCPSTVPPSPAQPYLRVSLPEDRYTQAWAPTSRTPWGAMVPRGVSMAHKVATPGSQTIMPCPMPTTPVQAWLEA* AMVPRGVSM (B07.02, B08.01)
AMVPRGVSMA (A02.01)
AWAPTSRTPW (A24.02)
CPMPTTPVQA (B07.02)
CPSTVPPSPA (B07.02)
GAMVPRGVSM (B07.02, B08.01)
MPCPMPTTPV (B07.02)
MPTTPVQAW (B07.02)
MPTTPVQAWL (B07.02)
SLPEDRYTQA (A02.01)
SPAQPYLRV (B07.02)
SPAQPYLRVS (B07.02)
TIMPCPMPT (A02.01)
TPVQAWLEA (B07.02)
TSRTPWGAM (B07.02)
VPPSPAQPYL (B07.02)
VPRGVSMAH (B07.02)
STAD, UCEC, BLCA, BRCA, LUSC, CESC, KIRC, UCS
β2M N62fs
E67fs
L74fs
F82fs
T91fs
E94fs
RMERELKKWSIQTCLSARTGLSISCTTLNSPPLKKMSMPAV* CLSARTGLSI (B08.01)
CTTLNSPPLK (A03.01)
GLSISCTTL (A02.01)
SPPLKKMSM (B07.02, B08.01)
TLNSPPLKK (A03.01)
TTLNSPPLK (A03.01)
TTLNSPPLKK (A03.01)
CRC, STAD, SKCM, HNSC
β2M L13fs
S14fs
LCSRYSLFLAWRLSSVLQRFRFTHVIQQRMESQIS* LQRFRFTHV (B08.01)
LQRFRFTHVI (B08.01)
RLSSVLQRF (A24.02)
RLSSVLQRFR (A03.01)
VLQRFRFTHV (A02.01, B08.01)
CRC, STAD, SKCM, HNSC
CDH1 A691fs
P708fs
L711fs
RSACVTVKGPLASVGRHSLSKQDCKFLPFWGFLEEFLLC* ASVGRHSLSK (A03.01)
KFLPFWGFL (A24.02)
LASVGRHSL (B07.02)
LPFWGFLEEF (B07.02)
PFWGFLEEF (A24.02)
SVGRHSLSK (A03.01)
ILC LumA Рак молочной железы
CDH1 H121fs
P126fs
H128fs
N144fs
V157fs
P159fs
N166fs
N181fs
F189fs
P201fs
F205fs
IQWGTTTAPRPIRPPFLESKQNCSHFPTPLLASEDRRETGLFLPSAAQKMKKAHFLKTWFRSNPTKTKKARFSTASLAKELTHPLLVSLLLKEKQDG* APRPIRPPF (B07.02)
APRPIRPPFL (B07.02)
AQKMKKAHFL (B08.01)
FLPSAAQKM (A02.01)
GLFLPSAAQK (A03.01)
HPLLVSLLL (B07.02)
KAHFLKTWFR (A03.01)
KARFSTASL (B07.02)
KMKKAHFLK (A03.01)
KTWFRSNPTK (A03.01)
LAKELTHPL (B07.02, B08.01)
LAKELTHPLL (B08.01)
NPTKTKKARF (B07.02)
QKMKKAHFL (B08.01)
RFSTASLAK (A03.01)
RPIRPPFLES (B07.02)
RSNPTKTKK (A03.01)
SLAKELTHPL (A02.01, B08.01)
TKKARFSTA (B08.01)
ILC LumA Рак молочной железы
CDH1 V114fs
P127fs
V132fs
P160fs
PTDPFLGLRLGLHLQKVFHQSHAEYSGAPPPPPAPSGLRFWNPSRIAHISQLLSWPQKTEERLGYSSHQLPRK* GLRFWNPSR (A03.01)
ISQLLSWPQK (A03.01)
RIAHISQLL (A02.01)
RLGYSSHQL (A02.01)
SQLLSWPQK (A03.01)
SRIAHISQL (B08.01)
WPQKTEERL (B07.02)
YSSHQLPRK (A03.01)
ILC LumA Рак молочной железы
CDH1 L731fs
R749fs
E757fs
G759fs
