Полипептид и иммунное модулирование

Группа изобретений относится к медицине, в частности к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, включающей бактерии, содержащей указанный вектор, и/или клетки-хозяина, включающей бактерии, содержащей указанную полинуклеотидную последовательность, для снижения воспаления у индивидуума. Также группа изобретений относится к фармацевтической композиции для снижения воспаления у индивидуума, содержащей флагеллин Roseburia и фармацевтически приемлемый эксципиент, носитель или разбавитель. Также описаны питательная добавка, пищевое вещество, продукт питания, диетическая добавка, пищевая добавка, содержащие флагеллин Roseburia. Также описаны способ получения фармацевтичской композиции и питательной добавки, содержащей флагеллин Roseburia. Группа изобретений обеспечивает получение средства, обладающего противовоспалительной и терапевтически релевантной эффективностью. 12 н. и 108 з.п. ф-лы, 27 ил., 18 табл., 1 пр.

 

ОБЛАСТЬ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится к флагеллинам Roseburia, и/или полинуклеотидным последовательностям, кодирующим указанные флагеллины Roseburia, и/или к векторам, содержащим указанные полинуклеотидные последовательности, и/или к клеткам-хозяевам, включая бактерии, содержащим указанные векторы, и/или к клеткам-хозяевам, включая бактерии, содержащим указанные полинуклеотидные последовательности, для различных терапевтических и пищевых применений.

УРОВЕНЬ ТЕХНИКИ

Полагают, что кишечник человека является стерильным в утробе, однако подвергается воздействию различным материнским и внешним микроорганизмам сразу после рождения. После этого происходит динамичный период микробной колонизации и смены сообществ, на которые влияют такие факторы, как путь доставки, окружающие условия, режим питания и генотип хозяина, все из которых влияют на состав микробиоты кишечника, в частности, на ранних стадиях жизни. Затем микробиота стабилизируется и становится похожей на микробиоту взрослого человека (Spor, Koren & Ley 2011). Микробиота кишечника человека содержит более 500-1000 различных филотипов, принадлежащих по существу двум основным бактериальным группам: Bacteroidetes и Firmicutes (Eckburg et al. 2005). Успешные симбиотические взаимосвязи в результате колонизации бактериями кишечника человека обеспечили широкое множество метаболических, структурных, защитных и других благоприятных функций. Повышенная метаболическая активность колонизированного кишечника обеспечивает деградацию в ином случае неперевариваемых компонентов рациона с высвобождением побочных продуктов, обеспечивающих важный источник питательных веществ для хозяина. Аналогично, иммунологическая важность микробиоты кишечника является хорошо известной и проиллюстрирована у безмикробных животных, которые имеют нарушенную иммунную система, которая функционально восстанавливается после введения комменсальных бактерий (Macpherson et al. 2001, Macpherson, Martinic & Harris 2002, Mazmanian et al. 2005).

В противоположность продуцированию секреторного IgA кишечника, на который влияет сама по себе микробная колонизация (Chung, Kasper 2010, Macpherson 2006), развитие и дифференцировка T-клеток, по-видимому, требуют колонизации конкретными комменсальными микроорганизмами. Виды Clostridium, и, в частности, спорообразующие сегментированные нитчатые бактерии (SFB), по-видимому, являются мощным стимулом для дифференцировки и созревания тонкокишечных и толстокишечных Th1, Th17 и Treg (Gaboriau-Routhiau et al. 2009, Ivanov et al. 2009). Недавние исследования продемонстрировали, что другие бактерии кишечника, включая бактерии кластеров Clostridium IV и XIVa и измененную флору Шедлера (ASF), могут влиять на образование de novo Treg, в то время как моноколонизация Bacteroides fragilis может корректировать дисбаланс Th1/Th2 у безмикробных мышей путем стимуляции экспансии Treg (Mazmanian et al. 2005, Geuking et al. 2011, Atarashi et al. 2011). Эти данные подразумевают важные иммунорегуляторные эффекты других резидентных бактерий кишечника. Очевидно, эффекты комменсальных бактерий на пути дифференцировки T-клеток варьируют и, как описано выше, на них может влиять ряд лигандов TLR, для которых было обнаружено, что они ассоциированы с определенными бактериями (Nutsch, Hsieh 2012). Например, механизм, посредством которого SFB влияет на T-клеточные ответы, в настоящее время неизвестен, однако недавние геномные исследования, подтвердившие присутствие генов флагеллина, указывают на то, что врожденные ответы, опосредуемые взаимодействиями TLR5-флагеллин, могут быть важными (Prakash et al. 2011, Sczesnak et al. 2011). Более того, эффекты усиления Treg B. fragilis связывают с PSA и опосредованием событий передачи сигнала TLR2 (Round et al. 2011).

Значительные изменения композиции микробиоты были документально подтверждены при желудочно-кишечных нарушениях, таких как воспалительное заболевание кишечника (IBD). Например, уровни бактерий Clostridium кластера XIVa является сниженным у пациентов с IBD, в то время как число E. coli увеличено, что указывает на сдвиг равновесия симбионтов и патобионтов в кишечнике (Frank et al. 2007, Scanlan et al. 2006, Kang et al. 2010, Machiels K. et al. 2013). Интересно, что этот микробный дисбиоз также ассоциирован с дисбалансом популяций эффекторных T-клеток.

Roseburia относится к филогенетическому кластеру XIVa типа Firmicutes. В настоящее время в роде Roseburia идентифицировано и охарактеризовано пять видов: Roseburia cecicola, Roseburia faecis, Roseburia hominis, Roseburia intestinalis, Roseburia inulinivorans (Stanton and Savage 1983, Duncan et al 2006). Эти бактерии представляют собой жгутиковые комменсальные анаэробы и также являются основными продуцентами бутирата (Duncan et al. 2006). Хотя точные количества этих бактерий, колонизирующих кишечник человека, не было точно оценено, Roseburia spp. являются преобладающими в здоровом кишечнике человека и представлены в меньшем количестве у пациентов с IBD (Machiels K. et al. 2013).

Описаны роли бактериальных генов, в частности флагеллина, участвующих в колонизации и адаптации к кишечнику мыши, а также иммунные гены хозяина, отвечающие на колонизацию бактериями Roseburia. Авторы изобретения показывают, что определенные структуры флагеллина Roseburia, таких как R. hominis и R. intestinalis, индуцируют отчетливые ответы в виде передачи сигнала как в эпителиальных клетках, так и в дендритных клетках относительно других жгутиковых кишечных бактерий. Продемонстрирована важность взаимодействий TLR5-Roseburia, таких как TLR5-R.hominis, при направлении адаптивного ответа хозяина, в частности, ответов Treg. Полная геномная последовательность и аннотация для R. hominis, описанных в настоящем описании, представлена в GenBank под номером доступа CP003040 (версия 1). Для R. intestinalis (номер доступа GenBank для гена 16S рРНК штамма L1-82: AJ312385), описанных в настоящем описании, эталонная геномная последовательность представлена в GenBank под номером доступа ABYJ02000000 (версия 2) и она состоит из последовательностей ABYJ02000001- ABYJ02000409.

ИЗЛОЖЕНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

Неожиданно, авторы настоящего изобретения обнаружили, что белки-флагеллины Roseburia, являются важными для модулирования иммунного ответа.

Кроме того, авторы настоящего изобретения неожиданно обнаружили, что белки-флагеллины, происходящие или получаемые из Roseburia hominis или Roseburia intestinalis, являются важными для модулирования иммунного ответа.

Настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для модулирования воспаления ткани или органа (такого как кишечник) у индивидуума.

В другом аспекте настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для модулирования продукции T-клеток (например, регуляторных T-клеток, таких как регуляторные T-клетки, способные экспрессировать TLR5) у индивидуума.

Настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для восстановления иммунологической толерантности.

В следующем аспекте, настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции иммунной системы индивидуума.

В другом аспекте настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для лечения нарушения у индивидуума, где указанное нарушение представляет собой воспалительное нарушение и/или аутоиммунное нарушение.

Настоящее изобретение, в другом аспекте относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для модулирования дендритных клеток (таких как дендритные клетки костного мозга) и/или эпителиальных клеток в ткани или органе индивидуума.

Настоящее изобретение в следующем аспекте относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции продукции IL-10 и/ или TGFβ в клетке или клетках индивидуума.

В следующем аспекте настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции продукции маркеров клеточной поверхности, вовлеченных в иммунные ответы и распознавание антигена, таких как CD40, I-A/I-E, CD317/BST-2, CD103, CD80, CD86, CD83 и/или Siglec-H и/или их видовые эквиваленты в клетке или клетках индивидуума.

В другом аспекте настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции (например, подавления) экспрессии одного или нескольких генов IFN типа I (таких как, но не ограничиваясь ими, один или несколько генов, выбранных из группы, состоящей из IFN-β1, IFN-β3, Ifi202b, Ifi203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 и Irf4), в клетке или клетках индивидуума.

Настоящее изобретение, в следующем аспекте, относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции (например, подавления) экспрессии одного или нескольких провоспалительных генов (таких как один или несколько генов, выбранных из группы, состоящей из, но не ограничивающейся ими, IL1-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21, IL22, IL23, IL27, IFNγ, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13 и TNF-α) в клетке или клетках индивидуума.

Настоящее изобретение в другом аспекте относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для улучшения микробиоты кишечника у индивидуума.

В другом аспекте настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции аппетита у индивидуума.

В следующем аспекте, настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции (например, подавления) экспрессии гена, кодирующего холицистокинин (Cck) и/или экспрессии гена, кодирующего глюкагон (Gcg) в клетке или клетках индивидуума.

Настоящее изобретение, в следующем аспекте, относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для улучшения здоровья пищеварительного тракта у индивидуума.

Настоящее изобретение, в другом аспекте относится к фармацевтической композиции, содержащей флагеллин Roseburia, и/или полинуклеотидную последовательность, кодирующую указанный флагеллин Roseburia, и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетку-хозяина, содержащую указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и фармацевтически приемлемый эксципиент, носитель или разбавитель.

В другом аспекте настоящее изобретение относится к пищевой добавке, содержащей флагеллин Roseburia, и/или полинуклеотидную последовательность, кодирующую указанный флагеллин Roseburia, и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетку-хозяина, содержащую указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и диетологически приемлемый эксципиент, носитель или разбавитель.

В следующем аспекте, настоящее изобретение относится к пищевому веществу, продукту питания, диетической добавке или пищевой добавке, содержащим флагеллин Roseburia, и/или полинуклеотидную последовательность, кодирующую указанный флагеллин Roseburia, и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетку-хозяина, содержащую указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis).

Настоящее изобретение в следующем аспекте относится к способу получения фармацевтической композиции в соответствии с настоящим изобретением, причем указанный способ включает смешение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), с фармацевтически приемлемым эксципиентом, носителем или разбавителем; причем необязательно указанный флагеллин Roseburia, и/или указанная полинуклеотидная последовательность, и/или указанный вектор, и/или указанная клетка-хозяин, содержащая указанный вектор, и/или указанная клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или указанные Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis) являются инкапсулированными.

В следующем аспекте настоящее изобретение относится к способу получения пищевой добавки в соответствии с настоящим изобретением, причем указанный способ включает смешение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), с диетологически приемлемым эксципиентом, носителем или разбавителем; причем необязательно указанный флагеллин Roseburia, и/или указанная полинуклеотидная последовательность, и/или указанный вектор, и/или указанная клетка-хозяин, содержащая указанный вектор, и/или указанная клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или указанные Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), являются инкапсулированными.

В другом аспекте настоящее изобретение относится к способу модулирования воспаления ткани или органа (такого как кишенчник) у индивидуума, причем указанный способ включает введение индивидууму флагеллина Roseburia, или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит модулирование воспаление ткани или органа (такого как кишечник) у индивидуума.

Настоящее изобретение, в другом аспекте относится к способу модулирования продукции T-клеток (например регуляторных T-клеток, таких как регуляторные T-клетки, способные экспрессировать TLR5) у индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит модулирование продукции T-клеток (например регуляторных T-клеток, таких как регуляторные T-клетки, способные экспрессировать TLR5) у индивидуума.

Настоящее изобретение, в следующем аспекте, относится к способу регуляции иммунной системы индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит регуляция иммунной системы индивидуума.

В следующем аспекте, настоящее изобретение относится к способу лечения нарушения у индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), где указанное нарушение представляет собой воспалительное нарушение и/или аутоиммунное нарушение.

В другом аспекте настоящее изобретение относится к способу модулирования дендритных клеток (таких как дендритные клетки костного мозга) и/или эпителиальных клеток у индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит модулирование дендритных клеток (таких как дендритные клетки костного мозга) и/или эпителиальных клеток у индивидуума.

В следующем аспекте, настоящее изобретение относится к способу регуляции продукции IL-10 и/или TGFβ в клетке или клетках индивидуума, причем указанный способ включает введение флагеллина Roseburia и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму, и где происходит регуляция продуцирования IL-10 и/или TGFβ в клетке или клетках индивидуума.

Настоящее изобретение, в другом аспекте относится к способу регуляции продукции маркеров клеточной поверхности, вовлеченных в иммунные ответы и распознавание антигена, таких как CD40, I-A/I-E, CD317/BST-2, CD103, CD80, CD86, CD83 и/или Siglec-H и/или их видовые эквиваленты, в клетке или клетках индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму, и где происходит регуляция продукции маркеров клеточной поверхности, вовлеченных в иммунные ответы и распознавание антигена, таких как CD40, I-A/I-E, CD317/BST-2, CD103, CD80, CD86, CD83 и/или Siglec-H и/или их видовые эквиваленты, в клетке или клетках индивидуума.

В другом аспекте настоящее изобретение относится к способу регуляции (например, подавления) экспрессии одного или нескольких генов IFN типа I (таких как один или несколько генов, выбранных из группы, состоящей из, но не ограничивающейся ими IFN-β1, IFN-β3, Ifi202b, Ifi203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 и Irf4) в клетке или клетках индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), где происходит регуляция экспрессии одного или нескольких генов IFN типа I (таких как один или несколько генов, выбранных из группы, состоящей из, но не ограничивающейся ими IFN-β1, IFN-β3, Ifi202b, Ifi203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 и Irf4) в клетке или клетках индивидуума.

В следующем аспекте настоящее изобретение относится к способу регуляции (например, подавления) экспрессии одного или нескольких провоспалительных генов (таких как один или несколько генов, выбранных из группы, состоящей из, но не ограничивающейся ими IL1-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21, IL22, IL23, IL27, IFNγ, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13 и TNF-α в клетке или клетках индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), где происходит регуляция экспрессии одного или нескольких провоспалительных генов (таких как один или несколько генов, выбранных из группы, состоящей из, но не ограничивающейся ими IL1-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21, IL22, IL23, IL27, IFNγ, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13 и TNF-α) в клетке или клетках индивидуума.

Настоящее изобретение в следующем аспекте относится к способу улучшения кишечной микробиоты у индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит улучшение микробиоты кишечника.

В другом аспекте настоящее изобретение относится к способу регуляции аппетита у индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит регуляция аппетита у индивидуума.

Настоящее изобретение в другом аспекте относится к способу регуляции (например, подавления) экспрессии гена, кодирующего холицистокинин (Cck), и/или экспрессии гена, кодирующего глюкагон (Gcg), в клетке или клетках индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит регуляция экспрессии гена, кодирующего холицистокинин (Cck), и/или экспрессии гена, кодирующего глюкагон (Gcg), в клетке или клетках индивидуума.

В следующем аспекте настоящее изобретение относится к способу улучшения здоровья пищеварительного тракта у индивидуума, причем указанный способ включает введение флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит улучшение здоровья пищеварительного тракта у индивидуума.

Настоящее изобретение в следующем аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для модулирования воспаления ткани или органа (такого как кишечник) у индивидуума.

Настоящее изобретение, в другом аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для модулирования продукции T-клеток (например регуляторных T-клеток, таких как регуляторные T-клетки, способные экспрессировать TLR5) у индивидуума.

В следующем аспекте, настоящее изобретение относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для регуляции иммунной системы индивидуума.

Настоящее изобретение в следующем аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для лечения нарушения у индивидуума, где указанное нарушение представляет собой воспалительное нарушение и/или аутоиммунное нарушение.

Настоящее изобретение, в другом аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для модулирования дендритных клеток (таких как дендритные клетки костного мозга) и/или эпителиальных клеток в ткани или органе индивидуума.

В другом аспекте настоящее изобретение относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для регуляции продукции IL-10 и/или TGFβ в клетке или клетках индивидуума.

Настоящее изобретение, в следующем аспекте, относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для регуляции продукции маркеров клеточной поверхности, вовлеченных в иммунные ответы и распознавание антигена, таких как CD40, I-A/I-E, CD317/BST-2, CD103, CD80, CD86, CD83 и/или Siglec-H и/или их видовые эквиваленты, в клетке или клетках индивидуума.

В следующем аспекте настоящее изобретение относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для регуляции (например, подавления) экспрессии одного или нескольких генов IFN типа I (таких как один или несколько генов, выбранных из группы, состоящей из, но не ограничивающейся ими IFN-β1, IFN-β3, Ifi202b, Ifi203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 и Irf4) в клетке или клетках индивидуума.

В другом аспекте настоящее изобретение относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для регуляции (например, подавления) экспрессии одного или нескольких провоспалительных генов (таких как один или несколько генов, выбранных из группы, состоящей из, но не ограничивающейся ими IL1-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21, IL22, IL23, IL27, IFNγ, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13 и TNF-α) в клетке или клетках индивидуума.

Настоящее изобретение в следующем аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для улучшения кишечной микробиоты у индивидуума.

Настоящее изобретение в другом аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для регуляции аппетита у индивидуума.

Настоящее изобретение в следующем аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для регуляции (например, подавления) экспрессии гена, кодирующего холицистокинин (Cck), и/или экспрессии гена, кодирующего глюкагон (Gcg), в клетке или клетках индивидуума.

Настоящее изобретение в другом аспекте относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для улучшения здоровья пищеварительного канала у индивидуума.

В другом аспекте настоящее изобретение относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения в медицине.

В следующем аспекте настоящее изобретение относится к флагеллину Roseburia, и/или к полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или к Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для восстановления иммунологической толерантности.

В другом аспекте настоящее изобретение относится к применению флагеллина Roseburia, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для изготовления лекарственного средства для восстановления иммунологической толерантности у индивидуума.

В другом аспекте настоящее изобретение относится к способу восстановления иммунологической толерантности у индивидуума, причем указанный способ включает введение флагеллина Roseburia и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), и где происходит восстановление иммунологической толерантности у индивидуума.

ЧЕРТЕЖИ

Фигура 1. Последовательность и аннотация генома R. hominis. Была получена полная геномная последовательность R. hominis A2-183. Она представлена одной хромосомой размером 3592125 п.н. с четырьмя рибосомальными оперонами, 66 РНК и 3273 прогнозируемыми белками. (A) Карта кольцевого генома R. hominis с указанием положения областей экспериментов ПЦР (таблица S1), на которые были нацелены праймеры. Дорожки на карте генома, начиная с наружной дорожки 0, представляют собой: дорожка 0 (синяя) - эксперименты ПЦР в реальном времени, указанные пронумерованными метками; дорожка 1 (голубой) - прямая CDS; дорожка 2 (голубой) - обратная CDS; дорожка 3 (серый) - рРНК; дорожка 4 (зеленый) - тРНК; дорожка 5 (красный) - маркирующие STS области, на которые нацелена ПЦР в реальном времени; кривая 1 - содержание GC; кривая 2 - смещение в сторону GC. (B) Функциональная аннотация генома R. hominis демонстрирует, что наибольшее число генов относится к генам углеводов, метаболизма белков, аминокислотам и производным.

Фигура 2. R. hominis отвечает на среду кишечника генами активации подвижности, мобилизации и хемотаксиса. Безмикробным самцам мышей GF C3H/HeN вводили культуру R. hominis через зонд в течение 28 суток и сравнивали с контрольными безмикробными животными. На 14 сутки и 28 сутки животных, которым вводили R. hominis (N=5), и контрольных животных (N=4) умерщвляли и подвздошную кишку, ободочную кишку и слепую кишку извлекали. (A) Подтверждение способом ПЦР в реальном времени генов, вовлеченных в переход конъюгация/мобилизация. (B) Подтверждение способом ПЦР в реальном времени генов, вовлеченных в подвижность и хемотаксис. (C) Вестерн-блоттинг R. hominis, выращенных in vitro в присутствии УФ-облученного стандартного корма для мышей, подвергнутых иммунному окрашиванию антителом Fla1, подвергнутым аффинной очистки, специфичной к Fla2 антисывороткой и антителом против ДНК-гиразы A (дорожка 1: без корма, дорожка 2: 0,01 г корма/10 мл культуры R. hominis, дорожка 3: 0,02 г корма /10 мл, дорожка 4: 0,05 г корма/10 мл, дорожка 5: 0,1 г корма/10 мл, дорожка 6: 0,2 г корма/10 мл, дорожка 7: 0,5 г корма/10 мл, дорожка 8: 1 г корма/10 мл). Изображение R. hominis, полученное с использованием электронной микроскопии (EM), демонстрирующее жгутики (черные стрелки). Иммуногистохимия, проведенная для бактерий из содержимого просвета колонизированных мышей и для R. hominis, выращенных in vitro с использованием специфичной к FlaA1 и FlaA2 антисыворотки. Исходное увеличение x1000. (D) Подтверждение с использованием ПЦР в реальном времени генов, вовлеченных в метаболизм бутирата. (E) Анализ с использованием ПЦР в реальном времени транскриптов R. hominis в процессе воздействия in vitro эпителиальных клеток кишечника человека. Результаты ПЦР в реальном времени представлены в качестве кратности изменения, *P<0,05, **P<0,01, ***P<0,001.

Фигура 3. Идентификация транскриптов, дифференциально экспрессирующихся в кишечнике мыши после моноассоциации с R. hominis. (A) Анализ на микрочипах Affymetrix дифференциально экспрессируемых генов у мышей, колонизированных R. hominis (N=5), относительно GF (N=4). Столбиковые диаграммы соответствуют числу генов, выше или ниже экспрессируемых после 14 и 28 суток. (B) Тепловая карта, полученная для дифференциально экспрессируемых генов с функциональной значимостью между мышами GF и мышами, колонизированными R. hominis, на 14 сутки и 28 сутки. (C) Подтверждение с использованием ПЦР в реальном времени генов, для которых было показано, что они значимо различаются между мышами, колонизированными R. hominis, и мышами GF. Результаты ПЦР в реально v времени представлены в качестве кратности изменения, *P<0,05, **P<0,01, ***P<0,001.

Фигура 4. Индукция клеток FoxP3+ Treg посредством Roseburia hominis. Проточно-цитометрический анализ клеток FoxP3+ Treg в собственной пластинке (P=0,0425 между контрольным введением и введением R. hominis) и брыжеечных лимфатических узлах (P=0,0683) общепринятых C3H/HeN, которым проводили введение R. hominis в течение 14 суток.