FCCSCCFFGGERWSKSPYCPQRMTPGTTFITMMKKEAEKRTRTLT* CPQRMTPGTT (B07.02)
EAEKRTRTL (B08.01)
GTTFITMMK (A03.01)
GTTFITMMKK (A03.01)
ITMMKKEAEK (A03.01)
RMTPGTTFI (A02.01)
SPYCPQRMT (B07.02)
TMMKKEAEK (A03.01)
TPGTTFITM (B07.02)
TPGTTFITMM (B07.02)
TTFITMMKK (A03.01)
ILC LumA Рак молочной железы
CDH1 S19fs
E24fs
S36fs
WRRNCKAPVSLRKSVQTPARSSPARPDRTRRLPSLGVPGQPWALGAAASRRCCCCCRSPLGSARSRSPATLALTPRATRSRCPGATWREAASWAE* CPGATWREA (B07.02)
CPGATWREAA (B07.02)
RSRCPGATWR (A03.01)
TPRATRSRC (B07.02)
ILC LumA Рак молочной железы
GATA3 P394fs
P387fs
S398fs
H400fs
M401fs
S408fs
P409fs
S408fs
P409fs
T419fs
H424fs
P425fs
S427fs
F431fs
S430fs
H434fs
H435fs
S438fs
M443fs
G444fs
*445fs
PGRPLQTHVLPEPHLALQPLQPHADHAHADAPAIQPVLWTTPPLQHGHRHGLEPCSMLTGPPARVPAVPFDLHFCRSSIMKPKRDGYMFLKAESKIMFATLQRSSLWCLCSNH* HVLPEPHLAL (B07.02)
RPLQTHVLPE (B07.02)
VLWTTPPLQH (A03.01)
Рак молочной железы
GATA3 P426fs
H434fs
P433fs
T441fs
PRPRRCTRHPACPLDHTTPPAWSPPWVRALLDAHRAPSESPCSPFRLAFLQEQYHEA* APSESPCSPF (B07.02)
CPLDHTTPPA (B07.02)
FLQEQYHEA (A02.01, B08.01)
RLAFLQEQYH (A03.01)
SPCSPFRLAF (B07.02)
SPPWVRALL (B07.02)
YPACPLDHTT (B07.02)
Рак молочной железы
MLL2 P519fs
E524fs
P647fs
S654fs
L656fs
R755fs
L761fs
Q773fs
TRRCHCCPHLRSHPCPHHLRNHPRPHHLRHHACHHHLRNCPHPHFLRHCTCPGRWRNRPSLRRLRSLLCLPHLNHHLFLHWRSRPCLHRKSHPHLLHLRRLYPHHLKHRPCPHHLKNLLCPRHLRNCPLPRHLKHLACLHHLRSHPCPLHLKSHPCLHHRRHLVCSHHLKSLLCPLHLRSLPFPHHLRHHACPHHLRTRLCPHHLKNHLCPPHLRYRAYPPCLWCHACLHRLRNLPCPHRLRSLPRPLHLRLHASPHHLRTPPHPHHLRTHLLPHHRRTRSCPCRWRSHPCCHYLRSRNSAPGPRGRTCHPGLRSRTCPPGLRSHTYLRRLRSHTCPPSLRSHAYALCLRSHTCPPRLRDHICPLSLRNCTCPPRLRSRTCLLCLRSHACPPNLRNHTCPPSLRSHACPPGLRNRICPLSLRSHPCPLGLKSPLRSQANALHLRSCPCSLPLGNHPYLPCLESQPCLSLGNHLCPLCPRSCRCPHLGSHPCRLS* ALHLRSCPC (B08.01)
CLHHRRHLV (B08.01)
CLHHRRHLVC (B08.01)
CLHRKSHPHL (B08.01)
CLRSHACPP (B08.01)
CLRSHTCPP (B08.01)
CLWCHACLH (A03.01)
CPHHLKNHL (B07.02)
CPHHLKNLL (B07.02)
CPHHLRTRL (B07.02, B08.01)
CPLHLRSLPF (B07.02, B08.01)
CPLPRHLKHL (B07.02, B08.01)
CPLSLRSHPC (B07.02)
CPRHLRNCPL (B07.02, B08.01)
FPHHLRHHA (B07.02, B08.01)
FPHHLRHHAC (B07.02, B08.01)
GLRSRTCPP (B08.01)
HACLHRLRNL (B08.01)
HLACLHHLR (A03.01)
HLCPPHLRY (A03.01)
HLCPPHLRYR (A03.01)
HLKHLACLH (A03.01)
HLKHRPCPH (B08.01)
HLKNHLCPP (B08.01)
HLKSHPCLH (A03.01)
HLKSLLCPL (A02.01, B08.01)
HLLHLRRLY (A03.01)
HLRNCPLPR (A03.01)
HLRNCPLPRH (A03.01)
HLRRLYPHHL (B08.01)
HLRSHPCPL (B07.02, B08.01)
HLRSHPCPLH (A03.01)
HLRSLPFPH (A03.01)
HLRTRLCPH (A03.01, B08.01)
HLVCSHHLK (A03.01)
HPCLHHRRHL (B07.02, B08.01)
HPGLRSRTC (B07.02)
HPHLLHLRRL (B07.02, B08.01)
HRKSHPHLL (B08.01)
HRRTRSCPC (B08.01)
KSHPHLLHLR (A03.01)
KSLLCPLHLR (A03.01)
LLCPLHLRSL (A02.01, B08.01)
LLHLRRLYPH (B08.01)
LPRHLKHLA (B07.02)
LPRHLKHLAC (B07.02, B08.01)
LRRLRSHTC (B08.01)
LRRLYPHHL (B08.01)
LVCSHHLKSL (B08.01)
NLRNHTCPPS (B08.01)
PLHLRSLPF (B08.01)
RLCPHHLKNH (A03.01)
RLYPHHLKH (A03.01)
RLYPHHLKHR (A03.01)
RPCPHHLKNL (B07.02)
RSHPCPLHLK (A03.01)
RSLPFPHHLR (A03.01)
RTRLCPHHL (B07.02)
RTRLCPHHLK (A03.01)
SLLCPLHLR (A03.01)
SLRSHACPP (B08.01)
SPLRSQANA (B07.02)
YLRRLRSHT (B08.01)
YPHHLKHRPC (B07.02, B08.01)
STAD, BLCA, CRC, HNSC, BRCA
PTEN I122fs
I135fs
A148fs
L152fs
D162fs
I168fs
SWKGTNWCNDMCIFITSGQIFKGTRGPRFLWGSKDQRQKGSNYSQSEALCVLL* FITSGQIFK (A03.01)
IFITSGQIF (A24.02)
SQSEALCVL (A02.01)
SQSEALCVLL (A02.01)
UCEC, PRAD, SKCM, STAD, BRCA, LUSC, KIRC, LIHC, KIRP, GBM
PTEN L265fs
K266fs
KRTKCFTFG* UCEC, PRAD, SKCM, STAD, BRCA, LUSC, KIRC, LIHC, KIRP, GBM
PTEN A39fs
E40fs
V45fs
R47fs
N48fs
PIFIQTLLLWDFLQKDLKAYTGTILMM* AYTGTILMM (A24.02)
DLKAYTGTIL (B08.01)
UCEC, PRAD, SKCM, STAD, BRCA, LUSC, KIRC, LIHC, KIRP, GBM
PTEN T319fs
T321fs
K327fs
A328fs
A333fs
QKMILTKQIKTKPTDTFLQILR* ILTKQIKTK (A03.01)
KMILTKQIK (A03.01)
KPTDTFLQI (B07.02)
KPTDTFLQIL (B07.02)
MILTKQIKTK (A03.01)
UCEC, PRAD, SKCM, STAD, BRCA, LUSC, KIRC, LIHC, KIRP, GBM
PTEN N63fs
E73fs
A86fs
N94fs
GFWIQSIKTITRYTIFVLKDIMTPPNLIAELHNILLKTITHHS* ITRYTIFVLK (A03.01)
LIAELHNIL (A02.01)
LIAELHNILL (A02.01)
MTPPNLIAEL (A02.01)
NLIAELHNI (A02.01)
NLIAELHNIL (A02.01)
RYTIFVLKDI (A24.02)
TITRYTIFVL (A02.01)
TPPNLIAEL (B07.02)
UCEC, PRAD, SKCM, STAD, BRCA, LUSC, KIRC, LIHC, KIRP, GBM
PTEN T202fs
G209fs
C211fs
I224fs
G230fs