Фигура 5. Маркеры T-клеток ободочной кишки в значительной степени индуцируются моноколонизацией R. hominis. (A) Иммунофлуоресцентный анализ клеток собственной пластинки восходящей ободочной кишки с помощью антител против CD3 и антител против FoxP3 у безмикробных мышей и мышей, моноколонизированных C3H/HeN R. hominis (N=8) и мышей C57Bl/6 (N=3). (B) Иммунофлуоресцентный анализ клеток собственной пластинки с использованием (i) антитела против Ly6G, (ii) антитела против CD11b, (iii) антитела против CD3, и (iv) антитела против CD3 и антитела против FoxP3 в восходящей ободочной кишке мышей C3H/HeN GF и мышей C3H/HeN, которым вводили R. hominis. Данные выражали в качестве числа положительных клеток на поле зрения у мышей GF (N=7-8) и у мышей, которым вводили R. hominis (N=8-10). *P<0,05. Исходное увеличение x630.

Фигура 6. Флагеллин RH1 R. hominis имеет определенные эффекты на эпителиальные клетки кишечника и происходящие из костного мозга мыши дендритные клетки. (A) Тепловая карта, полученная для дифференциально экспрессированных генов в эпителиальных клетках кишечника Caco-2 (N=1), обработанных различными бактериальными флагеллинами Salmonella enteritidis (SE), E. coli K12 (EC), RH1 и RH2. (B) Экспрессия (i) CD40; (ii) I-A/I-E и (iii) CD103 происходящими из CD11c+B220+CD317+ Flt3L дендритными клетками из общепринятых C3H/HeN, контролей (синий) и после инкубации в течение 24 с рекомбинантным флагеллином (SE, K12, RH1, RH2; зеленый), определенная проточной цитометрией. Гистограмма, на которой представлены данные трех экспериментов. (C) Частоты обработанных рекомбинантным флагеллином (SE, K12, RH1, RH2) полученных с помощью Flt3L и GMCSF дендритных клеток из общепринятых C3H/HeN, улавливаемых в качестве CD11c+B220+CD317+ клеток и CD11c+CD11b+B220- клеток, соответственно. Данные представлены в качестве среднего значения ± SEM процента от всех, живых и единичных клеток, для всех трех экспериментов. (D) Белковую экспрессию цитокинов IL-10 и IL-12 измеряли посредством CBA в супернатантах контрольных (нестимулированные DC; N=3) и обработанных RH1 DC (N=3), происходящих из C3H/HeN и C57Bl/6. Данные представлены в качестве среднего значения ± SD. ***P<0,001. (E) Количественный анализ посредством иммунофлуоресцентного мечения клеток собственной пластинки ободочной кишки антителами против CD3 и антителами против FoxP3 у безмикробных мышей TLR5KO и моноколонизированных посредством R. hominis мышей TLR5KO (N=2).

Фигура 7. R. hominis ослабляет воспаление в экспериментальной модели колита. Двадцать двух самок мышей C57BL/6 использовали для оценки терапевтического эффекта R. hominis в ходе индуцируемого DSS колита. Мышам, которым проводили введение, дозировали каждые сутки 109 к.о.е. R. hominis в течение 14 суток. Начиная с 8 суток мышам вводили DSS в их питьевой воде в течение 6 суток. Животных умерщвляли на 14 сутки и проводили взятие образцов ткани кишечника. (A) У мышей DSS без введения (N=8) происходило выраженное увеличение экспрессии всех генов по сравнению с контрольными мышами (N=4), в то время как дифференциальная экспрессия генов была более низкой у животных, которым вводили R. hominis (N=10). Результаты ПЦР в реальном времени представлены в качестве кратного изменения, ***P<0,001. (B) Гистопатологическая оценка ткани, представленная в качестве среднего процента полей зрения с данной степенью. Введение DSS значительно изменяло все поля зрения со степенями 0, 2, 3 и 4. R. hominis значительно снижали % полей зрения для патологии степени 4 (p=0,02) и увеличивали % полей зрения для степени 0. Данные представлены в качестве среднего значения ± SD. (C) Восходящая ободочная кишка (окрашенная гематоксилином/эозином) контрольных животных IL-10KO, которым вводили DSS, и животных IL-10KO, которым вводили DSS/R. hominis. Представленные изображения представляют собой репрезентативные поля зрения для каждой группы введения. Исходное увеличение x100.

Дополнительные Фигуры

Фигура S1. R. hominis предпочтительно колонизируют восходящую ободочную кишку моноколонизированных мышей. (A) R. hominis колонизировали восходящую ободочную кишку кишечника мышей с тесной ассоциаций бактерий с эпителием хозяина, обнаруженной посредством FISH с использованием A2-183 (зонд, специфический для R. hominis; FITC), Eub338 (универсальный зонд 16S; Cy3) и DAPI (ядра; синий). Также показано наложение A2-183 + Eub338 и Eub338 + DAPI. Величина гамма для красного канала была увеличена для наложения Eub338 + DAPI для иллюстрации меченных бактерий. Original magnification x630. (B) ПЦР с использованием праймеров, специфических для R. hominis, продемонстрировала положительный сигнал в ДНК фекалий после колонизации, в то время как фекалии животных GF были отрицательными в отношении присутствия каких-либо бактерий. (C) Анализ способом ПЦР в реальном времени, демонстрирующий уровни колонизации R. hominis/г фекалий. Бактериальную ДНК, выделенную из фекалий, сравнивали с известными стандартными концентрациями R. hominis, выращенных в культуре. Аналогичные уровни бактерий были обнаружены у всех моноколонизированных мышей, приближаясь к 1x1010 бактерий/г фекалий. Результаты исследования фекалий животных GF были отрицательными в отношении присутствия каких-либо бактерий.

Фигура S2. Анализ генной онтологии, проведенный для генов, активированных через 28 суток в восходящей ободочной кишке кишечнике. Функциональную интерпретацию данных генной онтологии (GO) проводили с использованием DAVID (http://david.abcc.ncifcrf.gov). Значимо отличающиеся транскрипты (P<0,05) были отнесены к категории GO "биологический процесс", чтобы найти значительно увеличенные значения GO. Снижались биологические процессы GO для "полимеризации актина" (GO:0030041) и "отрицательной регуляции каскада I-каппа B киназа/NF-каппа B" (GO:0043124).

Фигура S3. Идентификация транскриптов, дифференциально эксперссируемых в кишечнике мыши после моноассоциации с E. coli. (A) Анализ на микрочипах Affymetrix дифференциально экспрессируемых генов у мышей, колонизированных E. coli и R. hominis с течением времени. Столбиковые диаграммы соответствуют числу генов, выше или ниже экспрессируемых после 22 и 28 суток, соответственно. (B) Тепловая карта, полученная для дифференциально экспрессируемых генов с функциональной значимостью у мышей, колонизированных E. coli, на 22 сутки против 10 суток.

Фигура S4. Идентификация транскриптов, дифференциально экспрессируемых в кишечнике мышей TLR5KO после моноассоциации с R. hominis. (A) Тепловая карта, полученная для дифференциально экспрессируемых генов в восходящей ободочной кишке мышей TLR5KO, колонизированных R. hominis (N=3), и мышей дикого типа (N=3) на 28 сутки. (B) Тепловая карта, полученная для дифференциально экспрессируемых генов, ассоциированных с иммунитетом, в восходящей ободочной кишке мышей TLR5KO, колонизированных R. hominis, и мышей дикого типа на 28 сутки. (C) Тепловая карта, полученная для дифференциально экспрессируемых генов в подвздошной кишке мышей TLR5KO, колонизированных R. hominis, и мышей дикого типа на 28 сутки. (D) Тепловая карта, полученная для дифференциально экспрессируемых генов, ассоциированных с иммунитетом, в восходящей подвздошной кишке мышей TLR5KO, колонизированных R. hominis, и мышей дикого типа на 28 сутки.

Фигура S5. Анализ генной онтологии, проведенный на генах, подавляемых через 28 суток в восходящей кишке. В наибольшей степени снижались биологические процессы GO, вовлеченные в регуляцию аппетита, такие как "отрицательная регуляция ответа на пищу" (GO:0032096), "отрицательная регуляция аппетита" (GO:0032099) и "регуляция секреции катехоламинов" (GO:0050433).

Фигура S6. Колонизация R. hominis влияет на гены сытости и массы тела. Анализ сухой массы тела и липидного каркаса. (A) Сухая масса туши мышей, которым вводили R. hominis, была значительно большей по сравнению с животными GF. (B) Анализ массы туши показал, что общая тучность также была значительно более высокой у животных, которым вводили R. hominis, через 14 суток. Данные представлены в качестве среднего значения ± SD.

Фигура 1A. Представление клонирующего вектора PCR-Blunt II-TOPO, использованного для клонирования рекомбинантных флагеллинов, нерастворимых после лизиса клеток. На нем показано высокоэффективное клонирование ДНК продуктов ПЦР с тупыми концами. Она кодирует гены устойчивости канамицина и зеоцина для селекции в E. coli, и вкладыш фланкируется множеством участков рестрикции для вырезания.

Фиг.2A. Представление экспрессирующего вектора T7-MAT-Tag-FLAG-, использованного для клонирования рекомбинантных флагеллинов, нерастворимых после лизиса клеток. Участок множественного клонирования (MCS) фланкируется последовательностью MAT (металлсодержащая аффинная метка) и последовательностью пептида FLAG (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys), которая приводит к продукции флагеллина с двойным мечением, который далее может быть очищен с использованием аффинных колонок. Этот экспрессирующий вектор также кодирует промотор pT7/lac (lac-оперон фага T7) для индуцируемой IPTG экспрессии на высоком уровне рекомбинантных флагеллинов MAT-ORF-FLAG, внутреннего гена lacI, который подавляет транскрипцию в базальном состоянии в любом хозяине E. coli, и ген AmpR для селекции с ампициллином.

Фигура 3A. Визуализация на SDS-PAGE рекомбинантного флагеллина, клонированного с использованием клонирующего вектора PCR-Blunt II-TOPO и экспрессированного с использованием экспрессирующего вектора pT7-MAT-Tag-FLAG-2. Описание дорожек: 1, белковый стандарт (кДа); 2, RH1.

На фигурах B1A и B1B показан SDS-анализ рекомбинантных флагеллинов.

(A) K12 (Escherichia coli K12); ER (Eubacterium rectale 33656); RI1 (Roseburia intestinalis Fla 1); RI2 (Roseburia intestinalis Fla 2);

(B) RH1 (Roseburia hominis Fla 1); RH2 (Roseburia hominis Fla 2); RI3 (Roseburia intestinalis Fla 3); RI4 (Roseburia intestinalis Fla 4).

Фигура C1-C4. Множественное выравнивание последовательностей, подтверждающее нуклеотидную последовательность флагеллина и номер доступа.

Фигура D.2. Сравнительный анализ индукции гена CCL20 различными флагеллинами. Клетки HT-29 и Caco-2 стимулировали в течение 2 часов одним рекомбинантным флагеллином в концентрации 100 нг/мл. Тотальную РНК экстрагировали и подвергали анализу с использованием количественной ПЦР в реальном времени для генов CCL20 и β-актина. Эксперименты проводили в трех экземплярах в трех отдельных случаях. В таблице D2 указаны значимые отличия между каждой обработкой, вычисленные с использованием парного t-критерия, в HT-29.

Фигура D.3. Опосредуемая флагеллином секреция хемокинов в клетках HT-29 и Caco-2. В таблицах D3a, D3b, D3c и D3d указаны значимые различия между каждой обработкой, вычисленные с использованием парного t-критерия.

Фигура D4, нейтрализация TLR5 с помощью специфического антитела против TLR5.

Фигура D5A: частоты полученных с помощью GM-CSF/IL-4 дендритных клеток, стимулированных рекомбинантными флагеллинами, данные показаны в качестве кратности изменения по сравнению с нестимулированными полученными с помощью GM-CSF/IL-4 дендритными клетками.

Фигура D5B: частоты полученных с помощью Flt3L дендритных клеток, стимулированных рекомбинантными флагеллинами, данные представлены в качестве кратности изменения по сравнению с нестимулированными полученными с помощью Flt3L дендритными клетками.

Фигура D6 A и B. Проточно-цитометрический анализ FoxP3+ Treg в собственной пластинке мышей BOY/J WT и TLR5KO, которым вводили R. hominis.

ПОДРОБНОЕ ОПИСАНИЕ

Флагеллин

Флагеллин является основным компонентом бактериального жгутика, и он присутствует в больших количествах практических всех жгутиковых бактерий. Как правило, флагеллины являются глобулярными белками, которые организуются в полый цилиндр с образованием филамента в бактериальном жгутике.

Разнообразие последовательностей структурных белков и генов флагеллинов хорошо известно и варьируется в зависимости от вида бактерий, географического, и клинического и климатического происхождения. Существуют тысячи флагеллинов и родственных флагеллинам генов. Некоторые из важных флагеллинов в бактериях кишечника включают флагеллины FLA, FliC, FlgC, FLiE, FlaB, MoA и FliG.

Существует несколько типов полипептидов FLA (Fla). FlaA1, FlaA2, FlaA3, FlaA4 и FlaB представляют собой примеры полипептидов FLA.

Полипептид FlaA1

Термин "полипептид FlaA1", как используют в рамках изобретения относится к белку-флагеллину FlaA1. Примеры таких полипептидов включают полипептид FlaA1 Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis и Roseburia inulinivorans; полипептидную последовательность, представленную в качестве SEQ ID NO: 2 или SEQ ID NO: 6; и полипептиды, обладающие по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с SEQ ID NO: 2 или SEQ ID NO: 6, или их варианты, гомологи, фрагменты или производные.

SEQ ID NO: 2 имеет следующую последовательность:

MVVQHNLTAMNANRQLGITTGAQAKSSEKLSSGYKINRAADDAAGLTISEKMRSQVRGLNKASDNAQDGVSLIQVAEGALSETHSILQRMNELATQAANDTNTTSDRTAVQQEINQLASEITRIASTTQFNTMNLIDGNFTSKKLQVGSLCGQAITIDISDMSATGLGVSGLVVSSFSAAGKAMSAAQDAISYVSSMRSKLGALQNRLEHTISHLDNISEHTSSAESRIRDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ

SEQ ID NO: 2 депонирован в NCBI под номером доступа ABI48297.1.

Термины "полипептид FlaA1" и "FlaA1-полипептид" используют в настоящем описании взаимозаменяемо.

Термины "FlaA1", "Fla1" и "RH1" могут использоваться в настоящем описании взаимозаменяемо.

В одном варианте осуществления полипептид FlaA1 обладает по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с SEQ ID NO: 2 или с его вариантами, гомологами, фрагментами или производными. В одном аспекте аминокислоты в положениях 79-117 и в положениях 408-439, а также 411, 412, 420 SEQ ID NO: 2 (или их эквиваленты) считаются важными. В одном аспекте аминокислоты в положениях 411, 412, 420 SEQ ID NO: 2 (или их эквиваленты) представляют собой аланин (A), глутамин (Q) и серин (S), соответственно.

В одном варианте осуществления полипептид FlaA1 представляет собой полипептид, показанный в качестве SEQ ID NO: 2 или SEQ ID NO: 6.

Полипептиды FlaA1 могут происходить из определенных микроорганизмов. В одном аспекте полипептид FlaA1 происходит из бактерии, такой как Firmicute. В следующем аспекте полипептид FlaA1 происходит из Roseburia spp, таких как Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis или Roseburia inulinivorans.

Roseburia hominis и Roseburia intestinalis представляют собой недавно описанные комменсальные анаэробы кишечника филогенетического кластера XIVa в типе Firmicutes, относящиеся к доминирующей группе бактерий в кишечнике человека, а также являются основными продуцентами бутирата. Примером Roseburia hominis является штамм, депонированный согласно условиям Будапештского договора в National Collections of Industrial, Food and Marine Bacteria (NCIMB) в NCIMB Ltd, Ferguson Building, Craibstone Estate, Bucksburn, Aberdeen, UK, AB21 9YA, 21 октября 2004 года организацией Rowett Research Institute под номером доступа NCIMB 14029T Roseburia hominis A2-183T (DSM = 16839T). Другим примером пример является вид бактерий Roseburia hominis, как описано в Duncan, S. H., Aminov, R. I., Scott, K. P., Louis, P., Stanton, T. B., & Flint, H. J. (2006) Int. J. Syst. Evol. Microbiol. 56: 2437-2441. Примером Roseburia intestinalis является штамм, депонированный под номером доступа NCIMB 13810 Rosburia intestinalis L1-82T (DSM = 14610T). Другим примером является вид бактерий Roseburia hominis, как описано в Duncan, S. H., Aminоv, R. I., Scott, K. P., Louis, P., Stanton, T. B., & Flint, H. J. (2006) Int. J. Syst. Evol. Microbiol. 56: 2437-2441.

Термин "полинуклеотидная последовательность, кодирующая полипептид FlaA1", как используют в рамках изобретения, относится к полинуклеотидной последовательности, кодирующей белок флагеллина белок FlaA1. Примеры таких полинуклеотидных последовательностей включают ген FlaA1 R. hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis или Roseburia inulinivorans; полинуклеотидную последовательность, представленную в качестве SEQ ID NO: 1 или SEQ ID NO: 5; полинуклеотидные последовательности, кодирующие полипептид, представленный в качестве SEQ ID NO: 2 или SEQ ID NO: 6; полинуклеотидные последовательности, обладающие по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с SEQ ID NO: 1 или SEQ ID NO: 5 или их варианты, гомологи, фрагменты или производные; и полинуклеотидные последовательности, кодирующие полипептид, показанный в качестве SEQ ID NO: 2 или SEQ ID NO: 6, или кодирующие полипептид, обладающий по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с полипептидом, показанным в качестве SEQ ID NO: 2 или SEQ ID NO: 6 или их варианты, гомологи, фрагменты или производные.

SEQ ID NO: 1 имеет следующую последовательность:

ATGGTAGTACAGCACAATCTTACAGCAATGAACGCTAACAGACAGTTAGGTATCACAACAGGCGCACAGGCTAAGTCTTCTGAGAAGTTATCTTCTGGTTACAAGATCAACCGCGCAGCAGATGACGCAGCAGGTCTTACGATTTCCGAGAAGATGAGAAGCCAGGTTAGAGGCTTAAATAAAGCTTCTGACAACGCACAGGATGGTGTATCCCTTATTCAGGTAGCTGAGGGTGCATTAAGTGAGACACACTCCATCTTACAGCGTATGAATGAGTTAGCAACTCAGGCAGCAAACGATACCAATACAACCTCAGACAGAACTGCAGTTCAGCAGGAGATCAACCAGTTAGCATCTGAGATCACCAGAATCGCTTCTACAACTCAGTTCAACACAATGAACCTGATCGATGGTAACTTCACAAGTAAGAAGCTTCAGGTAGGTTCCCTTTGCGGACAGGCTATCACAATCGATATCTCTGATATGTCTGCTACAGGTCTTGGCGTTAGCGGATTAGTAGTATCTTCCTTCTCTGCAGCTGGTAAGGCAATGTCTGCAGCTCAGGATGCTATCAGCTACGTATCTTCTATGCGTTCTAAGCTGGGTGCATTACAGAACAGACTTGAGCACACAATCTCCCACCTGGACAACATTTCTGAGCACACATCTTCTGCAGAGTCTCGTATCCGTGATACAGATATGGCTGAAGAGATGGTTGAGTACAGCAAGAACAACATCCTTGCTCAGGCAGGACAGTCTATGCTTGCTCAGGCTAACCAGTCTACTCAGGGTGTATTATCCTTATTACAGTAA

SEQ ID NO: 1 депонирована в NCBI под номером доступа DQ789140.1.

В одном варианте осуществления полинуклеотидная последовательность, кодирующая полипептид FlaA1, обладает по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с полинуклеотидной последовательностью, показанной в качестве SEQ ID NO: 1 или SEQ ID NO: 5 или с их вариантами, гомологами, фрагментами или производными.

В одном варианте осуществления полинуклеотидная последовательность, кодирующая полипептид FlaA1, кодирует полипептид, показанный в качестве SEQ ID NO: 2 или SEQ ID NO: 6, или полипептид, обладающий по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с полипептидом, показанным в качестве SEQ ID NO: 2 или SEQ ID NO: 6, или с их вариантами, гомологами, фрагментами или производными.

В одном варианте осуществления полипептид FlaA1 представляет собой укороченный полипептид FlaA1. Например, укороченный полипептид содержит по меньшей мере 20, 30, 40, 50, 75, 100, 125, 150, 175 или 200 аминокислот полипептида, показанного в качестве SEQ ID NO: 2 или SEQ ID NO: 6.

Без связи с теорией, двумя необходимыми областями белка флагеллина, вовлеченного в распознавание и активацию TLR5, являются аминокислоты 79-117 SEQ ID NO: 2 (домен N-D1) и аминокислоты 408-439 SEQ ID NO: 2 (домен C-D1). Без связи с теорией, аминокислоты: A411, Q412, S420 являются важными аминокислотами.

Примеры укороченных полипептидов FlaA1 включают: полипептиды, которые содержат аминокислоты 79-117 и аминокислоты 408-439 SEQ ID NO: 2; полипептиды, обладающие по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью аминокислотами 79-117 и аминокислотами 408-439 SEQ ID NO: 2; полипептиды, обладающие по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с аминокислотами 79-117 и аминокислотами 408-439 SEQ ID NO: 2, где аминокислота в положении 411 (или ее эквивалент) представляет собой аланин (A) и/или аминокислота в положении 214 представляет собой глутамин (Q) и/или аминокислота в положении 420 представляет собой серин (S); полипептиды, содержащие аминокислоты 79-439 SEQ ID NO: 2; полипептиды, содержащие аминокислоты 79-439 SEQ ID NO: 2, где аминокислота в положении 411 (или ее эквивалент) представляет собой аланин (A); полипептиды, обладающие по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с аминокислотами 79-439 SEQ ID NO: 2; и полипептиды, обладающие по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с аминокислотами 79-439 SEQ ID NO: 2, где аминокислота в положении 411 (или ее эквивалент) представляет собой аланин (A) и/или аминокислота в положении 214 представляет собой глутамин (Q) и/или аминокислота в положении 420 представляет собой серин (S).

В одном аспекте аминокислоты в положениях 411, 412, 420 SEQ ID NO: 2 (или их эквиваленты) в укороченном полипептиде FlaA1 представляют собой аланин (A), глутамин (Q) и серин (S), соответственно.

В одном варианте осуществления полинуклеотидная последовательность, кодирующая полипептид FlaA1, кодирует укороченный полипептид FlaA1.

В одном варианте осуществления полипептид FlaA1 представляет собой слитый полипептид. Например, полипептид является слитым с глутатион-S-трансферазой (GST).

Род Roseburia

Бактерии Roseburia представляют собой немного искривленные палочковидные клетки, которые являются строго анаэробными и аборигенными для кишечника млекопитающих. Бактерии являются продуцирующими бутират и активно подвижными посредством множества жгутиков, присутствующих вдоль вогнутой стороны и кластером на одном конце (Stanton and Savage 1983). В настоящее время в роде Roseburia, было идентифицировано и охарактеризовано пять видов: Roseburia cecicola, Roseburia faecis, Roseburia hominis, Roseburia intestinalis и Roseburia inulinivorans (Stanton и Savage 1983, Duncan et al 2006).

В Stanton and Savage (1983 - Roseburia cecicola gen. nov., sp. nov., a motile, obligately anaerobic bacterium from a mouse cecum. Int. J. Syst. Bacteriol., 1983, 33, 618-627.) описаны Roseburia cecicola.

В Duncan et al. (2006 - Proposal of Roseburia faecis sp. nov., Roseburia hominis sp. nov. and Roseburia inulinivorans sp. nov., based on isolates from human faeces. Int. J. Syst. Evol. Microbiol., 2006, 56, 2437-2441) описаны Roseburia faecis.

В Duncan et al. (2006 - Proposal of Roseburia faecis sp. nov., Roseburia hominis sp. nov. and Roseburia inulinivorans sp. nov., based on isolates from human faeces. Int. J. Syst. Evol. Microbiol., 2006, 56, 2437-2441) описаны Roseburia hominis.

В Duncan et al. (2002 - Roseburia intestinalis sp. nov., a novel saccharolytic, butyrate-producing bacterium from human faeces. Int. J. Syst. Evol. Microbiol., 2002, 52, 1615-1620) описаны Roseburia intestinalis.

В Duncan et al. (2006 - Proposal of Roseburia faecis sp. nov., Roseburia hominis sp. nov. and Roseburia inulinivorans sp. nov., based on isolates from human faeces. Int. J. Syst. Evol. Microbiol., 2006, 56, 2437-2441) описаны Roseburia inulinivorans.

Флагеллин Roseburia

Термин "флагеллин Roseburia", как используют в рамках изобретения, относится к белку-флагеллину, происходящему или получаемому из бактерий Roseburia, таких как Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis и Roseburia inulinivorans.

Флагеллин Roseburia может представлять собой flaA1, flaA2, flaA3, flaA4 или их комбинации.

Термины "FlaA1", "Fla1", "flaA1" и "fla1" используют в настоящем описании.

Термины "FlaA2", "Fla2", "flaA2" и "fla2" используют в настоящем взаимозаменяемо.

Термин Fla используют в настоящем описании для обозначения полипептидов, которые могут представлять собой flaA1, flaA2, flaA3, flaA4 или fliC.

В одном варианте осуществления настоящее изобретение охватывает применение по меньшей мере одного флагеллина Roseburia. Например, настоящее изобретение охватывает применение комбинации по меньшей мере двух, по меньшей мере трех, по меньшей мере четырех или по меньшей мере пяти флагеллинов Roseburia.

В некоторых вариантах осуществления комбинация флагеллинов Roseburia содержит флагеллины, которые происходят или которые могут быть получены из по меньшей мере двух, трех, четырех или пяти различных видов Roseburia.

Примеры флагеллинов Roseburia включают флагеллины, происходящие или получаемые из бактерий Roseburia, таких как Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis и Roseburia inulinivorans. В одном варианте осуществления флагеллин происходит или может быть получен из Roseburia hominis. В другом варианте осуществления флагеллин происходит или может быть получен из Roseburia intestinalis.

Примеры флагеллинов Roseburia включают полипептидные последовательности, обладающие по меньшей мере 75%, 80%, 85%, 90%, 95%, 97%, 98% или 99% идентичностью с SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12, или их варианты, гомологи, фрагменты или производные.

В одном варианте осуществления флагеллин Roseburia обладает полипептидной последовательностью, показанной в качестве SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12.

Примерами флагеллинов Roseburia hominis являются Fla1 и Fla2 Roseburia hominis.

Пример Roseburia hominis Fla1 представлен в качестве SEQ ID NO: 2. Fla1 Roseburia hominis также обозначают в настоящем описании как RhFlaA1, RHFlaA1, RhFla1, RHFla1, RH1 или Rh1.

SEQ ID NO: 2 имеет следующую последовательность:

MVVQHNLTAMNANRQLGITTGAQAKSSEKLSSGYKINRAADDAAGLTISEKMRSQVRGLNKASDNAQDGVSLIQVAEGALSETHSILQRMNELATQAANDTNTTSDRTAVQQEINQLASEITRIASTTQFNTMNLIDGNFTSKKLQVGSLCGQAITIDISDMSATGLGVSGLVVSSFSAAGKAMSAAQDAISYVSSMRSKLGALQNRLEHTISHLDNISEHTSSAESRIRDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ

SEQ ID NO: 2 депонирована в NCBI под номером доступа ABI48297.1.

Пример Fla2 Roseburia hominis представлен в качестве SEQ ID NO: 4. Fla2 Roseburia hominis также обозначают в настоящем описании как RhFlaA2, RHFlaA2, RhFla2, RHFla2, Rh2 или RH2.

SEQ ID NO: 4 имеет следующую последовательность:

MVVNHNMAAICESRQLRYNVKKMEKSSKKLATGYKLNTANDDAAGLQISETMRHHVKGLNKASRNSQDGISMLQTADAALQETQDVLDRMVELTTQAANDINTDSDRRAIQDELDQLNKEVDRIAYTTHFNQQYMLAEGTPQAAPGYYRIQSGALNGQAIDIHFVNASKESLGTDKVNVSSHAKASESITMVQDAIEQAALWRDEFGSQQERLEHAVRNTDNTSQNTQSAESGIRDTNMNMEMVLYSTNRILVHASQSILAQYNDDAKSVLEILK

Примеры флагеллинов Roseburia intestinalis включают Fla1, Fla2, Fla3 и Fla4 Roseburia intestinalis.

Пример Fla1 Roseburia intestinalis представлен в качестве SEQ ID NO: 6. Roseburia intestinalis также обозначают в настоящем описании как RiFlaA1, RIFlaA1, RiFla1, RIFla1, Ri1 или RI1.

SEQ ID NO: 6 имеет следующую последовательность:

MRINYNVSAAIANKHLLGIEDNLSASMERLSSGLKINHSKDNPAGMAISNKMKAQIDGLNRASQNASDGISVIQIADGALSETTSILQRMRELSVQAASDATMTPADKEAIQKEITSLKDEVDRISTDTEYNSKTLLDGSLDTRVYTKNATRVDISDHVKAGQYQLSIDTAATQAGPVTANQNYNSTAPVGASGTMSINGSKVEIEAADTYAEAFEKIRNAAETGETTVKIEKNGALSFTAEQYGMSSILEIAFDDKQLANALGFTADGGNSVVEDPENKGSYVYGQIQNGKVIVPSGTDAEVTLTKPSDGTGFGDTATVKTDGNKITVTDRAGFEMSFLADAGYTGKLDFDVTDIGTMALHIGANEDQETRVRIPEVSCKSLYIDDADVTTVNGAGRGITQFDDAISKVSEVRSRLGAYQNRLESTVSSLDTFEENMTGAQSRLTDADMASEMTDYTHQNVLNQAAISVLTQANDLPQ

Пример Fla2 Roseburia intestinalis представлен в качестве SEQ ID NO: 8. Fla2 Roseburia intestinalis также обозначают в настоящем описании как RiFlaA2, или RIFlaA2, или Ri2, или RI2.

SEQ ID NO: 8 имеет следующую последовательность:

MVVNHNMALICESRQLRCNVKNMEKSSKKLATGYKLLGANDDAAGLQISETMRHQTRGLNKASRNSQDGISMLQTADAALQETQEVLDRMTDLTTQAANDINTDADRRAIQDEIDQLNQEVDRIAYTTNFNQQYILADGTPQARPGYYMIQTGSLAGQGIEIKFVNASKESLGVDKVDVSSHAKATESIAVVQNAIEKAASFRDTFGAQQERLEHALRGTDNTSESTQRAESSRRDTNMNMEMVQYSTNRILVQASQSILAQYNDDAKYVLEMLKQVLQILQ

Пример Fla3 Roseburia intestinalis представлен в качестве SEQ ID NO: 10. Fla3 Roseburia intestinalis также обозначается в настоящем описании как RiFla3, или RIFla3, или Ri3, или RI3.

SEQ ID NO: 10 имеет следующую последовательность:

MVVQHNMTAMNANRMLGVTTSAQAKSSEKLSSGYRINRAGDDAAGLTISEKMRSQIRGLNKASDNAQDGISLIQVAEGALSETHSILQRMNELATQAANDTNTTADRGAIQDEINQLTSEINRISSTTQFNTQNLIDGTFANKNLQVGSICGQRITVSIDSMSAGSLNVSANLVKVNTFSAAGEAMSNIQGAISAISTQRSYLGALQNRLEHTISNLDNISENTQSAESRIRDTDMAEEMVTYSKNNILAQAGQSMLAQANQSTQGVLSLLQ

Пример Fla4 Roseburia intestinalis представлен в качестве SEQ ID NO: 12. Fla4 Roseburia intestinalis также обозначают в настоящем описании как RiFla4, или RIFla4, или Ri4, или RI4.

SEQ ID NO: 12 имеет следующую последовательность:

MAMVVQHNMSAMNANRNLGVTTGMQAKSSEKLSSGYKINRAADDAAGLSISEKMRSQIRGLNKASDNAQDGISLIQTAEGALNESHSILQRMRELSVQAANGTETDDDREAVQNEVSQLQEELTRISETTEFNTMKLLDGSQSGSTSSTGSGPKFGVVDATLDGALVTSNVKGIKVATAAATTTKAGQETAIWAADGKTLTLNLSKNKVYTQDEIDDLIANAKQEDSSATGAPAEVKVSLKNGIFNADADTTAGTVTAGGVKAVSDEGTVTGFVGADTISFTANKYGAEFNDTVFKFKFDKAAGKEEVETNTAIEIDGANAVTAGEYTIHLAAGKEYTAEDLEDVLKTAGFDFDVKLSGNTPDEPNTLFATSGASTVTD

ITMGAGTAGAGLGSTDAMWGQAGYDSVSSGAGITLQIGANEGQTMSFSIDDMSARALGVDGNKVDLSTQAGAQKATDTIDAAIKKVSAQRGRMGAIQNRLEHTISNLDTAAENTQTAESRIRDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ

Термины "полипептид FlaA1", "FlaA1-полипептид", "полипептид-Fla1" и "Fla1-полипептид" используют в настоящем описании взаимозаменяемо. Термины "полипептид Fla2" и "Fla2-полипептид" используют в настоящем описании взаимозаменяемо. Термины "полипептид Fla3" и "Fla3-полипептид" используют в настоящем описании взаимозаменяемо. Термины "полипептид Fla4" и "Fla4-полипептид" используют в настоящем описании взаимозаменяемо.

В одном аспекте флагеллин Roseburia выбран из группы, состоящей из Fla1, Fla2, Fla3 и Fla4. В одном варианте осуществления флагеллин Roseburia выбран из группы, состоящей из Fla2, Fla1, Fla4 и их комбинаций. В следующем варианте осуществления флагеллин Roseburia представляет собой Fla2.

В одном аспекте флагеллин Roseburia выбран из группы, состоящей из Fla1 Roseburia hominis, Fla2 Roseburia hominis, Fla1 Roseburia intestinalis, Fla2 Roseburia intestinalis, Fla3 Roseburia intestinalis и Fla4 Roseburia intestinalis. В одном варианте осуществления флагеллин Roseburia выбран из группы, состоящей из Fla2 Roseburia hominis, Fla2 Roseburia intestinalis, Fla1 Roseburia intestinalis, Fla4 Roseburia intestinalis и их комбинаций. В следующем варианте осуществления флагеллин Roseburia выбран из группы, состоящей из Fla2 Roseburia hominis, Fla2 Roseburia intestinalis и их комбинаций. В другом варианте осуществления флагеллин Roseburia представляет собой Fla2 Roseburia intestinalis.

В одном варианте осуществления настоящее изобретение охватывает применение по меньшей мере одной полинуклеотидной последовательности, кодирующей флагеллин Roseburia. Например, настоящее изобретение охватывает применение комбинации по меньшей мере двух, по меньшей мере трех, по меньшей мере четырех или по меньшей мере пяти полинуклеотидных последовательностей, кодирующих флагеллины Roseburia.

В одном варианте осуществления настоящее изобретение охватывает применение полинуклеотидной последовательности, кодирующей по меньшей мере один флагеллин Roseburia. Например, настоящее изобретение охватывает применение полинуклеотидной последовательности, кодирующей комбинацию по меньшей мере двух, по меньшей мере трех, по меньшей мере четырех или по меньшей мере пяти полипептидных последовательностей, кодирующих флагеллины Roseburia.

Полинуклеотидная последовательность, кодирующая флагеллин Roseburia, может кодировать flaA1, flaA2, fla3, fla4 или их комбинации.

В некоторых вариантах осуществления комбинация полинуклеотидных последовательностей, кодирующая флагеллины Roseburia, содержит полинуклеотидные последовательности, кодирующие флагеллины, которые происходят или могут быть получены из по меньшей мере двух, трех, четырех или пяти различных видов Roseburia.

В некоторых вариантах осуществления полинуклеотидная последовательность кодирует комбинацию флагеллинов Roseburia, которые происходят или могут быть получены по меньшей мере из двух, трех, четырех или пяти различных видов Roseburia.

В другом варианте осуществления настоящее изобретение охватывает применение комбинации по меньшей мере одного флагеллина Roseburia и по меньшей мере одной полинуклеотидной последовательности, кодирующей флагеллин Roseburia.

Примеры полинуклеотидной последовательности, кодирующей флагеллины Roseburia, включают флагеллины, происходящие или получаемые из бактерий Roseburia, таких как Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis и Roseburia inulinivorans. В одном варианте осуществления полинуклеотидная последовательность кодирует флагеллин Roseburia, происходящий или получаемый из Roseburia hominis. В другом варианте осуществления полинуклеотидная последовательность кодирует флагеллин Roseburia, происходящий или получаемый из Roseburia intestinalis.

Примеры полинуклеотидны последовательностей, кодирующих флагеллин Roseburia, включают полинуклеотидные последовательности, кодирующие полипептид, который обладает по меньшей мере 75% идентичностью с SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12 или их варианты, гомологи, фрагменты или производные, и полинуклеотидные последовательности, обладающие по меньшей мере 75% идентичностью с SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9 или SEQ ID NO: 11 или их вариантами, гомологами, фрагментами или производными.

В одном варианте осуществления полинуклеотидная последовательность, кодирующая флагеллин Roseburia, имеет полинуклеотидную последовательность, кодирующую полипептид, который обладает последовательностью, показанной в качестве SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12.

В одном варианте осуществления полинуклеотидная последовательность, кодирующая флагеллин Roseburia, имеет полинуклеотидную последовательность, показанную в качестве SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9 или SEQ ID NO: 11.

Примерами полинуклеотидных последовательностей, кодирующих флагеллины Roseburia hominis, являются полинуклеотидные последовательности, кодирующие Fla1 и Fla2 Roseburia hominis.

Пример полинуклеотидной последовательности, кодирующей Fla1 Roseburia hominis, представлен в качестве SEQ ID NO: 1.

SEQ ID NO: 1 имеет следующую последовательность:

ATGGTAGTACAGCACAATCTTACAGCAATGAACGCTAACAGACAGTTAGGTATCACAACAGGCGCACAGGCTAAGTCTTCTGAGAAGTTATCTTCTGGTTACAAGATCAACCGCGCAGCAGATGACGCAGCAGGTCTTACGATTTCCGAGAAGATGAGAAGCCAGGTTAGAGGCTTAAATAAAGCTTCTGACAACGCACAGGATGGTGTATCCCTTATTCAGGTAGCTGAGGGTGCATTAAGTGAGACACACTCCATCTTACAGCGTATGAATGAGTTAGCAACTCAGGCAGCAAACGATACCAATACAACCTCAGACAGAACTGCAGTTCAGCAGGAGATCAACCAGTTAGCATCTGAGATCACCAGAATCGCTTCTACAACTCAGTTCAACACAATGAACCTGATCGATGGTAACTTCACAAGTAAGAAGCTTCAGGTAGGTTCCCTTTGCGGACAGGCTATCACAATCGATATCTCTGATATGTCTGCTACAGGTCTTGGCGTTAGCGGATTAGTAGTATCTTCCTTCTCTGCAGCTGGTAAGGCAATGTCTGCAGCTCAGGATGCTATCAGCTACGTATCTTCTATGCGTTCTAAGCTGGGTGCATTACAGAACAGACTTGAGCACACAATCTCCCACCTGGACAACATTTCTGAGCACACATCTTCTGCAGAGTCTCGTATCCGTGATACAGATATGGCTGAAGAGATGGTTGAGTACAGCAAGAACAACATCCTTGCTCAGGCAGGACAGTCTATGCTTGCTCAGGCTAACCAGTCTACTCAGGGTGTATTATCCTTATTACAGTAA

Пример полинуклеотидной последовательности, кодирующей Fla2 Roseburia hominis, представлен в качестве SEQ ID NO: 3.

SEQ ID NO: 3 имеет следующую последовательность:

ATGGTGGTTAATCATAATATGGCGGCAATCTGTGAGAGCAGGCAGCTGCGCTATAACGTGAAGAAGATGGAAAAATCTTCCAAAAAGCTTGCGACAGGGTACAAGCTGAACACAGCAAATGATGATGCGGCAGGCTTGCAGATATCAGAGACGATGCGGCATCATGTGAAAGGGCTGAACAAAGCCTCCCGGAATTCACAGGACGGCATCAGTATGCTGCAGACGGCGGATGCAGCGCTCCAAGAGACGCAGGATGTTCTCGATCGTATGGTGGAGCTGACGACGCAGGCAGCCAATGACATCAACACAGACTCGGATCGCAGGGCTATTCAGGATGAGTTGGATCAGCTGAACAAGGAAGTGGACCGCATCGCCTATACGACGCACTTCAATCAGCAGTATATGTTGGCGGAGGGAACGCCGCAGGCGGCACCGGGATATTACCGCATACAGTCCGGGGCACTGAACGGACAGGCGATAGATATCCATTTTGTAAATGCGAGCAAGGAGAGCCTTGGCACAGACAAAGTGAATGTATCTTCGCATGCGAAGGCGTCGGAATCCATCACGATGGTTCAGGACGCGATTGAACAGGCGGCGCTCTGGAGAGACGAGTTCGGCAGCCAGCAGGAGCGTCTGGAACATGCCGTGCGCAATACGGACAACACATCACAAAATACGCAGAGTGCGGAGTCAGGGATCAGAGACACCAACATGAATATGGAGATGGTATTATATTCGACCAACCGGATTCTGGTGCATGCATCCCAGAGTATTCTGGCACAGTATAATGATGATGCAAAATCAGTGCTTGAGATTTTGAAATAG

Примерами полинуклеотидных последовательностей, кодирующих флагеллины Roseburia intestinalis, являются полинуклеотидные последовательности, кодирующие Fla1, Fla2, Fla3 и Fla4 Roseburia intestinalis.

Пример полинуклеотидной последовательности, кодирующей Fla1 Roseburia intestinalis представлен в качестве SEQ ID NO: 5.

SEQ ID NO: 5 имеет следующую последовательность:

ATGCGTGGCGGAGACAATAGAAGGAGAAACAGAATGAGAATTAATTACAATGTGTCAGCAGCGATTGCGAATAAACATTTACTTGGAATTGAGGATAATTTAAGTGCATCGATGGAACGGCTTTCATCGGGACTTAAGATCAACCATTCCAAGGACAATCCGGCAGGAATGGCTATTTCCAACAAGATGAAAGCACAGATTGATGGTTTAAACCGGGCTTCCCAGAATGCATCGGATGGTATTTCTGTTATTCAGATCGCAGATGGTGCGCTGAGTGAAACGACCAGTATTTTACAGCGTATGAGAGAACTTTCCGTGCAGGCAGCGAGTGATGCAACAATGACACCGGCGGATAAAGAAGCAATCCAGAAAGAAATCACTTCATTAAAAGATGAAGTTGACCGTATTTCTACAGATACAGAGTATAACAGCAAAACACTTTTAGATGGTTCATTAGATACCAGGGTTTACACCAAAAATGCAACAAGAGTGGACATTTCTGATCATGTGAAAGCAGGACAGTATCAGCTTTCCATTGATACTGCAGCTACACAGGCCGGACCGGTAACAGCAAATCAGAATTATAATTCCACAGCACCGGTCGGTGCGTCCGGAACAATGAGTATTAATGGTTCTAAAGTAGAGATAGAGGCAGCCGACACCTATGCGGAGGCTTTTGAGAAGATCAGAAATGCAGCAGAGACTGGTGAAACAACCGTTAAGATTGAAAAGAATGGAGCACTTTCATTTACCGCAGAACAGTACGGAATGTCAAGCATCTTAGAGATCGCATTNNTGATGATAAGCAGCTTGCTAATGCACTTGGATTTACAGCAGACGGAGGAAACAGTGTTGTAGAAGATCCAGAGAATAAAGGCAGCTATGTATACGGACAGATTCAGAATGGCAAAGTGATCGTACCTTCCGGTACAGATGCCGAAGTAACGCTCACAAAACCGAGTGATGGAACCGGATTTGGTGATACAGCTACGGTAAAAACAGATGGAAATAAGATTACGGTTACAGACAGAGCCGGATTTGAGATGTCATTTCTTGCTGATGCAGGTTATACGGGTAAGCTGGATTTTGATGTCACGGATATCGGAACGATGGCACTTCATATTGGAGCAAATGAGGATCAGGAAACAAGAGTGCGTATTCCGGAGGTTTCCTGCAAGAGCCTTTACATTGATGATGCAGACGTGACGACTGTAAATGGAGCAGGCAGAGGTATCACACAGTTTGACGATGCCATTTCAAAGGTCAGTGAAGTGCGTTCAAGACTTGGTGCATACCAGAATCGTCTTGAGAGTACGGTATCAAGCCTGGATACGTTTGAAGAAAATATGACAGGAGCCCAGTCACGACTGACAGATGCGGATATGGCATCGGAAATGACAGATTATACACATCAGAATGTATTAAATCAGGCAGCAATCTCTGTTTTGACACAGGCAAACGATCTGCCACAGCAGGTATTGCAGATTCTGCAGTAA

Пример полинуклеотидной последовательности, кодирующей Fla2 Roseburia intestinalis представлен в качестве SEQ ID NO: 7.

SEQ ID NO: 7 имеет следующую последовательность:

ATGGTAGTTAATCATAATATGGCATTGATCTGTGAGAGTAGACAGTTACGATGTAATGTGAAGAACATGGAGAAGTCTTCAAAAAAGCTGGCAACAGGTTATAAATTGCTTGGAGCAAATGATGATGCAGCAGGATTACAGATATCAGAAACCATGCGTCATCAGACCAGAGGTCTTAACAAAGCATCCAGAAATTCGCAAGATGGAATTAGTATGCTGCAGACAGCAGATGCAGCATTACAGGAGACACAGGAAGTGTTGGATCGAATGACGGATCTGACAACACAGGCAGCTAATGATATCAATACGGATGCGGATCGTCGTGCAATTCAGGATGAAATCGATCAGTTAAATCAGGAAGTGGATCGTATTGCATATACGACGAATTTTAATCAGCAGTATATATTAGCGGATGGAACTCCGCAGGCAAGACCAGGATACTATATGATACAGACAGGAAGTCTTGCGGGACAGGGAATAGAGATTAAGTTTGTTAATGCGAGCAAAGAGAGCTTGGGTGTGGACAAGGTTGATGTATCATCGCATGCAAAAGCGACAGAATCTATAGCAGTGGTACAGAATGCAATTGAAAAGGCAGCTTCGTTTAGAGATACATTTGGGGCACAACAGGAGCGGTTAGAACACGCATTGCGTGGAACGGATAATACATCAGAAAGTACACAGAGGGCAGAATCAAGTAGACGCGATACCAACATGAATATGGAGATGGTACAATATTCTACAAACCGTATTTTAGTACAGGCATCTCAGAGTATTTTAGCACAGTACAATGATGATGCAAAATATGTGTTGGAAATGTTAAAATAG

Пример полинуклеотидной последовательности, кодирующей Fla3 Roseburia intestinalis, представлен в качестве SEQ ID NO: 9.