P231fs
R233fs
D236fs
NYSNVQWRNLQSSVCGLPAKGEDIFLQFRTHTTGRQVHVL* FLQFRTHTT (A02.01, B08.01)
LPAKGEDIFL (B07.02)
LQFRTHTTGR (A03.01)
NLQSSVCGL (A02.01)
SSVCGLPAK (A03.01)
VQWRNLQSSV (A02.01)
UCEC, PRAD, SKCM, STAD, BRCA, LUSC, KIRC, LIHC, KIRP, GBM
PTEN G251fs
E256fs
K260fs
Q261fs
L265fs
M270fs
H272fs
T286fs
E288fs
YQSRVLPQTEQDAKKGQNVSLLGKYILHTRTRGNLRKSRKWKSM* GQNVSLLGK (A03.01)
HTRTRGNLRK (A03.01)
ILHTRTRGNL (B08.01)
KGQNVSLLGK (A03.01)
LLGKYILHT (A02.01)
LRKSRKWKSM (B08.01)
SLLGKYILH (A03.01)
SLLGKYILHT (A02.01)
UCEC, PRAD, SKCM, STAD, BRCA, LUSC, KIRC, LIHC, KIRP, GBM
TP53 A70fs
P72fs
A76fs
A79fs
P89fs
W91fs
S96fs
V97fs
V97fs
G108fs
G117fs
S121fs
V122fs
C124fs
K139fs
V143fs
SSQNARGCSPRGPCTSSSYTGGPCTSPLLAPVIFCPFPENLPGQLRFPSGLLAFWDSQVCDLHVLPCPQQDVLPTGQDLPCAAVG* CTSPLLAPV (A02.01)
FPENLPGQL (B07.02)
GLLAFWDSQV (A02.01)
IFCPFPENL (A24.02)
LLAFWDSQV (A02.01)
LLAPVIFCP (A02.01)
LLAPVIFCPF (A02.01, A24.02)
LPCPQQDVL (B07.02)
RFPSGLLAF (A24.02)
RFPSGLLAFW (A24.02)
SPLLAPVIF (B07.02)
SPRGPCTSS (B07.02)
SPRGPCTSSS (B07.02)
SQVCDLHVL (A02.01)
VIFCPFPENL (A02.01)
BRCA, CRC, LUAD, PRAD, HNSC, LUSC, PAAD, STAD, BLCA, OV, LIHC, SKCM, UCEC, LAML, UCS, KICH, GBM, ACC
TP53 V173fs
H178fs
D186fs
H193fs
L194fs
E198fs
V203fs
E204fs
L206fs
D207fs
N210fs
T211fs
F212fs
V225fs
S241fs
GAAPTMSAAQIAMVWPLLSILSEWKEICVWSIWMTETLFDIVWWCPMSRLRLALTVPPSTTTTCVTVPAWAA* AMVWPLLSI (A02.01)
AMVWPLLSIL (A02.01)
AQIAMVWPL (A02.01, A24.02)
AQIAMVWPLL (A02.01)
CPMSRLRLA (B07.02, B08.01)
CPMSRLRLAL (B07.02, B08.01)
IAMVWPLLSI (A02.01, A24.02, B08.01)
ILSEWKEICV (A02.01)
IVWWCPMSR (A03.01)
IVWWCPMSRL (A02.01)
IWMTETLFDI (A24.02)
LLSILSEWK (A03.01)
MSAAQIAMV (A02.01)
MSRLRLALT (B08.01)
MSRLRLALTV (B08.01)
MVWPLLSIL (A02.01)
RLALTVPPST (A02.01)
TLFDIVWWC (A02.01)
TLFDIVWWCP (A02.01)
TMSAAQIAMV (A02.01)
VWSIWMTETL (A24.02)
WMTETLFDI (A02.01, A24.02)
WMTETLFDIV (A01.01, A02.01)
BRCA, CRC, LUAD, PRAD, HNSC, LUSC, PAAD, STAD, BLCA, OV, LIHC, SKCM, UCEC, LAML, UCS, KICH, GBM, ACC
TP53 R248fs
P250fs
S260fs
N263fs
G266fs
N268fs
V272fs
V274fs
P278fs
D281fs
R282fs
T284fs
E285fs