SEQ ID NO: 9 имеет следующую последовательность:

ATGGTAGTACAGCACAATATGACCGCAATGAATGCGAACAGAATGTTAGGCGTTACAACAAGCGCACAGGCAAAATCTTCAGAGAAATTATCTTCTGGTTACAGAATCAACCGTGCAGGTGATGACGCTGCTGGTTTAACAATTTCTGAGAAGATGAGAAGCCAGATCCGTGGATTAAACAAAGCTTCTGACAACGCACAGGATGGTATTTCCTTAATCCAGGTTGCTGAGGGTGCATTATCTGAGACACATTCTATCTTACAGCGTATGAATGAGTTAGCTACTCAGGCTGCTAACGATACCAATACAACTGCTGATAGAGGAGCTATTCAGGATGAGATCAACCAGTTAACATCTGAGATTAACAGAATCTCTTCTACAACTCAGTTCAATACTCAGAACCTCATCGATGGTACATTCGCAAATAAAAACCTTCAGGTTGGTTCTATCTGTGGACAGAGAATTACTGTTTCTATCGACAGTATGTCTGCTGGTAGCTTAAATGTATCTGCTAACTTAGTAAAGGTTAACACTTTCAGTGCAGCAGGTGAAGCAATGTCCAATATTCAGGGTGCTATTTCTGCAATTTCTACACAGCGTTCTTACTTAGGAGCTCTTCAGAATCGTCTGGAGCATACAATCTCCAACTTGGACAACATTTCTGAGAATACTCAGTCTGCTGAATCTCGTATCCGTGATACAGATATGGCTGAAGAGATGGTTACTTACAGCAAGAACAATATTCTTGCTCAGGCAGGACAGTCTATGCTTGCTCAGGCTAACCAGTCTACTCAGGGTGTACTTTCTCTGTTACAGTAA

Пример полинуклеотидной последовательности, кодирующей Fla4 Roseburia intestinalis, представлен в качестве SEQ ID NO: 11.

SEQ ID NO: 11 имеет следующую последовательность:

ATGGCAATGGTAGTACAGCACAACATGTCCGCAATGAATGCGAACAGAAATTTAGGTGTTACAACAGGAATGCAGGCAAAATCATCAGAGAAGTTATCTTCCGGTTACAAGATCAACCGTGCAGCAGATGATGCAGCAGGACTTTCTATTTCTGAGAAGATGAGAAGCCAGATCCGCGGTTTAAATAAAGCATCTGACAATGCACAGGATGGTATCTCTTTAATCCAGACCGCTGAGGGAGCATTAAATGAGTCCCACTCTATTTTACAGAGAATGAGAGAGTTATCCGTACAGGCAGCCAACGGTACAGAGACAGATGACGACCGCGAGGCAGTACAGAACGAGGTTTCCCAGTTACAGGAAGAGCTGACAAGAATTTCTGAGACAACAGAGTTCAACACGATGAAGCTGCTGGATGGTTCTCAGAGTGGAAGTACATCTTCAACCGGGTCAGGTCCGAAGTTTGGTGTTGTAGATGCAACATTAGACGGTGCACTTGTAACATCTAACGTGAAAGGTATTAAAGTAGCAACAGCAGCTGCCACAACAACAAAGGCAGGTCAGGAGACTGCTATCTGGGCTGCTGATGGAAAGACATTAACTTTAAATCTTTCGAAAAATAAGGTATATACACAGGACGAAATTGATGACTTGATCGCAAATGCAAAACAGGAAGACAGTTCTGCAACGGGTGCACCGGCTGAAGTGAAAGTATCTTTAAAGAATGGTATTTTTAATGCAGATGCAGACACAACTGCCGGAACTGTAACAGCCGGTGGTGTGAAGGCAGTATCTGATGAAGGAACAGTAACTGGATTTGTTGGTGCAGATACAATTTCATTTACGGCAAATAAGTATGGAGCAGAGTTCAATGATACTGTATTTAAATTCAAATTTGATAAGGCAGCAGGCAAAGAAGAAGTAGAGACAAATACAGCAATTGAAATTGATGGAGCAAATGCGGTAACAGCAGGTGAATATACAATTCATCTTGCAGCAGGCAAAGAATATACGGCAGAAGATTTAGAAGATGTTCTTAAAACGGCAGGATTCGACTTTGATGTTAAATTAAGTGGAAATACACCAGATGAGCCAAATACTTTATTTGCAACCAGTGGCGCATCAACTGTGACTGATATTACAATGGGTGCTGGCACCGCCGGAGCTGGTCTTGGAAGTACAGATGCTATGTGGGGGCAAGCTGGTTATGACAGTTATCTTCTGGTGCTGGCATTACCTTGCAGATTGGTGCAAATGAAGGTCAGACCATGAGTTTCTCTATCGATGACATGAGTGCAAGAGCACTTGGCGTAGATGGCAACAAAGTTGATTTAAGCACACAGGCTGGCGCACAGAAAGCAACTGATACCATTGATGCAGCAATCAAGAAAGTATCTGCACAGCGTGGTAGAATGGGTGCGATCCAGAACCGTCTGGAGCACACCATCAGCAACCTTGATACAGCAGCAGAGAATACCCAGACTGCAGAGTCCCGTATCCGTGATACAGATATGGCAGAAGAGATGGTTGAGTACTCCAAGAACAACATTCTTGCACAGGCAGGTCAGTCTATGCTTGCACAGGCGAACCAGTCTACACAGGGTGTACTCTCCTTATTACAGTAA

В одном аспекте полинуклеотидная последовательность кодирует флагеллин Roseburia, выбранный из группы, состоящей из Fla1, Fla2, Fla3 и Fla4. В одном варианте осуществления полинуклеотидная последовательность кодирует флагеллин Roseburia, выбранный из группы, состоящей из Fla2, Fla1, Fla4 и их комбинации. В следующем варианте осуществления полинуклеотидная последовательность кодирует флагеллин Fla2 Roseburia.

В одном аспекте полинуклеотидная последовательность, кодирующая флагеллин Roseburia, выбрана из группы, состоящей из полинуклеотидной последовательности, кодирующей Fla1 Roseburia hominis, полинуклеотидной последовательности, кодирующей Fla2 Roseburia hominis, полинуклеотидной последовательности, кодирующей Fla1 Roseburia intestinalis, полинуклеотидной последовательности, кодирующей Fla2 Roseburia intestinalis, полинуклеотидной последовательности, кодирующей Fla3 Roseburia intestinalis, и полинуклеотидной последовательности, кодирующей Fla4 Roseburia intestinalis. В одном варианте осуществления полинуклеотидная последовательность, кодирующая флагеллин Roseburia, выбрана из группы, состоящей из полинуклеотидной последовательности, кодирующей Fla2 Roseburia hominis, полинуклеотидной последовательности, кодирующей Fla2 Roseburia intestinalis, полинуклеотидной последовательности, кодирующей Fla1 Roseburia intestinalis, полинуклеотидной последовательности, кодирующей Fla4 Roseburia intestinalis, и их комбинаций. В следующем варианте осуществления полинуклеотидная последовательность, кодирующая флагеллин Roseburia, выбрана из группы, состоящей из полинуклеотидной последовательности, кодирующей Roseburia hominis Fla2, полинуклеотидной последовательности, кодирующей Fla2 Roseburia intestinalis и их комбинаций. В другом варианте осуществления полинуклеотидная последовательность, кодирующая флагеллин Roseburia, представляет собой полинуклеотидную последовательность, кодирующую Fla2 Roseburia intestinalis.

Терапевтический эффект флагеллинов авторы настоящего изобретения оценивали с использованием функциональных анализов.

В одном варианте осуществления флагеллин Roseburia представляет собой укороченный флагеллин Roseburia. Например, укороченный флагеллин Roseburia содержит по меньшей мере 20, 30, 40, 50, 75, 100, 125, 150, 175 или 200 аминокислот полипептида, показанного в качестве SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12.

В одном варианте осуществления укороченный флагеллин Roseburia представляет собой укороченный флагеллин Roseburia hominis или укороченный флагеллин Roseburia intestinalis.

В одном варианте осуществления полинуклеотидная последовательность, кодирующая флагеллин Roseburia, кодирует укороченный FlaA1, Fla2, Fla3 или Fla4. Например, полинуклеотидная последовательность кодирует укороченный флагеллин Roseburia, содержащий по меньшей мере 20, 30, 40, 50, 75, 100, 125, 150, 175 или 200 аминокислота полипептида, показанного в качестве SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10 или SEQ ID NO: 12.

В одном варианте осуществления полинуклеотидная последовательность, кодирующая флагеллин Roseburia, кодирует укороченный FlaA1 или Fla3.

В одном варианте осуществления флагеллин Roseburia представляет собой слитый полипептид. Например, полипептид является слитым с глутатион-S-трансферазой (GST).

Таблица A
обобщение последовательностей флагеллина Roseburia, описанных в настоящем описании, и бактериальных штаммов, из которых они могут происходить
Бактерии или штамм Сокращенное обозначение ID нуклеотидной последовательности Нуклеотидная последовательность ID аминокислотной последовательности Аминокислотная последовательность
Roseburia hominis A2-183(fla 1) RhFlaA1, или RHFlaA1, или RhFla1, или RHFla1, или Rh1, или RH1 SEQ ID 1 ATGGTAGTACAGCACAATCTTACAGCAATGAACGCTAACAGACAGTTAGGTATCACAACAGGCGCACAGGCTAAGTCTTCTGAGAAGTTATCTTCTGGTTACAAGATCAACCGCGCAGCAGATGACGCAGCAGGTCTTACGATTTCCGAGAAGATGAGAAGCCAGGTTAGAGGCTTAAATAAAGCTTCTGACAACGCACAGGATGGTGTATCCCTTATTCAGGTAGCTGAGGGTGCATTAAGTGAGACACACTCCATCTTACAGCGTATGAATGAGTTAGCAACTCAGGCAGCAAACGATACCAATACAACCTCAGACAGAACTGCAGTTCAGCAGGAGATCAACCAGTTAGCATCTGAGATCACCAGAATCGCTTCTACAACTCAGTTCAACACAATGAACCTGATCGATGGTAACTTCACAAGTAAGAAGCTTCAGGTAGGTTCCCTTTGCGGACAGGCTATCACAATCGATATCTCTGATATGTCTGCTACAGGTCTTGGCGTTAGCGGATTAGTAGTATCTTCCTTCTCTGCAGCTGGTAAGGCAATGTCTGCAGCTCAGGATGCTATCAGCTACGTATCTTCTATGCGTTCTAAGCTGGGTGCATTACAGAACAGACTTGAGCACACAATCTCCCACCTGGACAACATTTCTGAGCACACATCTTCTGCAGAGTCTCGTATCCGTGATACAGATATGGCTGAAGAGATGGTTGAGTACAGCAAGAACAACATCCTTGCTCAGGCAGGACAGTCTATGCTTGCTCAGGCTAACCAGTCTACTCAGGGTGTATTATCCTTATTACAGTAA SEQ ID 2 MVVQHNLTAMNANRQLGITTGAQAKSSEKLSSGYKINRAADDAAGLTISEKMRSQVRGLNKASDNAQDGVSLIQVAEGALSETHSILQRMNELATQAANDTNTTSDRTAVQQEINQLASEITRIASTTQFNTMNLIDGNFTSKKLQVGSLCGQAITIDISDMSATGLGVSGLVVSSFSAAGKAMSAAQDAISYVSSMRSKLGALQNRLEHTISHLDNISEHTSSAESRIRDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ
Roseburia hominis A2-183 (fla 2) RhFlaA2, или RHFlaA2, или RhFla2, или RHFla2, или Rh2, или RH2 SEQ ID 3 ATGGTGGTTAATCATAATATGGCGGCAATCTGTGAGAGCAGGCAGCTGCGCTATAACGTGAAGAAGATGGAAAAATCTTCCAAAAAGCTTGCGACAGGGTACAAGCTGAACACAGCAAATGATGATGCGGCAGGCTTGCAGATATCAGAGACGATGCGGCATCATGTGAAAGGGCTGAACAAAGCCTCCCGGAATTCACAGGACGGCATCAGTATGCTGCAGACGGCGGATGCAGCGCTCCAAGAGACGCAGGATGTTCTCGATCGTATGGTGGAGCTGACGACGCAGGCAGCCAATGACATCAACACAGACTCGGATCGCAGGGCTATTCAGGATGAGTTGGATCAGCTGAACAAGGAAGTGGACCGCATCGCCTATACGACGCACTTCAATCAGCAGTATATGTTGGCGGAGGGAACGCCGCAGGCGGCACCGGGATATTACCGCATACAGTCCGGGGCACTGAACGGACAGGCGATAGATATCCATTTTGTAAATGCGAGCAAGGAGAGCCTTGGCACAGACAAAGTGAATGTATCTTCGCATGCGAAGGCGTCGGAATCCATCACGATGGTTCAGGACGCGATTGAACAGGCGGCGCTCTGGAGAGACGAGTTCGGCAGCCAGCAGGAGCGTCTGGAACATGCCGTGCGCAATACGGACAACACATCACAAAATACGCAGAGTGCGGAGTCAGGGATCAGAGACACCAACATGAATATGGAGATGGTATTATATTCGACCAACCGGATTCTGGTGCATGCATCCCAGAGTATTCTGGCACAGTATAATGATGATGCAAAATCAGTGCTTGAGATTTTGAAATAG SEQ ID 4 MVVNHNMAAICESRQLRYNVKKMEKSSKKLATGYKLNTANDDAAGLQISETMRHHVKGLNKASRNSQDGISMLQTADAALQETQDVLDRMVELTTQAANDINTDSDRRAIQDELDQLNKEVDRIAYTTHFNQQYMLAEGTPQAAPGYYRIQSGALNGQAIDIHFVNASKESLGTDKVNVSSHAKASESITMVQDAIEQAALWRDEFGSQQERLEHAVRNTDNTSQNTQSAESGIRDTNMNMEMVLYSTNRILVHASQSILAQYNDDAKSVLEILK
Roseburia intestinalis L1-82 (fla1) RiFlaA1, или RIFlaA1, RiFla1, или RIFla1, или Ri1, или RI1 SEQ ID 5 ATGCGTGGCGGAGACAATAGAAGGAGAAACAGAATGAGAATTAATTACAATGTGTCAGCAGCGATTGCGAATAAACATTTACTTGGAATTGAGGATAATTTAAGTGCATCGATGGAACGGCTTTCATCGGGACTTAAGATCAACCATTCCAAGGACAATCCGGCAGGAATGGCTATTTCCAACAAGATGAAAGCACAGATTGATGGTTTAAACCGGGCTTCCCAGAATGCATCGGATGGTATTTCTGTTATTCAGATCGCAGATGGTGCGCTGAGTGAAACGACCAGTATTTTACAGCGTATGAGAGAACTTTCCGTGCAGGCAGCGAGTGATGCAACAATGACACCGGCGGATAAAGAAGCAATCCAGAAAGAAATCACTTCATTAAAAGATGAAGTTGACCGTATTTCTACAGATACAGAGTATAACAGCAAAACACTTTTAGATGGTTCATTAGATACCAGGGTTTACACCAAAAATGCAACAAGAGTGGACATTTCTGATCATGTGAAAGCAGGACAGTATCAGCTTTCCATTGATACTGCAGCTACACAGGCCGGACCGGTAACAGCAAATCAGAATTATAATTCCACAGCACCGGTCGGTGCGTCCGGAACAATGAGTATTAATGGTTCTAAAGTAGAGATAGAGGCAGCCGACACCTATGCGGAGGCTTTTGAGAAGATCAGAAATGCAGCAGAGACTGGTGAAACAACCGTTAAGATTGAAAAGAATGGAGCACTTTCATTTACCGCAGAACAGTACGGAATGTCAAGCATCTTAGAGATCGCATTNNTGATGATAAGCAGCTTGCTAATGCACTTGGATTTACAGCAGACGGAGGAAACAGTGTTGTAGAAGATCCAGAGAATAAAGGCAGCTATGTATACGGACAGATTCAGAATGGCAAAGTGATCGTACCTTCCGGTACAGATGCCGAAGTAACGCTCACAAAACCGAGTGATGGAACCGGATTTGGTGATACAGCTACGGTAAAAACAGATGGAAATAAGATTACGGTTACAGACAGAGCCGGATTTGAGATGTCATTTCTTGCTGATGCAGGTTATACGGGTAAGCTGGATTTTGATGTCACGGATATCGGAACGATGGCACTTCATATTGGAGCAAATGAGGATCAGGAAACAAGAGTGCGTATTCCGGAGGTTTCCTGCAAGAGCCTTTACATTGATGATGCAGACGTGACGACTGTAAATGGAGCAGGCAGAGGTATCACACAGTTTGACGATGCCATTTCAAAGGTCAGTGAAGTGCGTTCAAGACTTGGTGCATACCAGAATCGTCTTGAGAGTACGGTATCAAGCCTGGATACGTTTGAAGAAAATATGACAGGAGCCCAGTCACGACTGACAGATGCGGATATGGCATCGGAAATGACAGATTATACACATCAGAATGTATTAAATCAGGCAGCAATCTCTGTTTTGACACAGGCAAACGATCTGCCACAGCAGGTATTGCAGATTCTGCAGTAA SEQ ID 6 MRINYNVSAAIANKHLLGIEDNLSASMERLSSGLKINHSKDNPAGMAISNKMKAQIDGLNRASQNASDGISVIQIADGALSETTSILQRMRELSVQAASDATMTPADKEAIQKEITSLKDEVDRISTDTEYNSKTLLDGSLDTRVYTKNATRVDISDHVKAGQYQLSIDTAATQAGPVTANQNYNSTAPVGASGTMSINGSKVEIEAADTYAEAFEKIRNAAETGETTVKIEKNGALSFTAEQYGMSSILEIAFDDKQLANALGFTADGGNSVVEDPENKGSYVYGQIQNGKVIVPSGTDAEVTLTKPSDGTGFGDTATVKTDGNKITVTDRAGFEMSFLADAGYTGKLDFDVTDIGTMALHIGANEDQETRVRIPEVSCKSLYIDDADVTTVNGAGRGITQFDDAISKVSEVRSRLGAYQNRLESTVSSLDTFEENMTGAQSRLTDADMASEMTDYTHQNVLNQAAISVLTQANDLPQ
Roseburia intestinalis L1-82 (fla2) RiFla2, или RIFla2, или Ri2, или RI2 SEQ ID 7 ATGGTAGTTAATCATAATATGGCATTGATCTGTGAGAGTAGACAGTTACGATGTAATGTGAAGAACATGGAGAAGTCTTCAAAAAAGCTGGCAACAGGTTATAAATTGCTTGGAGCAAATGATGATGCAGCAGGATTACAGATATCAGAAACCATGCGTCATCAGACCAGAGGTCTTAACAAAGCATCCAGAAATTCGCAAGATGGAATTAGTATGCTGCAGACAGCAGATGCAGCATTACAGGAGACACAGGAAGTGTTGGATCGAATGACGGATCTGACAACACAGGCAGCTAATGATATCAATACGGATGCGGATCGTCGTGCAATTCAGGATGAAATCGATCAGTTAAATCAGGAAGTGGATCGTATTGCATATACGACGAATTTTAATCAGCAGTATATATTAGCGGATGGAACTCCGCAGGCAAGACCAGGATACTATATGATACAGACAGGAAGTCTTGCGGGACAGGGAATAGAGATTAAGTTTGTTAATGCGAGCAAAGAGAGCTTGGGTGTGGACAAGGTTGATGTATCATCGCATGCAAAAGCGACAGAATCTATAGCAGTGGTACAGAATGCAATTGAAAAGGCAGCTTCGTTTAGAGATACATTTGGGGCACAACAGGAGCGGTTAGAACACGCATTGCGTGGAACGGATAATACATCAGAAAGTACACAGAGGGCAGAATCAAGTAGACGCGATACCAACATGAATATGGAGATGGTACAATATTCTACAAACCGTATTTTAGTACAGGCATCTCAGAGTATTTTAGCACAGTACAATGATGATGCAAAATATGTGTTGGAAATGTTAAAATAG SEQ ID 8 MVVNHNMALICESRQLRCNVKNMEKSSKKLATGYKLLGANDDAAGLQISETMRHQTRGLNKASRNSQDGISMLQTADAALQETQEVLDRMTDLTTQAANDINTDADRRAIQDEIDQLNQEVDRIAYTTNFNQQYILADGTPQARPGYYMIQTGSLAGQGIEIKFVNASKESLGVDKVDVSSHAKATESIAVVQNAIEKAASFRDTFGAQQERLEHALRGTDNTSESTQRAESSRRDTNMNMEMVQYSTNRILVQASQSILAQYNDDAKYVLEMLKQVLQILQ
Roseburia intestinalis L1-82 (fla3) RiFla3, или RIFla3, или Ri3, или RI3 SEQ ID 9 ATGGTAGTACAGCACAATATGACCGCAATGAATGCGAACAGAATGTTAGGCGTTACAACAAGCGCACAGGCAAAATCTTCAGAGAAATTATCTTCTGGTTACAGAATCAACCGTGCAGGTGATGACGCTGCTGGTTTAACAATTTCTGAGAAGATGAGAAGCCAGATCCGTGGATTAAACAAAGCTTCTGACAACGCACAGGATGGTATTTCCTTAATCCAGGTTGCTGAGGGTGCATTATCTGAGACACATTCTATCTTACAGCGTATGAATGAGTTAGCTACTCAGGCTGCTAACGATACCAATACAACTGCTGATAGAGGAGCTATTCAGGATGAGATCAACCAGTTAACATCTGAGATTAACAGAATCTCTTCTACAACTCAGTTCAATACTCAGAACCTCATCGATGGTACATTCGCAAATAAAAACCTTCAGGTTGGTTCTATCTGTGGACAGAGAATTACTGTTTCTATCGACAGTATGTCTGCTGGTAGCTTAAATGTATCTGCTAACTTAGTAAAGGTTAACACTTTCAGTGCAGCAGGTGAAGCAATGTCCAATATTCAGGGTGCTATTTCTGCAATTTCTACACAGCGTTCTTACTTAGGAGCTCTTCAGAATCGTCTGGAGCATACAATCTCCAACTTGGACAACATTTCTGAGAATACTCAGTCTGCTGAATCTCGTATCCGTGATACAGATATGGCTGAAGAGATGGTTACTTACAGCAAGAACAATATTCTTGCTCAGGCAGGACAGTCTATGCTTGCTCAGGCTAACCAGTCTACTCAGGGTGTACTTTCTCTGTTACAGTAA SEQ ID 10 MVVQHNMTAMNANRMLGVTTSAQAKSSEKLSSGYRINRAGDDAAGLTISEKMRSQIRGLNKASDNAQDGISLIQVAEGALSETHSILQRMNELATQAANDTNTTADRGAIQDEINQLTSEINRISSTTQFNTQNLIDGTFANKNLQVGSICGQRITVSIDSMSAGSLNVSANLVKVNTFSAAGEAMSNIQGAISAISTQRSYLGALQNRLEHTISNLDNISENTQSAESRIRDTDMAEEMVTYSKNNILAQAGQSMLAQANQSTQGVLSLLQ
Roseburia intestinalis L1-82 (fla4) RiFla4, или RIFla4, или Ri4, или RI4 SEQ ID 11 ATGGCAATGGTAGTACAGCACAACATGTCCGCAATGAATGCGAACAGAAATTTAGGTGTTACAACAGGAATGCAGGCAAAATCATCAGAGAAGTTATCTTCCGGTTACAAGATCAACCGTGCAGCAGATGATGCAGCAGGACTTTCTATTTCTGAGAAGATGAGAAGCCAGATCCGCGGTTTAAATAAAGCATCTGACAATGCACAGGATGGTATCTCTTTAATCCAGACCGCTGAGGGAGCATTAAATGAGTCCCACTCTATTTTACAGAGAATGAGAGAGTTATCCGTACAGGCAGCCAACGGTACAGAGACAGATGACGACCGCGAGGCAGTACAGAACGAGGTTTCCCAGTTACAGGAAGAGCTGACAAGAATTTCTGAGACAACAGAGTTCAACACGATGAAGCTGCTGGATGGTTCTCAGAGTGGAAGTACATCTTCAACCGGGTCAGGTCCGAAGTTTGGTGTTGTAGATGCAACATTAGACGGTGCACTTGTAACATCTAACGTGAAAGGTATTAAAGTAGCAACAGCAGCTGCCACAACAACAAAGGCAGGTCAGGAGACTGCTATCTGGGCTGCTGATGGAAAGACATTAACTTTAAATCTTTCGAAAAATAAGGTATATACACAGGACGAAATTGATGACTTGATCGCAAATGCAAAACAGGAAGACAGTTCTGCAACGGGTGCACCGGCTGAAGTGAAAGTATCTTTAAAGAATGGTATTTTTAATGCAGATGCAGACACAACTGCCGGAACTGTAACAGCCGGTGGTGTGAAGGCAGTATCTGATGAAGGAACAGTAACTGGATTTGTTGGTGCAGATACAATTTCATTTACGGCAAATAAGTATGGAGCAGAGTTCAATGATACTGTATTTAAATTCAAATTTGATAAGGCAGCAGGCAAAGAAGAAGTAGAGACAAATACAGCAATTGAAATTGATGGAGCAAATGCGGTAACAGCAGGTGAATATACAATTCATCTTGCAGCAGGCAAAGAATATACGGCAGAAGATTTAGAAGATGTTCTTAAAACGGCAGGATTCGACTTTGATGTTAAATTAAGTGGAAATACACCAGATGAGCCAAATACTTTATTTGCAACCAGTGGCGCATCAACTGTGACTGATATTACAATGGGTGCTGGCACCGCCGGAGCTGGTCTTGGAAGTACAGATGCTATGTGGGGGCAAGCTGGTTATGACAGTTATCTTCTGGTGCTGGCATTACCTTGCAGATTGGTGCAAATGAAGGTCAGACCATGAGTTTCTCTATCGATGACATGAGTGCAAGAGCACTTGGCGTAGATGGCAACAAAGTTGATTTAAGCACACAGGCTGGCGCACAGAAAGCAACTGATACCATTGATGCAGCAATCAAGAAAGTATCTGCACAGCGTGGTAGAATGGGTGCGATCCAGAACCGTCTGGAGCACACCATCAGCAACCTTGATACAGCAGCAGAGAATACCCAGACTGCAGAGTCCCGTATCCGTGATACAGATATGGCAGAAGAGATGGTTGAGTACTCCAAGAACAACATTCTTGCACAGGCAGGTCAGTCTATGCTTGCACAGGCGAACCAGTCTACACAGGGTGTACTCTCCTTATTACAGTAA SEQ ID 12 MAMVVQHNMSAMNANRNLGVTTGMQAKSSEKLSSGYKINRAADDAAGLSISEKMRSQIRGLNKASDNAQDGISLIQTAEGALNESHSILQRMRELSVQAANGTETDDDREAVQNEVSQLQEELTRISETTEFNTMKLLDGSQSGSTSSTGSGPKFGVVDATLDGALVTSNVKGIKVATAAATTTKAGQETAIWAADGKTLTLNLSKNKVYTQDEIDDLIANAKQEDSSATGAPAEVKVSLKNGIFNADADTTAGTVTAGGVKAVSDEGTVTGFVGADTISFTANKYGAEFNDTVFKFKFDKAAGKEEVETNTAIEIDGANAVTAGEYTIHLAAGKEYTAEDLEDVLKTAGFDFDVKLSGNTPDEPNTLFATSGASTVTDITMGAGTAGAGLGSTDAMWGQAGYDSVSSGAGITLQIGANEGQTMSFSIDDMSARALGVDGNKVDLSTQAGAQKATDTIDAAIKKVSAQRGRMGAIQNRLEHTISNLDTAAENTQTAESRIRDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ

Таблица B
Обобщение номеров доступа для флагеллинов Roseburia, описанных в настоящем описании
Бактерии и штамм Сокращенное обозначение Номер доступа генома или гена Номер доступа белка
(GenBank)
Номер доступа белка (Эталонная последовательность NCBI)
Roseburia hominis A2-183(fla 1) RhFlaA1, или RHFlaA1, или RhFla1, или RHFla1, или Rh1, или RH1 DQ789140.1 ABI48297.1 ABI48297.1
Roseburia hominis A2-183 (fla 2) RhFlaA2, или RHFlaA2, или RhFla2, или RHFla2, или Rh2, или RH2 DQ789141.1 ABI48298.1 ABI48298.1
Roseburia intestinalis L1-82 (fla1) RiFlaA1, или RIFlaA1 RiFla1, или RIFla1, или Ri1, или RI1 ABYJ02000009.1 EEV02820 WP_006855378

Roseburia intestinalis L1-82 (fla2) RiFla2, или RIFla2, или Ri2, или RI2 ABYJ02000032.1 EEV02466 WP_006855745
Roseburia intestinalis L1-82 (fla3) RiFla3, или RIFla3, или Ri3, или RI3 ABYJ02000104.1 EEV00779 WP_006857364
Roseburia intestinalis L1-82 (fla4) RiFla4, или RIFla4, или Ri4, или RI4 ABYJ02000202.1 EEU99488 WP_006858703

Модулирование/регуляция

Термины "модулирование" и "регуляция" можно использовать в настоящем описании взаимозаменяемо.

В одном варианте осуществления термин "модулирование" относится к увеличению, и/или индукции, и/или стимуляции, и/или активации. В альтернативном варианте осуществления термин "модулирование" относится к снижению, и/или уменьшению, и/или ингибированию.

В одном варианте осуществления термин "регуляция" относится к активации. В альтернативном варианте осуществления термин "регуляция" относится к подавлению.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), снижают воспаление в ткани или органе.

Например, уменьшается воспаление пищеварительного тракта или его части (такого как кишечник).

Термин "воспаление", как используют в рамках изобретения, относится к одному или нескольким из следующих: покраснение, опухание, боль, слабость, жар и нарушенная функция ткани или органа вследствие воспалительного процесса, запускаемого чрезмерной реакцией иммунной системы.

Снижение воспаления у индивидуума можно определять путем определения уровней провоспалительных цитокинов и хемокинов в образцах ткани, сыворотки и/или фекалий у индивидуума до и после введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis) индивидууму. Например, можно проводить уровни одного или нескольких из следующих: IL-1, IL-4, IL5, IL6, IL-8, IL-12, IL-13, IL-17, IL-21, IL-22, IL23, TNFα, IFNγ, CXCL1, CXCL10, CCL2, CCL20, сывороточный и фекальный кальпротектин, кальций-связывающие белки SA1009/SA1008, и интерфероны типа 1, маркеры CD, такие как CD163, CD14, воспалительные факторы транскрипции, такие как NF-kB, STAT и MAP-киназы, c-реактивный белок (CRP), скорость оседания эритроцитов (ESR), белки системы комплемента, сывороточный альбумин, гистологическая оценка тканей-мишеней и органов-мишеней, индексы активности заболевания. Кроме того, в исследованиях у человека можно проводить исследования с использованием опросников качества жизни (QoL) до и после введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления количество ткани или органа, которое является воспаленным у индивидуума, составляет по меньшей мере 10%, 20%, 30%, 40% или 50% ниже по сравнению с количеством ткани или органа, которое является воспаленным у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащего указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидную последовательность, кодирующую флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), снижают воспаление эпителиальных клеток в ткани или органе.

Например, эпителиальные клетки представляют собой эпителиальные клетки пищеварительного тракта или его части (такой как кишечник).

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), увеличивает продукцию T-клеток у индивидуума.

В одном варианте осуществления T-клетки представляют собой регуляторные T-клетки (также обозначаемые как Tregs), такие как регуляторные T-клетки, способные экспрессировать TLR5 (Toll-подобный рецептор 5).

Без связи с теорией, увеличение числа Treg будет оказывать противодействие другим эффекторым T-клеткам (также обозначаемым как Teff), таким как Th1, Th17 и Th2, которые запускают воспаление, аутоиммунитет и аллергические/атопические состояния. Таким образом, это свойство флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), можно использовать для борьбы с многими заболеваниями, при которых утрачивается баланс Teff/Treg, например болезнью Крона и язвенным колитом.

В одном варианте осуществления возрастает продуцирование T-клеток у индивидуума, так что существует по меньшей мере на 10%, 20%, 30%, 40% или 50% более T-клеток или более чем на 100% больше T-клеток по сравнению с числом T-клеток у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "иммунная система", как используют в рамках изобретения, может относиться к адаптивной иммунной системы и/или врожденной иммунной системе.

В одном аспекте изобретение относится к флагеллину Roseburia и/или к полипептиду Fla (такому как FlaA1 или FlaA2), и/или к полинуклеотидной последовательности, кодирующей флагеллин Roseburia и/или Fla (такой как FlaA1 или FlaA2) полипептид, и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таким как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции адаптивной иммунной системы индивидуума.

Как используют в рамках изобретения, термин "адаптивная иммунная система", также известный как "специфическая иммунная система" относится к высокоспециализированным системным клеткам и процессам, которые устраняют или предупреждают патогенный рост. Адаптивный иммунный ответ обеспечивает иммунной системе позвоночных способность распознавать и запоминать конкретные патогены (для формирования иммунитета), и инициировать более сильные атаки, каждый раз когда патоген встречается.

Как используют в рамках изобретения, термин "регуляция адаптивной иммунной системы" означает индукцию активности адаптивной иммунной системы, и/или стимуляция иммунных гомеостатических механизмов посредством увеличения уровня активности относительно исходного уровня активности. Предпочтительно, адаптивная иммунная система модулируется в сторону иммунной регуляции (но не иммунной активации, таким образом, снижая воспаление).

Дефекты и нарушения, ассоциированные с адаптивной иммунной системой, в частности, связанные с функцией T-клеток, ассоциированы с многими воспалительными и аутоиммунными заболеваниями. T-клеточные ответы, ассоциированные с Th1, Th2 и Th17, ассоциированы с атопическими, воспалительными и аутоиммунными заболеваниями. Способы терапии, которые улучшают или увеличивают популяции регуляторных T-клеток (Treg), являются важными для контроля заболеваний, запускаемых чрезмерными ответами клеток Th1, Th2 и Th17.

Другой аспект изобретения относится к флагеллину Roseburia и/или полипептиду Fla (такому как FlaA1 или FlaA2) полипептид, и/или к полинуклеотидной последовательности, кодирующей флагеллин Roseburia и/или Fla (такой как FlaA1 или FlaA2), и/или к вектору, содержащему указанную полинуклеотидную последовательность, и/или к клетке-хозяину, содержащей указанный вектор, и/или к клетке-хозяину, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для регуляции врожденной иммунной системы индивидуума.

Как используют в рамках изобретения, термин "врожденная иммунная система", также известный как неспецифическая иммунная система, включает клетки и механизмы, которые обеспечивают у хозяина немедленную защиту от инфекции другими организмами неспецифическим образом. Это означает, что клетки врожденной иммунной системы распознают и отвечают на патогены универсальным образом, но, в отличие от адаптивной иммунной системы, они не сообщают длительного или защитного иммунитета хозяину.

Как используют в рамках изобретения, термин "регуляция врожденной иммунной системы" означает индукцию активности врожденной иммунной системы и/или повышение уровня активности относительно исходного уровня активности, так что она индуцирует иммунный гомеостаз.

Утрата или нарушение регуляции врожденной иммунной функции, либо вследствие утраты эпителиального барьера, либо вследствие пептидов врожденного иммунитета, таких как дефензины, хемокины и цитокины, либо вследствие дефектной передачи сигнала TLR, ассоциированы с увеличенным риском воспалительных заболеваний, в нескольких органах организма, включая кишечник. Такие заболевания включают воспалительное заболевание кишечника.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2) и/или полинуклеотидная последовательность, кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), восстанавливают иммунологическую толерантность.

Как используют в рамках изобретения, термин "иммунологическая толерантность" относится к процессу, посредством которого иммунная система не атакует антиген, такой как собственный антиген.

Как используют в рамках изобретения термин "восстановление иммунологической толерантности" относится к восстановлению иммунологической толерантности к одному или нескольким антигенам (таким как собственный антиген) у индивидуума, так что уровень иммунологической толерантности к антигену является более высоким по сравнению с уровнями у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis) индивидууму.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), активирует дендритные клетки и/или эпителиальные клетки.

Как используют в рамках изобретения термин "активирует дендритные клетки" относится к активации одного или нескольких клеточных маркеров (таких как клеточные маркеры I-A/I-E, CD80 и CD86 и CD40) и/или увеличению продукции одного или нескольких цитокинов (таких как IL-10 и TGFβ) клетками (такими как дендритные клетки) у индивидуума по сравнению с уровнями у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "I-A/I-E", как используют в рамках изобретения, относится к клеточным маркерам MHC класса II.

CD40 имеет неотъемлемую роль в иммунитете и он является одной из наиболее охарактеризованных костимулирующих молекул. Этот рецептор, являющийся представителем семейства рецепторов фактора некроза опухоли, экспрессируется профессиональными антигенпредставляющими клетками, такими как дендритные клетки. CD40 связывает его лиганд CD40L, который временно экспрессируется на T-клетках и других неиммунных клетках в воспалительных условиях.

CD40L является примером T-клеточного маркера. Следующими примерами T-клеточных маркеров являются CD3, CD4, CD25, FoxP3, CTLA-4, Ly6g и CD11b.

CD80 и CD86 экспрессируются на антигенпредставляющих клетках (таких как дендритные клетки) и они требуются для развития и костимуляции T-клеточных ответов. Молекулы CD28 и CTLA-4 на T клетках служат в качестве рецепторов для костимулирующих антигенов CD80 и CD86.

Примерами маркеров регуляторных T-клеток толстого кишечника являются CD3, CD4, CD25, FoxP3, CTLA-4, Ly6g и CD11b.

Без связи с теорией, истощение Ly6g (например Ly6g6c и ly6g6e) повышает риск инфекции, как в кишечнике, так и в дыхательных путях, и оно ассоциировано с заболеваниями, такими как нейтропения. Таким образом, в одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), предназначены для применения для лечения нейтропении.

Другой аспект изобретения относится к флагеллину Roseburia и/или полипептиду Fla (таком как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для применения для поддержания иммунного гомеостаза у индивидуума. Как используют в рамках изобретения "поддержание иммунного гомеостаза" относится к саморегуляции иммунной системы организма для поддержания пероральной толерантности или иммунной стабильности в ответ на изменяющиеся условия. Пероральная толерантность относится к нормальным иммунным ответам на пищу и комменсальные бактерии в здоровом кишечнике. Она утрачивается при глютеновой болезни и воспалительных заболеваниях кишечника, таких как болезнь Крона и язвенный колит. Таким образом, в одном аспекте флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), предназначены для применения для лечения глютеновой болезни и воспалительных заболеваний кишечника, таких как болезнь Крона и язвенный колит.

В одном варианте осуществления количество клеточного маркера на клетке(ах) индивидуума повышается так, что на клетке(ах) присутствует по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера на клетке(ах), или более чем на 100% больше клеточного маркера на клетке(ах), по сравнению с количеством клеточного маркера на клетке(ах) индивидуума до введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно, число клеток у индивидуума, которые имеют клеточный маркер, увеличивается, как например, по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточный маркер, или более чем на 100% больше клеток, которые имеют клеточный маркер, по сравнению с числом клеток с клеточным маркером у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном аспекте клетки представляют собой T-клетки.

В другом аспекте клетки представляют собой клетки пищеварительного тракта (такие как клетки кишечника).

В следующем аспекте клетки представляют собой регуляторные T-клетки толстого кишечника и/или тонкого кишечника и они могут быть либо CD4-положительными, либо CD8-положительными.

В одном аспекте клеточный маркер представляет собой T-клеточный маркер. В другом аспекте клеточный маркер представляет собой T-клеточный маркер толстого кишечника.

Примерами клеточных маркеров являются маркеры, которые представляют собой маркеры типа I-A/I-E. CD40 является другим примером клеточного маркера, также встречающегося на дендритных клетках.

В одном варианте осуществления уровень цитокина у индивидуума возрастает так, что уровень цитокина является по меньшей мере на 10%, 20%, 30%, 40% или 50% более высоким, или более чем на 100% более высоким по сравнению с уровнем цитокина у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Примеры дендритных клеток включают дендритные клетки костного мозга и дендритные клетки слизистой оболочки кишечника.

Как используют в рамках изобретения термин "активирует эпителиальные клетки" относится к увеличению экспрессии экспрессии одного или нескольких провоспалительных генов эпителиальными клетками у индивидуума по сравнению с уровнями экспрессии у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "провоспалительный ген", как используют в рамках изобретения, относится к гену, который при экспрессии усиливает воспаление. Примеры провоспалительных генов включают гены, кодирующие, но не ограничивающиеся ими IL1-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21, IL22, IL23, IL27, IFNγ, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13 и TNF-α.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), активирует продукцию цитокина.

Термин "активирует продукцию цитокина", как используют в рамках изобретения, относится к увеличению уровня цитокина у индивидуума по сравнению с уровнем цитокина у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления уровень цитокина возрастает так, что уровень является по меньшей мере на 10%, 20%, 30%, 40% или 50% более высоким, или более чем на 100% более высоким, по сравнению с уровнем у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В другом варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), активирует продукцию IL-10 и/или TGFβ.

Термин "активирует продукцию IL-10", как используют в рамках изобретения, относится к увеличению уровня IL-10 у индивидуума по сравнению с уровнем IL-10 у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления уровень IL-10 возрастает так, что уровень является по меньшей мере на 10%, 20%, 30%, 40% или 50% более высоким, или более чем на 100% более высоким по сравнению с уровнем у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В некоторых аспектах IL-10 продуцируется дендритными клетками, такими как происходящие из костного мозга дендритные клетки и дендритные клетки слизистой оболочки кишечника, в частности, подгруппы CD103+.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla, и/или полинуклеотидная последовательность, кодирующая флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), активируют продукцию маркеров клеточной поверхности, вовлеченных в иммунные ответы и распознавание антигена в клетке или клетках индивидуума.

Примеры маркеров клеточной поверхности, вовлеченных в иммунные ответы и распознавание антигенов, включают CD40, I-A/I-E, CD317/BST-2, CD103, CD80, CD86, CD83 и/или Siglec-H и/или их видовые эквиваленты.

Маркеры клеточной поверхности (например CD317/BST-2) могут быть названы различными названиями в различных видах или маркер клеточной поверхности еще может не быть идентифицирован на клетках конкретного вида. Термин "видовой эквивалент", как используют в рамках изобретения, охватывает эти маркеры клеточной поверхности.

Термин "активирует продукцию CD40", как используют в рамках изобретения, относится к увеличению уровня CD40 у индивидуума по сравнению с уровнем CD40 у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, число клеток, содержащих клеточный маркер CD40, увеличивается и/или увеличивается количество маркера CD40 на клетках.

В одном варианте осуществления количество клеточного маркера CD40 на клетке(ах) индивидуума увеличивается так, что на клетке(ах) становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера, или на клетке(ах) становится более чем на 100% больше клеточного маркера на клетке(ах), по сравнению с количеством клеточного маркера на клетке(ах) индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно число клеток у индивидуума, которые имеют клеточный маркер CD40, возрастает, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточный маркер, или более чем на 100% больше клеток, которые имеют клеточный маркер, по сравнению с количеством клеток с клеточным маркером у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "активирует продукцию I-A/I-E", как используют в рамках изобретения, относится к увеличению уровня I-A/I-E у индивидуума по сравнению с уровнем I-A/I-E у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, число клеток, содержащих один или несколько клеточных маркеров I-A/I-E, возрастает и/или количество клеточных маркеров I-A/I-E на клетке возрастает.

В одном варианте осуществления количество клеточного маркера I-A/I-E на клетке(ах) индивидуума увеличивается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера I-A/I-E на клетке(ах), или более чем на 100% больше клеточного маркера I-A/I-E cell на клетке(ах), по сравнению с количеством клеточного маркера I-A/I-E cell на клетке(ах) индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно возрастает число клеток у индивидуума, которые имеют клеточный маркер I-A/I-E, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточные маркеры I-A/I-E, или более чем на 100% больше клеток, которые имеют клеточный маркер I-A/I-E, по сравнению с числом клеток с клеточным маркером I-A/I-E у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "активирует продукцию CD317/BST-2", как используют в рамках изобретения, относится к увеличению уровня CD317/BST-2 у индивидуума по сравнению с уровнем CD317/BST-2 у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептида Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, число клеток, содержащих один или несколько клеточных маркеров CD317/BST-2, возрастает и/или возрастает количество клеточных маркеров CD317/BST-2 на клетке.

В одном варианте осуществления количества клеточных маркеров CD317/BST-2 на клетке(ах) индивидуума увеличиваются так, что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточных маркеров CD317/BST-2 на клетке(ах), или более чем на 100% больше клеточных маркеров CD317/BST-2 на клетке(ах), по сравнению с количеством клеточных маркеров CD317/BST-2 на клетке(ах) индивидуума до введения флагеллина Roseburia, и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно число клеток у индивидуума, которые имеют клеточные маркеры CD317/BST-2 увеличивается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточные маркеры CD317/BST-2, или более чем на 100% больше клеток, которые имеют клеточные маркеры CD317/BST-2, по сравнению с количеством клеток с клеточными маркерами CD317/BST-2 у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "активирует продукцию CD103", как используют в рамках изобретения относится, к увеличению уровня CD103 у индивидуума по сравнению с уровнем CD103 у индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептида Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, количество клеток, содержащих один или несколько клеточных маркеров CD103, возрастает и/или возрастает количество клеточного маркера CD103 на клетке.

В одном варианте осуществления количество клеточного маркера CD103 на клетке(ах) индивидуума повышается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера CD103 на клетке(ах), или более чем на 100% больше клеточного маркера CD103 на клетке(ах), по сравнению с количеством клеточного маркера CD103 на клетке(ах) индивидуума до выведения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно число клеток у индивидуума, который имеет клеточный маркер CD103, увеличивается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточный маркер CD103, или более чем на 100% больше клеток, которые имеют клеточный маркер CD103, по сравнению с количеством клеток с клеточным маркером CD103 у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такиъ как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "активирует продукцию CD80", как используют в рамках изобретения, относится к увеличению уровня CD80 у индивидуума по сравнению с уровнем CD80 у индивидуума до введения флагеллина Roseburia, и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептида Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, количество клеток, содержащих один или несколько клеточных маркеров CD80, увеличивается и/или количество клеточных маркеров CD80 на клетке увеличивается.