L289fs
K292fs
P301fs
S303fs
T312fs
S314fs
K319fs
K320fs
P322fs
Y327fs
F328fs
L330fs
R333fs
R335fs
R337fs
E339fs
TGGPSSPSSHWKTPVVIYWDGTALRCVFVPVLGETGAQRKRISARKGSLTTSCPQGALSEHCPTTPAPLPSQRRNHWMENISPFRSVGVSASRCSES* ALRCVFVPV (A02.01, B08.01)
ALRCVFVPVL (A02.01, B08.01)
ALSEHCPTT (A02.01)
AQRKRISARK (A03.01)
GAQRKRISA (B08.01)
HWMENISPF (A24.02)
LPSQRRNHW (B07.02)
LPSQRRNHWM (B07.02, B08.01)
NISPFRSVGV (A02.01)
RISARKGSL (B07.02, B08.01)
SPFRSVGVSA (B07.02)
SPSSHWKTPV (B07.02, B08.01)
TALRCVFVPV (A02.01)
VIYWDGTAL (A02.01)
VIYWDGTALR (A03.01)
VLGETGAQRK (A03.01)
BRCA, CRC, LUAD, PRAD, HNSC, LUSC, PAAD, STAD, BLCA, OV, LIHC, SKCM, UCEC, LAML, UCS, KICH, GBM, ACC
TP53 S149fs
P151fs
P152fs
V157fs
Q165fs
S166fs
H168fs
V173fs
FHTPARHPRPRHGHLQAVTAHDGGCEALPPP* HPRPRHGHL (B07.02, B08.01)
HPRPRHGHLQ (B07.02)
RPRHGHLQA (B07.02)
RPRHGHLQAV (B07.02, B08.01)
BRCA, CRC, LUAD, PRAD, HNSC, LUSC, PAAD, STAD, BLCA, OV, LIHC, SKCM, UCEC, LAML, UCS, KICH, GBM, ACC
TP53 P47fs
D48fs
D49fs
Q52fs
F54fs
E56fs
P58fs
P60fs
E62fs
M66fs
P72fs
V73fs
P75fs
A78fs
P82fs
P85fs
S96fs
P98fs
T102fs
Y103fs
G108fs
F109fs
R110fs
G117fs
CCPRTILNNGSLKTQVQMKLPECQRLLPPWPLHQQLLHRRPLHQPPPGPCHLLSLPRKPTRAATVSVWASCILGQPSL* GSLKTQVQMK (A03.01)
PPGPCHLLSL (B07.02)
RTILNNGSLK (A03.01)
SLKTQVQMK (A03.01)
SLKTQVQMKL (B08.01)
TILNNGSLK (A03.01)
BRCA, CRC, LUAD, PRAD, HNSC, LUSC, PAAD, STAD, BLCA, OV, LIHC, SKCM, UCEC, LAML, UCS, KICH, GBM, ACC
TP53 L26fs
P27fs
P34fs
P36fs
A39fs
Q38fs
VRKHFQTYGNYFLKTTFCPPCRPKQWMI* CPPCRPKQWM (B07.02)
TTFCPPCRPK (A03.01)
BRCA, CRC, LUAD, PRAD, HNSC, LUSC, PAAD, STAD, BLCA, OV, LIHC, SKCM, UCEC, LAML, UCS, KICH, GBM, ACC
TP53 C124fs
L130fs
N131fs
C135fs
K139fs
A138fs
T140fs
V143fs
Q144fs
V147fs
T150fs
P151fs
P152fs
G154fs
R156fs
R158fs
A161fs
LARTPLPSTRCFANWPRPALCSCGLIPHPRPAPASAPWPSTSSHST* CFANWPRPAL (A24.02)
FANWPRPAL (B07.02, B08.01)
GLIPHPRPA (A02.01)
HPRPAPASA (B07.02, B08.01)
HPRPAPASAP (B07.02)
IPHPRPAPA (B07.02, B08.01)
IPHPRPAPAS (B07.02)
RPALCSCGL (B07.02)
RPALCSCGLI (B07.02)
TPLPSTRCF (B07.02)
WPRPALCSC (B07.02)
WPRPALCSCG (B07.02)