В одном варианте осуществления количество клеточного маркера CD80 на клетке клетке(ах) индивидуума повышается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера CD80 на клетке(ах), или более чем на 100% больше клеточных маркеров CD80 на клетке(ах), по сравнению с количеством клеточных маркеров CD80 на клетке(ах) индивидуума до введения флагеллина Roseburia, и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно количество клеток у индивидуума, которые имеют клеточный маркер CD80, увеличивается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточный маркер CD80, или более чем на 100% больше клеток, которые имеют клеточный маркер CD80, по сравнению с количеством клеток с клеточным маркером CD80 у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "активирует продукцию CD86", как используют в рамках изобретения, относится к увеличению уровня CD86 у индивидуума по сравнению с уровнем CD86 у индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, число клеток, содержащих один или несколько клеточных маркеров CD86, увеличивается и/или увеличивается количество клеточных маркеров CD86 на клетке.

В одном варианте осуществления количество клеточного маркера CD86 на клетке(ах) индивидуума повышается так, что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера CD86 на клетке(ах), или более чем на 100% больше клеточного маркера CD86 на клетке(ах), по сравнению с количеством клеточного маркера CD86 на клетке(ах) индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно количество клеток у индивидуума, которые имеют клеточный маркер CD86, увеличивается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточные маркеры CD86, или более чем на 100% больше клеток, которые имеют клеточный маркер CD86, по сравнению с количеством клеток с клеточным маркером CD86 у индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "активирует продукцию CD83", как используют в рамках изобретения, относится к увеличению уровня CD83 у индивидуума по сравнению с уровнем CD83 у индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, число клеток, содержащих один или несколько клеточных маркеров CD83, увеличивается и/или увеличивается количество клеточных маркеров CD83 на клетке.

В одном варианте осуществления количество клеточного маркера CD83 на клетке(ах) индивидуума повышается так, что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера CD83 на клетке(ах), или более чем на 100% больше клеточного маркера CD83 на клетке(ах), по сравнению с количеством клеточного маркера CD86 на клетке(ах) индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно количество клеток у индивидуума, которые имеют клеточный маркер CD83, увеличивается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточные маркеры CD83, или более чем на 100% больше клеток, которые имеют клеточный маркер CD86, по сравнению с количеством клеток с клеточным маркером CD83 у индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "активирует продукцию Siglec-H", как используют в рамках изобретения, относится к увеличению уровня Siglec-H у индивидуума по сравнению с уровнем Siglec-H у индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Например, число клеток, содержащих один или несколько клеточных маркеров Siglec-H, увеличивается и/или увеличивается количество клеточных маркеров Siglec-H на клетке.

В одном варианте осуществления количество клеточного маркера Siglec-H на клетке(ах) индивидуума повышается так, что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеточного маркера Siglec-H на клетке(ах), или более чем на 100% больше клеточного маркера Siglec-H на клетке(ах), по сравнению с количеством клеточного маркера Siglec-H на клетке(ах) индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно количество клеток у индивидуума, которые имеют клеточный маркер Siglec-H, увеличивается, так что становится по меньшей мере на 10%, 20%, 30%, 40% или 50% больше клеток, которые имеют клеточные маркеры Siglec-H, или более чем на 100% больше клеток, которые имеют клеточный маркер Siglec-H, по сравнению с количеством клеток с клеточным маркером Siglec-H у индивидуума до введения флагеллина Roseburia и/или полипептида Fla, и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный Fla, и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В некоторых аспектах продукция CD40 I-A/I-E, CD317/BST-2, CD80, CD86, CD83 и/или Siglec-H осуществляется дендритными клетками (такими как толерогенные CD103+ дендритные клетки, увеличенные в количестве с использованием FLT3L.).

В одном варианте осуществления экспрессия одного или нескольких генов IFN типа I в клетке или клетках индивидуума снижается.

В одном варианте осуществления уровень экспрессии одного или нескольких генов IFN типа I снижается так, что уровень становится по меньшей мере на 10%, 20%, 30%, 40% или 50% более низким по сравнению с уровнем у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Примеры генов IFN типа I включают, но не ограничиваясь ими, IFN-β1, IFN-β3, Ifi202b, Ifi203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 и Irf4.

В одном варианте осуществления экспрессия одного или нескольких провоспалительных генов в клетке или клетках индивидуума снижается.

В одном варианте осуществления уровень экспрессии одного или нескольких провоспалительных генов снижается так, что уровень становится по меньшей мере на 10%, 20%, 30%, 40% или 50% более низким по сравнению с уровнем у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "микробиота кишечника", как используют в рамках изобретения, относится к микроорганизмам, которые живут в пищеварительном тракте животных-хозяев. Эти микроорганизм выполняют широкое множество различных метаболических, структурных, защитных и других полезных функций.

Как используют в рамках изобретения, термин "улучшение микробиоты кишечника" относится к увеличению количества и/или типа микроорганизмов, присутствующих в кишечнике индивидуума (например хозяина), и/или к увеличению активности указанных микроорганизмов с точки зрения их метаболических, структурных, защитных и других полезных функций. Например, количества (т.е. уровни) бактерий Clostridium кластера XIVa увеличивается и количества E. coli снижается; такое улучшение микробиоты кишечника может происходить у индивидуумов с воспалительным заболеванием кишечника (IBD) после введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления количество микроорганизмов, присутствующих в кишечнике индивидуума (например, хозяина), увеличивается, так что количество микроорганизмов становится по меньшей мере на 10%, 20%, 30%, 40% или 50% более высоким, или более чем на 100% более высоким, чем уровень у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно количество типов микроорганизмов, присутствующих в кишечнике индивидуума (например, хозяина), увеличивается, так что становится по меньшей мере на 5%, 10%, или 15% больше типов микроорганизмов по сравнению с количеством типов у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Как используют в рамках изобретения, термин "регуляция аппетита" относится к способности модулировать (т.е. увеличивать или снижать) желание у индивидуума употреблять пищу.

В одном варианте осуществления аппетит у индивидуума стимулируется (т.е. повышается).

Без связи с теорией, флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), подавляют стимулирующий эффект на аппетит индивидуума путем подавления экспрессии генов, ассоциированных с подавлением аппетита (таких как гены, кодирующие гормоны насыщения). Примерами генов, ассоциированных с регуляцией аппетита, являются Agt, Cartpt, Cck, Cxcl12 и Gcg и подавление одного или нескольких из этих генов ассоциировано с подавлением аппетита.

Примерами гормонов насыщения являются Cck и Gcg.

В одном аспекте флагеллин Roseburia, и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), стимулируют аппетит у индивидуума, так что индивидуум употребляет по меньшей мере на 5%, 10%, или 15% больше пищи, чем индивидуум до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму. Дополнительно или альтернативно флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), стимулируют аппетит у индивидуума, так что через 1 месяц после введения масса индивидуума становится по меньшей мере на 2%, 5% или 10% более высокой, чем у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), снижает уровень холицистокинина (Cck) и/или глюкагона (Gcg) в крови индивидуума.

В одном аспекте флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), снижает уровень холицистокинина (Cck) и/или глюкагона (Gcg) в крови индивидуума по меньшей мере на 5%, 10%, 15% или 20% по сравнению с индивидуумом до введения флагеллина Roseburia, и/или полипептида Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанного полипептида Fla (такого как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), подавляют экспрессию гена, кодирующего холицистокинин (Cck), и/или экспрессию гена, кодирующего глюкагон (Gcg) в клетке или клетках индивидуума.

В одном аспекте флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), снижают экспрессию гена, кодирующего холицистокинин (Cck), так что уровень экспрессии становится по меньшей мере на 5%, 10%, 15% или 20% более низким по сравнению с уровнем экспрессии у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2) и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2) и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном аспекте флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), снижают экспрессию гена, кодирующего глюкагон (Gcg), так что уровень экспрессии становится по меньшей мере на 5%, 10%, 15% или 20% более низким по сравнению с уровнем экспрессии у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

Термин "улучшение здоровья пищеварительного тракта", как используют в рамках изобретения, относится к уменьшению уровня воспаления пищеварительного тракта или его части и/или улучшение кишечной микробиоты.

В одном варианте осуществления уровень воспаления в пищеварительном тракте является по меньшей мере на 10%, 20%, 30%, 40% или 50% более низким, чем уровень воспаления в пищеварительном тракте индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), регулирует экспрессию по меньшей мере одного гена, выбранного из Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, ltln, Sprr1a, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, lgsf8 и Tcfe2a. Многие из этих генов являются генами кишечного барьера и, таким образом, функционируют, снижая инвазивность патогенов кишечника и также снижая число жизнеспособных патогенов.

В одном варианте осуществления экспрессия одного или нескольких генов, выбранных из группы, состоящей из TLR-родственных генов (например, Tlr5, Tlr1, и Vnn1), генов, кодирующих противомикробные пептиды (например, Defb37, Pla2g, Muc16, и ltln), генов функции кишечного барьера (например Sprr1a, Cldn4, Pmp22, Crb3 и Magi3), генов врожденного иммунитета (например Defcr20, Pcgf2, Ltbp4, lgsf8 и Tcfe2a) в клетке или клетках индивидуума повышается.

В одном варианте осуществления экспрессия одного или нескольких генов, выбранных из группы, состоящей из TLR-родственных генов (например Tlr5, Tlr1 и Vnn1), генов, кодирующих противомикробные пептиды (например Defb37, Pla2g, Muc16 и ltln), генов функции кишечного барьера (например Sprr1a, Cldn4, Pmp22, Crb3 и Magi3), генов врожденного иммунитета (например Defcr20, Pcgf2, Ltbp4, lgsf8 и Tcfe2a) увеличивается так, что уровень становится по меньшей мере на 10%, 20%, 30%, 40% или 50% более высоким, или более чем на 100% более высоким, по сравнению с уровнем у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления экспрессия одного или нескольких генов, выбранных из группы, состоящей из Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, ltln, Sprr1a, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, lgsf8 и Tcfe2a, в клетке или клетках индивидуума повышается.

В одном варианте осуществления уровень экспрессии одного или нескольких генов, выбранных из группы, состоящей из Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, ltln, Sprr1a, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, lgsf8 и Tcfe2a, повышается так, что уровень становится по меньшей мере на 10%, 20%, 30%, 40% или 50% более высоким, или более чем на 100% более высоким, чем уровень у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В одном варианте осуществления экспрессия одного или нескольких генов, выбранных из группы, состоящей из генов, кодирующих ацетил-CoA-ацетилтрансферазу, 3-гидроксиацил-CoA-дегидрогеназу, бутирил-CoA-дегидрогеназу и фосфоенолпируваткарбоксикиназу [ATP] в клетке или клетках индивидуума модулируется.

В одном варианте осуществления уровень экспрессии одного или нескольких генов, выбранных из группы, состоящей из генов, кодирующих ацетил-CoA-ацетилтрансферазу, 3-гидроксиацил-CoA-дегидрогеназу, бутирил-CoA-дегидрогеназу и фосфоенолпируваткарбоксикиназу [ATP], модулируется так, что уровень становится по меньшей мере на 10%, 20%, 30%, 40% или 50% более высоким или более низким по сравнению с уровнем у индивидуума до введения флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), индивидууму.

В следующем аспекте настоящее изобретение относится к трансформированному микроорганизму (такому как Firmicutes, например Roseburia spp, такие как R. hominis или R. intestinalis), в котором экспрессия флагеллина (например, флагеллина Roseburia), такого как FlaA1 или FlaA2, является повышенной по сравнению с эквивалентным микроорганизмом до трансформации, и к его применению для различных терапевтических и пищевых применений, как описано в настоящем описании. Например, трансформированный микроорганизм может быть трансформирован нуклеотидной последовательностью (такой как промотор), так что микроорганизм способен повышать экспрессию гена, кодирующего флагеллин (например флагеллин Roseburia), такой как FlaA1 или FlaA2. В другом примере трансформированный микроорганизм может быть трансформирован экспрессирующим вектором, содержащим нуклеотидную последовательность, кодирующую флагеллин (например флагеллин Roseburia) такой как FlaA1 или FlaA2, функционально связанную с регуляторной последовательностью (такой как промотор) так что микроорганизм становится способным сверхэкспрессировать ген, кодирующий флагеллин (например флагеллин Roseburia), такой как FlaA1 или FlaA2.

Как используют в рамках изобретения, термин "экспрессирующий вектор" относится к конструкции ДНК, содержащей конструкцию, содержащую кодирующую последовательность ДНК (например, последовательность гена), которая функционально связана с одной или несколькими последовательностью(ями) контроля, способными влиять на экспрессию кодирующей последовательности в хозяине. Такие последовательности контроля включают промотор для обеспечения транскрипции, необязательную последовательность оператора для контроля такой транскрипции, последовательность, кодирующую подходящие участки связывания рибосом с мРНК, и последовательности, которые контролируют завершение транскрипции и трансляции. Вектор может представлять собой плазмиду, фаговую частицу или просто потенциальную геномную вставку. После трансформации подходящему хозяину, вектор может реплицироваться и функционировать независимо от генома хозяина или в некоторых случаях он сам по себе может встраиваться в геном. Плазмида является наиболее часто используемой формой экспрессирующего вектора. Однако подразумевают, что описание включает такие другие формы экспрессирующих векторов, которые выполняют эквивалентные функции, которые известны или становятся известными в данной области.

Термин "функционально связанный" относится к соседнему расположению, где элементы организованы так, чтобы они были функционально сопряженными. Например, промотор функционально связан с кодирующей последовательностью, если он контролирует транскрипцию кодирующей последовательности.

Ткани

В одном варианте осуществления ткань или орган представляет собой пищеварительный тракт или его отдел (например, пищевод, желудок или кишечник, такой как тонкий кишечник или толстый кишечник и ободочная кишка) или области других слизистых оболочек (такие как носовые ходы и легкие).

В одном варианте осуществления ткань или орган представляет собой пищеварительный тракт или его часть.

Примеры частей пищеварительного тракта включают пищевод, желудок и тонкий кишечник (такой как тонкий кишечник (например, двенадцатиперстная кишка, тощая кишка или подвздошная кишка) и/или толстый кишечник (например, слепая кишка, восходящая ободочная кишка, поперечная ободочная кишка, нисходящая ободочная кишка и сигмовидная кишка)).

Индивидуум

В одном варианте осуществления индивидуумом является моногастрическое животное.

Примеры моногастрических животных включают птиц, людей, крыс, свиней, собак, кошек, лошадей и кроликов.

В другом варианте осуществления индивидуумом является млекопитающее, такое как моногастрическое млекопитающее.

Примеры моногастрических млекопитающих включают всеядных животных (таких как люди, крысы и свиньи), хищных животных (таких как собаки и кошки) и травоядных животных (таких как лошади и кролики).

В одном варианте осуществления индивидуумом является человек.

Как правило, TLR5 может экспрессироваться в клетках указанного индивидуума.

Нарушения

Roseburia флагеллин и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), можно использовать для лечения нарушения у индивидуума, где указанное нарушение представляет собой воспалительное нарушение и/или аутоиммунное нарушение.

В одном варианте осуществления воспалительное нарушение и/или аутоиммунное нарушение влияет на пищеварительный тракт или его отдел у указанного индивидуума.

В одном варианте осуществления воспалительное нарушение и/или аутоиммунное нарушение влияет на область слизистой оболочки индивидуума. Примеры областей слизистых оболочек включают пищеварительный тракт или его отдел (например, пищевод, желудок или тонкий кишечник, такой как тонкий кишечник или толстый кишечник и ободочная кишка), носовые ходы и легкие.

В одном варианте осуществления воспалительное нарушение и/или аутоиммунное нарушение выбрано из группы, состоящей из ревматоидного артрита, псориаза, рассеянного склероза, диабета типа I, глютеновой болезни, атопического дерматита, ринита, синдрома раздраженной кишки (IBS), колита, воспалительного нарушения кишечника (IBD), язвенного колита, резервуарного илеита, болезни Крона, функциональной диспепсии, атопических заболеваний, некротизирующего энтероколита и их комбинаций.

В одном аспекте воспалительное нарушение представляет собой колит. В следующем аспекте воспалительное заболевание представляет собой болезнь Крона, язвенный колит или резервуарный илеит.

В одном аспекте воспалительное нарушение и/или аутоиммунное нарушение поражает кишечник.

В одном аспекте кишечное нарушение представляет собой IBS. Точная патофизиология IBS еще предстоит установить. В недавних исследованиях описано воспаление слизистой оболочки и изменения микробиоты кишечника у пациентов с IBS и корреляция заболевания с кишечными инфекциями.

В следующем аспекте, кишечное нарушение представляет собой болезнь Крона.

В одном аспекте нарушение представляет собой аутоиммунное нарушение.

В одном аспекте аутоиммунное нарушение выбрано из группы, состоящей из язвенного колита, резервуарного илеита, ревматоидного артрита, псориаза, рассеянного склероза, диабета типа I, аллергии (включая глютеновую болезнь), атопического дерматита и ринита.

В частности вследствие функции восстановления иммунной толерантности, особое значение имеют аутоиммунные заболевания, ревматоидный артрит, псориаз, рассеянный склероз, диабет типа I.

Как используют в рамках изобретения, термин "лекарственное средство" охватывает лекарственные средства для применения как у человека, так и у животных, в медицине человека и ветеринарии. Кроме того, термин "лекарственное средство", как используют в рамках изобретения, означает любое вещество, которое обеспечивает терапевтический и/или благоприятный эффект. Термин "лекарственное средство", как используют в рамках изобретения, не обязательно ограничивается веществами, которые требуют разрешения продажи на рынке, но могут включать вещества, которые можно использовать в косметике, нутрицевтиках, пищевых продуктах (включая, например, еду и напитки), пробиотические культуры, пищевые добавки и натуральные лекарственные средства. Кроме того, термин "лекарственное средство", как используют в рамках изобретения, охватывает продукт, предназначенный для включения в корм для животных, например, в корм для скота и/или корм для домашних животных.

Профилактические применения

Флагеллин Roseburia, и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), согласно изобретению также можно использовать в профилактических применениях. В профилактических применениях флагеллин Roseburia, и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), согласно изобретению вводят пациенту, предрасположенному или имеющему иной риск, конкретного заболевания в количестве, которое является достаточном, чтобы по меньшей мере частично снизить риск развития заболевания. Такое количество определяют как "профилактически эффективная доза". Точные количества зависят от ряда конкретных факторов, таких как состояние здоровья индивидуума и его масса тела.

Инкапсулирование

В одном варианте осуществления флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia of полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), является инкапсулированной.

В следующем варианте осуществления фармацевтическая композиция, содержащая флагеллин Roseburia, и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), является инкапсулированной.

В другом варианте осуществления пищевая добавка, содержащая флагеллин Roseburia, и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), является инкапсулированной.

В следующем варианте осуществления пищевое вещество, продукт питания, диетическая добавка или пищевая добавка, являются инкапсулированными.

Термин "инкапсулированный", как используют в настоящем описании, относится к средствам для защиты полипептида, и/или полинуклеотидной последовательности, и/или вектора, и/или клетки-хозяина, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), от несовместимой окружающей среды посредством физического разделения так, чтобы их можно было доставить в заданную область (например, кишечник) без деградации или значительной деградации, чтобы полипептид, и/или полинуклеотидная последовательность, и/или вектор, и/или клетка-хозяин, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), могли оказывать эффект на заданную область. Примером является капсула, покрытая кишечной оболочкой.

Даже когда задачей инкапсулирования является выделение полипептида, и/или полинуклеотидной последовательности, и/или вектора, и/или клетки-хозяина, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), из окружающей среды, защитное покрытие или оболочка должны быть разрушены в момент желаемого действия. Разрушение защитного покрытия или оболочки, как правило, осуществляют с использованием химических и физических стимулов, таких как давление, действие ферментов, химическая реакция и физическая дезинтеграция.

Например, инкапсулирование обеспечивает возможность проглатывания полипептида, и/или полинуклеотидной последовательности, и/или вектора, и/или клетки-хозяина, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), чтобы полипептид, и/или полинуклеотидная последовательность, и/или вектор, и/или клетка-хозяин, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), можно было доставить в кишечник (т.е. в заданную область) в количестве, которое является эффективным для обеспечения эффекта в кишечнике.

Фармацевтическая композиция

Фармацевтическая композиция может представлять собой любую фармацевтическую композицию. В одном аспекте фармацевтическую композицию вводят перорально, энтерально или ректально. Например, композиция может представлять собой годную в пищу композицию. "Годный в пищу" означает материал, который одобрен для употребления человеком или животным.

Фармацевтические композиции могут быть предназначены для употребления человеком или животным в медицине человека или в ветеринарии.

Примеры таких пригодных эксципиентов для различных форм фармацевтических композиций, описанных в настоящем описании, могут быть найдены в "Handbook of Pharmaceutical Excipients, 2nd Edition, (1994), под редакцией A Wade и PJ Weller.

Приемлемые носители или разбавители для терапевтического применения хорошо известны в области фармацевтики и описаны, например, в Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985).

Примеры пригодных носителей включают лактозу, крахмал, глюкозу, метилцеллюлозу, стеарат магния, маннит, сорбит и т.п. Примеры пригодных разбавителей включают этанол, глицерин и воду.

Выбор фармацевтического носителя, эксципиента или разбавителя может быть осуществлен с учетом предполагаемого пути введения и стандартной фармацевтической практики. Фармацевтические композиции могут содержать в качестве или в дополнение к носителю, эксципиенту или разбавителю любое пригодное связующее вещество(а), смазывающее вещество(а), суспендирующее вещество(а), вещество(а) покрытия, солюбилизирующее вещество(а).

Примеры пригодных связующих веществ включают крахмал, желатин, природные сахара, такие как глюкоза, безводная лактоза, свободнотекучая лактоза, бета-лактоза, кукурузные подсластители, природные и синтетические камеди, такие как гуммиарабик, трагакант или альгинат натрия, карбоксиметилцеллюлоза и полиэтиленгликоль.

Примеры пригодных смазывающих веществ включают олеат натрия, стеарат натрия, стеарат магния, бензоат натрия, ацетат натрия, хлорид натрия и т.п.

В фармацевтической композиции могут быть предоставлены консерванты, стабилизаторы, красители и даже вкусовые добавки. Примеры консервантов включают бензоат натрия, сорбиновую кислоту и сложные эфиры п-гидроксибензойной кислоты. Также можно использовать антиоксиданты и суспендирующие вещества.

Пищевые добавки

Диетологически приемлемые носители, разбавители и эксципиенты включают носители, разбавители и эксципиенты, пригодные для употребления человеком или животным, и которые используют в качестве стандартных в пищевой промышленности. Типичные диетологически приемлемые носители, разбавители и эксципиенты известны специалисту в данной области.

Пищевые вещества/продукты

Следующий аспект изобретения относится к пищевым веществам, продуктам питания, диетическим добавкам и пищевым добавка, содержащим флагеллин Roseburia, и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидную последовательность, кодирующую указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетку-хозяина, содержащую указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis).

Термины "пищевое вещество", "продукт питания" "пищевая добавка" и "диетическая добавка", как используют в рамках изобретения, охватывают все годные к употреблению продукты, которые могут быть твердыми, желеобразными или жидкими.

Пригодные продукты питания могут включать, например, функциональные продукты питания, пищевые композиции, корма для домашних животных, корма для скота, диетические пищевые продукты, пищевые вещества и т.п. В одном аспекте продукт питания представляет собой диетический пищевой продукт.

Как используют в рамках изобретения, термин "функциональный продукт питания" означает продукт питания, которые способен обеспечивать не только питательный эффект, но также способен обеспечивать другой полезный эффект у потребителя. Таким образом, функциональные продукты питания представляют собой обычные продукты, которые имеют компоненты или ингредиенты (такие как ингредиенты, описанные в настоящем описании), включенные в них, которые придают продукту питания конкретную функциональную, например медицинскую или физиологическую пользу, отличную от исключительно питательного эффекта.

Примеры конкретных продуктов питания, которые пригодны в рамках настоящего изобретения, включают молочные продукты, готовые к употреблению десерты, порошки для разбавления, например, молоком или водой, шоколадно-молочные напитки, солодовые напитки, готовые к употреблению блюда, блюда немедленного приготовления или напитки для людей или композиции корма, соответствующие полному или частичному рациону для домашних животных или скота.

В одном аспекте пищевое вещество, продукт питания, диетическая добавка или пищевая добавка в соответствии с настоящим изобретением предназначены для людей, домашних животных или скота, таких как моногастрические животные. Пищевое вещество, продукт питания, диетическая добавка или пищевая добавка могут быть предназначена для животных, выбранных из группы, состоящей из собак, кошек, свиней, лошадей или птиц. В следующем варианте осуществления продукт питания, диетическая добавка или пищевая добавка предназначены для взрослых особей, в частности, для взрослых людей.

Термин "молочный продукт" как используют в рамках изобретения означает любое жидкое или полутвердое молоко или продукт на основе молочной сыворотки, имеющий различное содержание жира. Молочный продукт может представлять собой, например, коровье молоко, козье молоко, овечье молоко, обезжиренное молоко, цельное молоко, молоко, восстановленное из порошкового молока, и молочную сыворотку без какой-либо обработки, или обработанный продукт, такой как йогурт, сычужная закваска, творог, простокваша, свернувшееся цельное молоко, кефир и другие кисломолочные продукты. Другая важная группа включает молочные напитки, такие как напитки из молочной сыворотки, кисломолочные продукты, сгущенное молоко, молок для младенцев и детей; молоко со вкусовыми добавками, мороженое; содержащие молоко продукты, такие как сладости.

Пищевые вещества, продукты питания, диетические добавки или пищевые добавки по настоящему изобретению могут представлять собой или могут быть добавлены к пищевым добавкам, также называемым диетическими или питательными добавками или пищевыми добавками.

Пищевые вещества, продукты питания, диетические добавки или пищевые добавки согласно изобретению также можно использовать для кормления животных (например, для кормления свиней), в частности, у рано отнятых поросят и у откормочных свиней. Ожидается, что пищевые вещества, продукты питания, диетические добавки или пищевые добавки будут усиливать иммунную функцию, снижать или предупреждать инфекционные заболевания, благоприятным образом изменять состав микробиоты и улучшать рост и характеристики животных, например, посредством повышения расхода корма на единицу прироста массы тела.

Пробиотики или живой биотерапевтический продукт

Флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидная последовательность, кодирующая указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетка-хозяин, содержащая указанный вектор, и/или клетка-хозяин, содержащая указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), можно использовать в пробиотическом или живом биотерапевтическом продукте.

Другой аспект изобретения относится к пробиотической композиции, содержащей флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидную последовательность, кодирующую указанный флагеллин Roseburia и/или указанный полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетку-хозяина, содержащую указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis).

Как используют в рамках изобретения, термин "пробиотик" означает препараты микробных клеток или компонентов микробных клеток с благоприятным эффектом на здоровье или самочувствие реципиента. (Salminen S, Ouwehand A. Benno Y. et al "Probiotics: how should they be defined" Trends Food Sci. Technol. 1999:10 107-10).

В одном аспекте пробиотическая композиция представляет собой перорально вводимую композицию метаболически активных, т.е. живых и/или лиофилизированных, или нежизнеспособных убитых нагреванием, облученных или подвергнутых лизису пробиотических бактерий. Пробиотическая композиция может содержать другие ингредиенты. Пробиотическую композицию можно вводить перорально, т.е. в форме таблетки, капсулы или порошка. Пробиотическая композиция может содержать вид бактерий R. hominis или R. intestinalis. Инкапсулированные продукты являются предпочтительными для R. hominis и R. intestinalis, поскольку они являются анэробами. Могут быть включены другие ингредиенты (например, такие как витамин C), в качестве ловушек кислорода и пребиотических субстратов (таких как те, которые улучшают колонизацию и выживаемость in vivo). Альтернативно пробиотическую композицию по изобретению можно вводить перорально в качестве пищевого или питательного продукта, такого как молоко, ферментированный молочный продукт на основе молочной сыворотки, или в качестве фармацевтического продукта.

Пригодная суточная доза пробиотических бактерий составляет от приблизительно 1×103 до приблизительно 1×1011 колониеобразующих единиц (CFU); например, от приблизительно 1×107 до приблизительно 1×1010 к.о.е.; в другом примере от приблизительно 1×106 до приблизительно 1×1010 CFU.

В одном аспекте пробиотическая композиция содержит в качестве активных ингредиентов вид бактерий и/или их клеточные компоненты в количестве от приблизительно 1×106 до приблизительно 1×1011 к.о.е./г, относительно массы композиции; например, от приблизительно 1×108 до приблизительно 1×1010 к.о.е./г. Доза может составлять 1 г, 3 г, 5 г и 10 г.

Как правило, пробиотик необязательно комбинируют по меньшей мере с одним пригодным пребиотическим соединением. Пребиотик обычно представляет собой неперевариваемый углевод, такой как олиго- или полисахарид, или сахарный спирт, который не деградирует или не всасывается в верхнем пищеварительном тракте. Известные пребиотики включают коммереские продукты, такие как инулин и трансгалактоолигосахариды.

В одном аспекте пробиотическая композиция по настоящему изобретению включает пребиотик в количестве от приблизительно 1 до приблизительно 30% по массе, относительно общей массы композиции (например от 5 до 20% по массе). Углеводы могут быть выбраны из группы, состоящей из: фруктоолигосахаридов (или FOS), короткоцепочечных фруктоолигосахаридов, инулина, изомальтолигосахаридов, пектинов, ксилоолигосахаридов (или XOS), хитозанолигосахаридов (или COS), бета-глюканов, модифицированных аравийской камедью и устойчвых крахмалов, полидекстрозы, D-тагатозы, волокон акации, волокон рожкового дерева, овса и цитрусовых. В одном аспекте пребиотики представляют собой короткоцепочечные фруктоолигосахариды (для простоты представленные в настоящем описании как FOSs-c.c); указанные FOSs-c.c. представляют собой неперевариваемые углеводы, обычно получаемые путем переработки сахарной свеклы и включающие молекулу сахарозы, с которой связаны три молекулы глюкозы.

Введение

Фармацевтические композиции, питательные добавки, пищевые вещества, продукты питания, диетические добавки или пищевые добавки по настоящему изобретению могут быть адаптированы для перорального, ректального, вагинального, парентерального, внутримышечного, внутрибрюшинного, внутриартериального, интратекального, внутрибронхиального, подкожного, внутрикожного, внутривенного, назального, буккального или сублингвального путей введения.

В одном аспекте фармацевтические композиции, питательные добавки, пищевые вещества, продукты питания, диетические добавки или пищевые добавки по настоящему изобретению адаптированы для перорального. ректального, вагинального, парентерального, назального, буккального или сублингвального путей введения.

В следующем аспекте фармацевтические композиции, питательные добавки, пищевые вещества, продукты питания, диетические добавки или пищевые добавки по настоящему изобретению адаптированы для перорального введения.

Для перорального введения особенно применимыми являются прессованные таблетки, пилюли, таблетки, желатиновые капсулы, капли и капсулы.

Другие формы введения включают растворы или эмульсии, которые можно инъецировать внутривенно, внутриартериально, интратекально, подкожно, внутрикожно, внутрибрюшинно или внутримышечно, и которые получают из стерильных или стерилизуемых растворов. Фармацевтические композиции по настоящему изобретению также могут иметь форму суппозиториев, пессариев, суспензий, эмульсий, лосьонов, мазей, кремов, гелей, спреев, растворов или присыпок.

Альтернативными способами трансдермального введения являются введение с использованием кожного пластыря. Например, активный ингредиент можно включать в крем, состоящий из водной эмульсии полиэтиленгликолей или вазелинового масла. В другом примере, активный ингредиент также может быть включен в мазь, состоящую из белого воска или белой мягкой парафиновой основы вместе с такими стабилизаторами и консервантами, которые могут потребоваться.

Фармацевтические композиции, питательные добавки, пищевые вещества, продукты питания, диетические добавки или пищевые добавки могут быть составлены в единичной дозированной форме, т.е. в форме отдельных частей, содержащих единичную дозу, или множество единичных доз или части единичных доз.

Дозировка

Специалист в данной области может без труда определить соответствующую дозу флагеллина Roseburia и/или полипептида Fla (такого как FlaA1 или FlaA2), и/или полинуклеотидной последовательности, кодирующей указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектора, содержащего указанную полинуклеотидную последовательность, и/или клетки-хозяина, содержащей указанный вектор, и/или клетки-хозяина, содержащей указанную полинуклеотидную последовательность, и/или Roseburia (таких как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), для введения индивидууму без излишнего экспериментирования. Как правило, врач может определить истинную дозировку, который является наиболее пригодной для индивидуального пациента, и она зависит от различных факторов, включающих активность конкретного используемого бактериального штамма, метаболическую стабильность и продолжительность действия этого штамма, возраста, массы тела, общего состояния здоровья, пола, режима питания, пути и времени введения, скорости экскреции, комбинации лекарственных средств, тяжести конкретного состояния и индивидуальной проводимой терапии. Дозировки, описанные в настоящем описании, иллюстрируют средний случай. Безусловно, могут быть индивидуальные случая, когда оправданы более высокие или более низкие диапазоны дозировок, и они входят в объем настоящего изобретения.

Комбинации

В одном аспекте флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидную последовательность, кодирующую указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетку-хозяина, содержащую указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), вводят в комбинации по меньшей мере с одним, или двумя, или тремя, или четырьмя, или пятью другими активными агентами. В таких случаях флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или полинуклеотидную последовательность, кодирующую указанный флагеллин Roseburia и/или полипептид Fla (такой как FlaA1 или FlaA2), и/или вектор, содержащий указанную полинуклеотидную последовательность, и/или клетку-хозяина, содержащую указанный вектор, и/или клетку-хозяина, содержащую указанную полинуклеотидную последовательность, и/или Roseburia (такие как вид бактерий Roseburia hominis или вид бактерий Roseburia intestinalis), можно вводить последовательно, одновременно или один за другим с одним или несколькими другими активными веществами.

По меньшей мере один, или два, или три, или четыре, или пять активных агентов могут быть выбраны из группы, состоящей из: флагеллинов Roseburia, полипептида Fla (такого как FlaA1 или FlaA2), полинуклеотидной последовательности(ей), кодирующей указанный флагеллин Roseburia, полинуклеотидной последовательности(ей), кодирующей указанный полипептид Fla (такой как FlaA1 или FlaA2), вектора(ов), содержащего указанную полинуклеотидную последовательность(и), клетку(и)-хозяина, содержащую указанный вектор(ы), клетку(и)-хозяина, содержащую указанную полинуклеотидную последовательность(и), и микроорганизмы (например Roseburia, такие как R. hominis и/или R. intestinalis).

По меньшей мере одно, или два, или три, или четыре, или пять других активных агентов могут представлять собой микроорганизм (например, Roseburia, такие как R. hominis и/или R. intestinalis). Примеры пригодных микроорганизмов включают: Roseburia hominis A2-183 и Roseburia intestinalis L1-82.

Идентичность последовательностей или гомология последовательностей

Термины "полипептид", "полипептид последовательность", "белок" и "аминокислотная последовательность" используют в настоящем описании взаимозаменяемо.

Термины "полинуклеотидная последовательность" и "нуклеотидная последовательность" используют в настоящем описании взаимозаменяемо.

Настоящее изобретение также охватывает применение последовательности, имеющей степень идентичности последовательности или гомологии последовательности с аминокислотной последовательностью(ями) полипептида, описанного в настоящем описании (например, варианты, гомологи и производные) или любой нуклеотидной последовательностью, кодирующей такой полипептид (далее обозначаемая как "гомологичная последовательность(и)"). В рамках настоящего изобретения термин "гомолог" означает структуру, имеющую определенную гомологию с рассматриваемыми аминокислотными последовательностями и рассматриваемыми нуклеотидными последовательностями. В рамках настоящего изобретения термин "гомология" может быть приравнен к "идентичности".

В контексте настоящего изобретения гомологичная последовательность включает аминокислотную или нуклеотидную последовательность, которая может быть по меньшей мере на 50, 60, 70, 75, 80, 85 или 90% идентичной, в некоторых вариантах осуществления по меньшей мере на 95, 96, 97, 98 или 99% идентичной рассматриваемой последовательности. Хотя гомологию также можно рассматривать в понятиях сходства (т.е. аминокислотные остатки, имеющие сходные химические свойства/функции), в контексте настоящего изобретения предпочтительно выражать гомологию в понятиях идентичности последовательностей.

В некоторых вариантах осуществления гомологичная последовательность включает аминокислотную последовательность или нуклеотидную последовательность, которая имеет одну или несколько вставок, делеций и/или замен по сравнению с рассматриваемой последовательностью.

В некоторых вариантах осуществления настоящее изобретение относится к применению белка, аминокислотная последовательность которого представлена в настоящем описании, или белка, происходящего из этого (родительского) белка посредством замены, делеции или вставки одной или нескольких аминокислот, как например, 2, 3, 4, 5, 6, 7, 8, 9 аминокислот или более, как например, 10 или более 10 аминокислот в аминокислотной последовательности родительского белка, и обладающего активностью родительского белка.

В некоторых вариантах осуществления настоящее изобретение относится к применению последовательности нуклеиновой кислоты (или гена), кодирующей белок, аминокислотная последовательность которого представлена в настоящем описании, или кодирующей белок, происходящий из этого (родительского) белка посредством замены, делеции или вставки одной или нескольких аминокислот, как например, 2, 3, 4, 5, 6, 7, 8, 9 аминокислот или более аминокислот, как например, 10 или более 10 аминокислот, в аминокислотной последовательности родительского белка, и имеющий активность родительского белка.

В контексте настоящего изобретения гомологичный последовательность включает нуклеотидную последовательность, которая может быть по меньшей мере на 50, 60, 70, 75, 85 или 90% идентичной, в некоторых вариантах осуществления по меньшей мере на 95, 96, 97, 98 или 99% идентичной нуклеотидной последовательности, кодирующей полипептид, описанный в настоящем описании (рассматриваемая последовательность). Как правило, гомолог содержит те же или эквивалентные последовательности, которые кодируют домен(ы) и т.д., что и рассматриваемая последовательность. Хотя гомологию также можно рассматривать в понятиях сходства (т.е. аминокислотные остатки, имеющие сходные свойства/функции), в контексте настоящего изобретения предпочтительно выражать гомологию в понятиях идентичности последовательностей.

Гомологичный аминокислотная последовательность и/или нуклеотидная последовательность может обеспечивать и/или кодировать полипептид, который сохраняет функциональную активность и/или повышает активность полипептида.

В некоторых аспектах аминокислотная последовательность, как описано в настоящем описании, обладает по меньшей мере 50, 60, 70, 75, 80, 85 или 90% идентичностью, в некоторых вариантах осуществления по меньшей мере 95, 96, 97, 98 или 99% идентичностью с рассматриваемой последовательностью.

В некоторых аспектах нуклеотидная последовательность, как описано в настоящем описании, обладает по меньшей мере 50, 60, 70, 75, 80, 85 или 90% идентичностью, в некоторых вариантах осуществления по меньшей мере 95, 96, 97, 98 или 99% идентичностью с рассматриваемой последовательностью.

Сравнение гомологии можно проводить невооруженным глазом или чаще с помощью свободно доступных программ для сравнения последовательностей. Эти коммерчески доступные компьютерные программы могут вычислять % гомологию между двумя или более последовательностями.

% гомологию можно вычислять для непрерывных последовательностей, т.е. одну последовательность выравнивают с другой последовательностью, и каждая аминокислота в одной последовательность прямо сравнивается с соответствующей аминокислотой в другой последовательности, по одному остатку за раз. Это называют выравниванием "без пропусков". Как правило, такое выравнивание без пропусков проводят только на протяжении относительно короткого числа остатков.

Хотя этот способ является очень простым и унифицированным, в нем не учитывается, что, например, в случае в ином случае идентичной пары последовательностей одна инсерция или делеция будет приводить к тому, что следующие аминокислота остатки будут исключаться из выравнивания, таким образом, потенциально вызывая значительное снижение % гомологии при проведении глобального выравнивания. Следовательно, большинство способов сравнения последовательностей предназначены для проведения оптимального выравнивания, которые учитывают возможные инсерции и делеции без чрезмерного снижения общего показателя гомологии. Это осуществляется путем встраивания "пропусков" при выравнивании последовательностей, чтобы попытаться максимизировать локальную гомологию.

Однако эти более комплексные способы присваивают "штраф за внесение пропуска" каждому пропуску, который происходит при выравнивании, так что для одного и того же числа идентичных аминокислот, выравнивание последовательностей с наименьшим возможным количеством пропусков, отражающее более родство между двумя сравниваемыми последовательностями, будет обеспечивать более высокий показатель, чем выравнивание с множеством пропусков. Как правило, используют "аффинный штраф за пропуск", который предписывают относительно высокий штраф за внесение пропуска и меньший штрафы за каждый последующий остаток в пропуске. Он является наиболее часто используемой системой оценки пропусков. Высокие штрафы за пропуск, безусловно, будут обеспечивать оптимизированное выравнивание с меньшим количеством пропусков. Большинство программ выравнивания позволяют модифицировать штрафы за пропуск. Как правило, при использовании такого программного обеспечения для сравнения последовательностей используют параметры по умолчанию.

Вычисление максимальной % гомологии, таким образом, во-первых, требует проведения оптимального выравнивания, учитывая штрафы за пропуски. Пригодной компьютерной программой для проведения такого выравнивания является Vector NTI (Invitrogen Corp.). Примеры программного обеспечения, которое может проводить сравнения последовательностей, включают, но не ограничиваются ими, пакет программ BLAST (см. Ausubel et al 1999 Short Protocols in Molecular Biology, 4th Ed - Chapter 18), BLAST 2 (см. FEMS Microbiol Lett 1999 174(2): 247-50; FEMS Microbiol Lett 1999 177(1): 187-8 и tatiana@ncbi.nlm.nih.gov), FASTA (Altschul et al 1990 J. Mol. Biol. 403-410) и, например, AlignX например. По меньшей мере BLAST, BLAST 2 и FASTA являются доступными для поиска в автономном режиме и через Интернет (см. Ausubel et al 1999, стр. с 7-58 по 7-60).

Хотя конечную % гомологию можно измерять в понятиях идентичности, процесс выравнивания, сам по себе, как правило не основан на сравнении пар по принципу "все или ничего". Вместо этого обычно используют взвешенную оценочную матрицу сходства, которая приписывает оценку каждому попарному сравнению, исходя из химического сходства или эволюционного расстояния. Примером такой широко используемой матрицы является матрица BLOSUM62 - матрица по умолчанию для пакета программ BLAST. В программах Vector NTI обычно используются либо общедоступные величины по умолчанию, либо специализированная таблица сравнения символов, если она поставляется (см. руководство пользователя для дополнительных деталей). Для некоторых применений является предпочтительным использование величин по умолчанию для пакета программ Vector NTI.

Альтернативно процентную гомологию можно вычислять с использованием функции множественного сравнения в Vector NTI (Invitrogen Corp.), на основе алгоритма, аналогичного CLUSTAL (Higgins DG & Sharp PM (1988), Gene 73(1), 237-244).

После проведения программным обеспечением оптимального выравнивания, является возможным вычисление % гомологии, например % идентичности последовательностей. Программное обеспечение, как правило, проводит это в качестве части сравнения последовательностей и генерирует числовой результат.

При использовании штрафов за пропуск при определении идентичности последовательностей для попарного выравнивания можно использовать следующие параметры, например:

ДЛЯ BLAST
ВНЕСЕНИЕ ПРОПУСКА 0
ПРОДОЛЖЕНИЕ ПРОПУСКА 0

ДЛЯ CLUSTAL ДНК БЕЛОК
РАЗМЕР СЛОВА 2 1 K triple
ШТРАФ ЗА ВНЕСЕНИЕ ПРОПУСКА 15 10
ШТРАФ ЗА ПРОДОЛЖЕНИЕ ПРОПУСКА 6,66 0,1

В одном варианте осуществления можно использовать CLUSTAL со штрафом за внесение пропуска и штрафом за продолжение пропуска, как определено выше.

В одном варианте осуществления степень идентичности в отношении нуклеотидной последовательности определяют на протяжении по меньшей мере 20 последовательно расположенных нуклеотидов, например, на протяжении по меньшей мере 30 последовательно расположенных нуклеотидов, например, на протяжении по меньшей мере 40 последовательно расположенных нуклеотидов, например, на протяжении по меньшей мере 50 последовательно расположенных нуклеотидов, например, на протяжении по меньшей мере 60 последовательно расположенных нуклеотидов, например, на протяжении по меньшей мере 100 последовательно расположенных нуклеотидов, например, на протяжении по меньшей мере 200 последовательно расположенных нуклеотидов, например на протяжении по меньшей мере 300 последовательно расположенных нуклеотидов.

В одном варианте осуществления степень идентичности в отношении нуклеотидной последовательности можно определять на протяжении всей последовательности.

Рекомбинантный

В одном аспекте полипептид и/или полинуклеотидная последовательность флагеллина Roseburia для применения в рамках настоящего изобретения представляют собой рекомбинантную последовательность, т.е. последовательность, полученную с использованием способов рекомбинантных ДНК.

Эти способы рекомбинантных ДНК входят в пределы способности специалиста в данной области. Такие способы объяснены в литературе, например, J. Sambrook, E. F. Fritsch, и T. Maniatis, 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Books 1-3, Cold Spring Harbor Laboratory Press.

Синтетический

В одном аспекте полинуклеотидная последовательность флагеллина Roseburia для применения в рамках настоящего изобретения представляет собой синтетическую последовательность, т.е. последовательность, полученную посредством химического или ферментативного синтеза in vitro. Она включает, но не ограничивается ими, последовательности, полученные с помощью оптимального использования кодонов для организмов-хозяев, таких как метилотрофные дрожжи Pichia и Hansenula.

Экспрессия ферментов

Нуклеотидная последовательность для применения в рамках настоящего изобретения может быть включена в рекомбинантный реплицируемого вектор. Вектор можно использовать для репликации и экспрессии нуклеотидной последовательности в белковой форме в и/или из совместимой клетки-хозяина.

Экспрессию можно контролировать с использованием последовательностей контроля, например, регуляторных последовательностей.

Белок, продуцируемой рекомбинантной клеткой-хозяином путем экспрессии нуклеотидной последовательности, может секретироватся или может содержаться внутриклеточно в зависимости от последовательности и/или используемого вектора. Кодирующие последовательности могут быть сконструированы с сигнальными последовательностями, которые направляют секрецию основных кодируемых последовательностей через конкретную мембрану прокариотических или эукариотических клеток.

Экспрессирующий вектор

В одном аспекте настоящее изобретение относится к вектору (такому как экспрессирующий вектор), содержащему по меньшей мере одну полинуклеотидную последовательность, кодирующую по меньшей мере один флагеллин Roseburia.

Термин "экспрессирующий вектор" означает конструкцию, способную к экспрессии in vivo или in vitro.

В одном варианте осуществления экспрессирующий вектор встроен в геном подходящего организма-хозяина. Термин "встроенный" в одном аспекте охватывает стабильное встраивание в геном.

Нуклеотидная последовательность по настоящему изобретению может присутствовать в векторе, в котором нуклеотидная последовательность функционально связана с регуляторными последовательностями, способными обеспечивать экспрессию нуклеотидной последовательности подходящей клеткой-хозяином или организмом-хозяином.

Векторами для применения в рамках настоящего изобретения можно трансформировать подходящую клетку-хозяина или организм-хозяина, как описано в настоящем описании, для обеспечения экспрессии полипептида по настоящему изобретению.

Выбор вектора, например плазмидного, космидного или фагового вектора, часто зависит от клетки-хозяина, в которую его намереваются вводить.

Векторы для применения в рамках настоящего изобретения могут содержать один или несколько генов селективных маркеров, таких как ген, который сообщает устойчивость к антибиотикам, например, устойчивость к ампициллину, канамицину, хлорамфениколу или тетрациклину. Альтернативно селекцию можно проводить посредством совместной трансформации (как описано в WO91/17243).

Векторы можно использовать in vitro, например, для получения РНК, или использовать для трансфекции, трансформации, трансдукции или инфицирования клетки-хозяина.

Таким образом, в следующем варианте осуществления описание относится к способу получения нуклеотидных последовательностей по настоящему изобретению посредством внесения нуклеотидной последовательности по настоящему изобретению в реплицирующийся вектор, введения вектора в совместимую клетку-хозяина и выращивания клетки-хозяина в условиях, которые осуществляют репликацию вектора.

Вектор, кроме того, может содержать нуклеотидную последовательность, позволяющую вектору реплицироваться в рассматриваемой клетке-хозяине. Примерам таких последовательности являются ориджины репликации плазмид pUC19, pACYC177, pUB110, pE194, pAMB1 и pIJ702.

Экспрессирующий вектор может содержать по меньшей мере две, три, четыре или пять полинуклеотидных последовательностей, кодирующих флагеллины Roseburia.

Примеры экспрессирующих векторов включают pGEX-6P-1, PCR-Blunt II-TOPO и T7-MAT-Tag-FLAG-.

Экспрессирующий вектор pGEX-6P-1 можно использовать для клонирования рекомбинантных флагеллинов. Экспрессирующий вектор pGEX-6P-1 содержит промотор tac для химически индуцируемой экспрессии на высоком уровне GST-меченых рекомбинантных белков, внутренний ген lacIq для применения в любом хозяине E. coli, ген AmpR для селекции с ампициллином и участок для протеазы PreScission, для отщепления, если желательно, белка от слитого продукта.

Клонирующий вектор PCR-Blunt II-TOPO можно использовать для клонирования рекомбинантных флагеллинов, в частности, флагеллинов, которые являются нерастворимыми после клеточного лизиса. Как правило, этот вектор позволяет высокоэффективное клонирование ДНК продуктов ПЦР с тупыми концами. Вектор содержит гены устойчивости к канамицину и зеоцину для селекции в E. coli, и вставка фланкируется множествами участков рестрикции для вырезания.

Для клонирования рекомбинантных флагеллинов можно использовать экспрессирующий вектор T7-MAT-Tag-FLAG-, в частности, флагеллинов, которые являются нерастворимыми после лизиса клеток. Участок множественного клонирования (MCS) фланкируется последовательностью MAT (металлсодержащая аффинная метка) и последовательностью пептида FLAG (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys), что приводит к продуцированию флагеллина с двойным мечением, который далее можно очищать с использованием аффинных колонок. Этот экспрессирующий вектор также содержит промотор pT7/lac (lac-оперон фага T7) для индуцируемой IPTG экспрессии на высоком уровне рекомбинантных флагеллинов MAT-ORF-FLAG, внутреннего гена lacI, который подавляет транскрипцию в базальном состоянии в любом хозяине E. coli, и ген AmpR для селекции с ампициллином.

Регуляторные последовательности

В некоторых применениях нуклеотидная последовательность для применения в рамках настоящего изобретения функционально связана с регуляторной последовательностью, которая способна обеспечивать экспрессию нуклеотидной последовательности, например, выбранной клеткой-хозяином. В качестве примера настоящее изобретение охватывает вектор, содержащий нуклеотидную последовательность по настоящему изобретению, функционально связанную с такой регуляторной последовательностью, т.е. вектор представляет собой экспрессирующий вектор.

Термин "функционально связанный" относится к смежному положению, где описанные компоненты обладают взаимозависимостью, позволяющей им функционировать предполагаемым для них образом. Регуляторную последовательность, "функционально связанную" с кодирующей последовательностью, лигируют таким образом, чтобы осуществлялась экспрессия кодирующей последовательности в условиях, совместимых с последовательностями контроля.

Термин "регуляторные последовательности" включает промоторы, и энхансеры, и другие сигналы регуляции экспрессии.

Термин "промотор" используют в его обычном значении в данной области, например, в значении участка связывания РНК-полимеразы.

Увеличенной экспрессии нуклеотидной последовательности, кодирующей флагеллин по настоящему изобретению, также можно достигать посредством выбора гетерологичных регуляторных областей, например, областей промоторов, секреторных лидерных последовательностей и терминаторов.

В одном варианте осуществления нуклеотидная последовательность согласно настоящему описанию функционально связана по меньшей мере с промотором.

Другие промоторы также можно использовать для контроля экспрессии полипептида по настоящему описанию.

Примеры пригодных промоторов для контроля транскрипции нуклеотидной последовательности в хозяевах, являющихся бактериями, грибами или дрожжами, хорошо известны в данной области.

Промотор, кроме того, может включать признаки, обеспечивающие или повышающие экспрессию в подходящем хозяине. Например, признаки могут представлять собой консервативные боксы, такие как Box Прибнова или TATA-бокс.

Конструкции

Термин "конструкция", который является синонимом терминам, таким как "конъюгат", "кассета" и "гибрид", включает нуклеотидную последовательность для применения в соответствии с настоящим изобретением, прямо или непрямо связанную с промотором.

Примером непрямого присоединения является предоставление подходящей спейсерной группы, такой как последовательность интрона, такая как Sh1-интрон или интрон ADH, между промотором и нуклеотидной последовательностью по настоящему изобретению. Указанное является справедливым для термина "слитый" в отношении настоящего изобретения, который включает прямое или непрямое связывание. В некоторых случаях термины не охватывают природную комбинацию нуклеотидной последовательности, кодирующей белок, обычно связанной с промотором гена дикого типа, и случай, когда они оба находятся в их естественном окружении.

Конструкция также может содержать или экспрессировать маркер, который обеспечивает селекцию генетической конструкции.

Для некоторых применений конструкция по настоящему изобретению содержит по меньшей мере нуклеотидную последовательность по настоящему изобретению, функционально связанную с промотором.

Клетки-хозяева

Термин "клетка-хозяин" в отношении настоящего описания включает любу клетку, которая содержит нуклеотидную последовательность и/или экспрессирующий вектор, как описано в настоящем описании. Как правило, клетка-хозяин способна к рекомбинантной продукции белка, имеющего конкретные свойства, как определено в настоящем описании.

Примеры клеток-хозяев включают бактерии, такие как Roseburia spp., и компетентные клетки. Примерами Roseburia spp являются Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis и Roseburia inulinivorans. Примеры компетентных клеток включают компетентные клетки E. coli (такие как E. coli BL21(DE3) pLysS и/или E. coli B21 Rosetta).

Таким образом, следующий вариант осуществления настоящего изобретения относится к клеткам-хозяевам, трансформированным или трансфицированным нуклеотидной последовательностью по настоящему изобретению. Дополнительно или альтернативно, следующий вариант осуществления настоящего изобретения относится к клеткам-хозяевам, трансформированным или трансфицированным нуклеотидной последовательностью (например, промотор, такой как гетерологичный промотор или экзогенный промотор), которая способна активировать экспрессию (обеспечивать сверхэкспрессию) нуклеотидной последовательности (например, ген, такой как гомологичный ген или эндогенный ген), кодирующей флагеллин по настоящему изобретению по сравнению с эквивалентным микроорганизмом перед трансформацией. Клетки выбирают так, чтобы они были совместимыми с указанным вектором и, например, они могут представлять собой клетки бактерий (например прокариотические клетки), клетки грибов или клетки дрожжей.

Нуклеотидная последовательность, кодирующая флагеллин по настоящему изобретению, может быть гетерологичной или гомологичной для клетки-хозяина. Как правило, когда нуклеотидная последовательность, кодирующая флагеллин, является гомологичной клетке-хозяину, клетка-хозяин содержит множество копий нуклеотидной последовательности. Дополнительно или альтернативно, нуклеотидная последовательность, кодирующая флагеллин, функционально связана с гетерологичным промотором; как правило, указанный промотор способен активировать (сверхэкспрессировать) гомологичную нуклеотидную последовательность, кодирующую флагеллин.

В одном примере клетка-хозяин содержит нуклеотидную последовательность, кодирующую полипептид флагеллина по настоящему изобретению (такой как гомологичная или эндогенная нуклеотидная последовательность) под контролем гетерологичного или экзогенного промотора.

В одном варианте осуществления клетка-хозяин трансформирована или трансфицирована одной или несколькими нуклеотидными последовательностями, которые кодируют по меньшей мере один флагеллин (например флагеллин Roseburia), выбранный из группы, состоящей из Fla1, Fla2, Fla3 и Fla4. В другом варианте осуществления клетка-хозяин трансформирована или трансфицирована одной или несколькими нуклеотидными последовательностями, которые кодируют по меньшей мере один флагеллин (например, флагеллин Roseburia), выбранный из группы, состоящей из Fla2, Fla1 и Fla4. В следующем варианте осуществления клетка-хозяин трансформирована или трансфицирована нуклеотидными последовательностями, которые кодируют флагеллин (например флагеллин Roseburia) Fla2.

Клетка-хозяин может содержать множество копий полинуклеотидных последовательностей, кодирующих флагеллины Roseburia.

Клетка-хозяин может содержать по меньшей мере 1, 2, 3, 4 или 5 полинуклеотидных последовательностей, кодирующих по меньшей мере 1, 2, 3, 4 или 5 флагеллинов Roseburia.

В одном варианте осуществления клетка-хозяин содержит полинуклеотидную последовательность, кодирующую по меньшей мере один флагеллин Roseburia, происходящий или получаемый из одного вида Roseburia, и по меньшей мере одну дополнительную полинуклеотидную последовательность, кодирующую по меньшей мере один флагеллин Roseburia, происходящий или получаемый из отличающегося вида Roseburia. Например, клетка-хозяин содержит по меньшей мере одну полинуклеотидную последовательность, кодирующую флагеллин R. hominis (например Fla1 или Fla2), и по меньшей мере одну полинуклеотидную последовательность, кодирующую флагеллин R. intestinalis (например Fla1 или Fla 2).

Клетка-хозяин может содержать по меньшей мере 1, 2, 3, 4 или 5 экспрессирующих векторов, содержащих по меньшей мере 1, 2, 3, 4 или 5 полинуклеотидных последовательностей, кодирующих флагеллин Roseburia.

В одном варианте осуществления клетка-хозяин содержит экспрессирующий вектор, содержащий полинуклеотидную последовательность, кодирующую флагеллины Roseburia, происходящие или получаемые из одного вида Roseburia, и по меньшей мере один дополнительный экспрессирующий вектор, содержащий полинуклеотидную последовательность, кодирующую флагеллины Roseburia, происходящую или получаемую из другого вида Roseburia. Например, клетка-хозяин содержит по меньшей мере один экспрессирующий вектор, содержащий полинуклеотидную последовательность, кодирующую флагеллин R. hominis (например Fla1 или Fla2) и по меньшей мере один экспрессирующий вектор, содержащий полинуклеотидную последовательность, кодирующую флагеллин R. intestinalis (например Fla1 или Fla 2).

Нуклеотидная последовательность, кодирующая флагеллин, может быть эндогенной или экзогенной для клетки-хозяина. Как правило, когда нуклеотидная последовательность, кодирующая флагеллин, является эндогенной для клетки-хозяина, клетка-хозяин содержит множество копий нуклеотидной последовательности. Дополнительно или альтернативно, нуклеотидная последовательность, кодирующая флагеллин, функционально связана с экзогенным промотором; как правило, указанный промотор способен активировать (обеспечивать сверхэкспрессию) эндогенной нуклеотидной последовательности, кодирующей флагеллин.

Примерами пригодных бактериальных организмов-хозяев являются грам-положительные или грам-отрицательные виды бактерий.

В одном варианте осуществления клетка-хозяин представляет собой микроорганизм.

В одном варианте осуществления клетка-хозяин представляет собой вид молочнокислых бактерий, вид Lactococcus, вид Bifidobacterium, вид Lactobacillus или вид Propionibacterium.

Примеры молочно-кислых бактерий включают, но не ограничиваются ими, Lactobacillus spp., Leuconostoc spp., Pediococcus spp., Lactococcus spp., Streptococcus spp., Aerococcus spp., Carnobacterium spp., Enterococcus spp., Oenococcus spp., Sporolactobacillus spp., Tetragenococcus spp., Vagococcus spp. и Weisella spp.

Примеры Lactobacillus spp включают Lactobacillus paracasei, L. acidophilus, L. fermentum, L. brevis, L. gasseri, L. plantarum, L. bulgaricus, L. helveticus, L. reuteri, L. casei, L. jensenii, L. rhamnosus, L. crispatus, L. johnsonii, L. salivarius, L. acetotolerans, L. acidifarinae, L. acidipiscis, L. agilis, L. algidus, L. alimentarius, L. amylolyticus, L. amylophilus, L. amylotrophicus, L. amylovorus, L. animalis, L. antri, L. apodemi, L. aviarius, L. bifermentans, L. buchneri, L. camelliae, L. catenaformis, L. ceti, L. coleohominis, L. collinoides, L. composti, L. concavus, L. coryniformis, L. crustorum, L. curvatus, L. delbrueckii subsp. delbrueckii, L. delbrueckii subsp. bulgaricus, L. delbrueckii subsp. lactis, L. dextrinicus, L. diolivorans, L. equi, L. equigenerosi, L. farraginis, L. farciminis, L. fornicalis, L. fructivorans, L. frumenti, L. fuchuensis, L. galUnarum, L. gastricus, L. ghanensis, L. graminis, L. hammesii, L. hamsteri, L. harbinensis, L. hayakitensis, L. hilgardii, L. homohiochii, L. iners, L. ingluviei, L. intestinalis, L. kalixensis, L. kefiranofaciens, L. kefiri, L. kimchii, L. kitasatonis, L. kunkeei, L. leichmannii, L. lindneri, L. malefermentans, L. mail, L. manihotivorans, L. mindensis, L. mucosae, L. murinus, L. nagelii, L. namurensis, L. nantensis, L. oligofermentans, L. oris, L. panis, L. pantheris, L. parabrevis, L. parabuchneri, L. paracollinoides, L. parafarraginis, L. parakefiri, L. paralimentarius, L. paraplantarum, L. pentosus, L. perolens, L. pontis, L. psittaci, L. rennini, L. rimae, L. rogosae, L. rossiae, L. ruminis, L. saerimneri, L. sakei, L. sanfranciscensis, L. satsumensis, L. secaliphilus, L. sharpeae, L. siliginis, L. spicheri, L. suebicus, L. thailandensis, L. ultunensis, L. vaccinostercus, L. vaginalis, L. versmoldensis, L. vini, L. vitulinus, L. zeae и L. zymae.

Примеры Propionibacterium включают, но не ограничиваются ими, Propionibacterium freudenrechli subsp. shermanii (PAB), Propionibacterium acidifaciens, Propionibacterium acidipropionici, Propionibacterium acnes, Propionibacterium australiense, Propionibacterium avidum, Propionibacterium cyclohexanicum, Propionibacterium freudenrelchli subsp. freudenrelchli, Propionibacterium granulosum, Propionibacterium jensenii, Propionibacterium microaerophilum, Propionibacterium propionicum и Propionibacterium thoenii.

В одном варианте осуществления Propionibacterium представляют собой Propionibacterium freudenrechli subsp. shermanii (PAB).

Примеры Bifidobacterium включают, но не ограничиваются ими, Bifidobacterium adolescentis, B. breve, B. longum, B. animalis, B. infantis, B. thermophilum, B. bifidum, Bifidobacterium catenulatum, Bifidobacterium pseudocatenulatum, Bifidobacterium angulatum и B. lactis.

В другом варианте осуществления клетка-хозяин представляет собой Firmicute, например, вид Roseburia, такой как Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis или Roseburia inulinivorans. В одном варианте осуществления клетка-хозяин содержит по меньшей мере одну гетерологичную полинуклеотидную последовательность, кодирующую флагеллин Roseburia. Дополнительно или альтернативно, клетка-хозяин содержит по меньшей мере две копии гомологичной полинуклеотидной последовательности, кодирующей флагеллин Roseburia; например, клетка-хозяин содержит по меньшей мере 3, 4 или 5 гомологичных копии полинуклеотидной последовательности, кодирующей флагеллин Roseburia.

В зависимости от природы нуклеотидной последовательности, кодирующей полипептид по настоящему изобретению, и/или желательности дальнейшей обработки экспрессируемого белка, можно использовать эукариотические хозяева, такие как дрожжи или другие грибы. Как правило, клетки дрожжей предпочтительнее используют среди клеток грибов, поскольку ими легче манипулировать. Однако некоторые белки либо плохо секретируются из дрожжевых клеток, либо в некоторых случаях не процессируются надлежащим образом (например, гипергликозилирование в дрожжах). В этих случаях следует выбирать другой организм гриба, являющийся хозяином.

Применение подходящих клеток-хозяев, таких как клетки-хозяева дрожжей, грибов и растений, может обеспечить посттрансляционные модификации (например, миристоилирование, гликозилирование, укорочение, липидизация и фосфорилирование тирозина, серина или треонина), которые могут потребоваться для сообщения оптимальной биологической активности рекомбинантным продуктам экспрессии по настоящему изобретению.

Клетка-хозяин может представлять собой штамм с дефицитом протеазы или минус-штамм по протеазе. Он, например, может представлять собой штамм с дефицитом протеазы Aspergillus oryzae JaL 125, в котором ген щелочной фосфатазы под названием "alp" удален. Этот штамм описан в WO97/35956.

Термин "клетка-хозяин" не охватывает нативные нуклеотидные кодирующие последовательности в их природной среде, когда они находятся под контролем их нативного промотора, который также находится в его природной среде.

Организм

Термин "организм" в рамках настоящего описания включает любой организм, который может содержать нуклеотидную последовательность, кодирующую полипептид по настоящему изобретению, и/или продукты, полученные из нее, и/или где промотор может обеспечить экспрессию нуклеотидной последовательности согласно настоящему изобретению, когда она присутствует в организме.

Пригодные организмы могут включать бактерию (такую как прокариотическая бактерия), гриб, дрожжевую клетку или растение.

Термин "трансгенный организм" в рамках настоящего описания включает любой организм, который содержит нуклеотидную последовательность, кодирующую полипептид по настоящему изобретению, и/или продукты, получаемые из нее, и/или где промотор может обеспечить экспрессию нуклеотидной последовательности по настоящему изобретению в организме. В одном варианте осуществления нуклеотидная последовательность включена в геном организма.

Термин "трансгенный организм" не охватывает нативные нуклеотидные кодирующие последовательности в их природной среде, когда они находятся под контролем их нативного промотора, который также находится в его природной среде.

Таким образом, трансгенный организм в рамках настоящего описания включает организм, содержащий любой из или комбинации из нуклеотидной последовательности, кодирующей полипептид по настоящему изобретению, конструкций по настоящему изобретению, векторов по настоящему изобретению, плазмид по настоящему изобретению, клеток по настоящему изобретению или их продуктов.

Например, трансгенный организм может содержать нуклеотидную последовательность, кодирующую полипептид по настоящему изобретению (такую как гомологичная нуклеотидная последовательность) под контролем гетерологичного промотора.

Трансформация клеток-хозяев/организма-хозяина

Как указано ранее, организм-хозяин может представлять собой прокариотический или эукариотический организм. Примеры пригодных прокариотических хозяев включают Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, Roseburia inulinivorans, E. coli и Bacillus subtilis.

Способы трансформации прокариотических хозяев широко описаны в данной области, например см. Sambrook et al (Molecular Cloning: A Laboratory Manual, 2nd edition, 1989, Cold Spring Harbor Laboratory Press). Если используют прокариотического хозяина, тогда может быть необходимым, чтобы нуклеотидная последовательность была пригодным образом модифицирована перед трансформацией, например, посредством удаления интронов.

Клетки нитчатых грибов можно трансформировать с использованием различных способов, известных в данной области, таких как способ, вовлекающий формирование и трансформацию протопластов с последующей регенерацией клеточной стенки известным способом. Применение Aspergillus в качестве микроорганизма-хозяина описано в EP 0 238 023.

Другим организмом-хозяином может быть растение. Обзор основных способов, используемых для трансформации растений, может быть найден в статьях Potrykus (Annu Rev Plant Physiol Plant Mol Biol [1991] 42:205-225) и Christou (Agro-Food-Industry Hi-Tech March/April 1994 17-27). Дальнейшее описание трансформации растений может быть найдено в EP-A-0449375.

Общие способы трансформации грибов, дрожжей и растений представлены в последующих разделах.

Трансформированный гриб

Организм-хозяин может представлять собой гриб, такой как плесень. Примеры таких пригодных хозяев включают любого представителя рода Thermomyces, Acremonium, Aspergillus, Penicillium, Mucor, Neurospora, Trichoderma и т.п.

В одном варианте осуществления организм-хозяин может представлять собой нитчатый гриб.

Трансформация нитчатых грибов рассмотрена в US-A-5741665, в которой описаны стандартные способы трансформации нитчатых грибов, и культивирование грибов хорошо известно в данной области. Обширный обзор способов, используемых для N. crassa, описан, например в Davis и de Serres, Methods Enzymol (1971) 17A: 79-143.

Следующие способы, которые также можно использовать для трансформации нитчатых грибов, рассмотрены в US-A-5674707.

Кроме того, экспрессия генов в нитчатых грибах описана в Punt et al. (2002) Trends Biotechnol 2002 May;20(5):200-6, Archer & Peberdy Crit Rev Biotechnol (1997) 17(4):273-306.

Настоящее описание охватывает продуцирование трансгенных нитчатых грибов по настоящему изобретению, полученных с использованием этих стандартных способов.

В одном аспекте организм-хозяин может представлять собой организм-хозяин рода Aspergillus, такой как Aspergillus niger.

Трансгенный Aspergillus по нсатоящему описанию также можно получать, следуя, например, указаниям Turner G. 1994 (Vectors for genetic manipulation. In: Martinelli S.D., Kinghorn J.R.( Editors) Aspergillus: 50 years on. Progress in industrial microbiology vol 29. Elsevier Amsterdam 1994. pp. 641-666).

Трансформированные дрожжи

В другом варианте осуществления трансгенный организм может представлять собой дрожжи.

Обзор принципов экспрессии гетерологичных генов в дрожжах представлен, например, в Methods Mol Biol (1995), 49:341-54, и Curr Opin Biotechnol (1997) Oct;8(5):554-60.

В этом отношении, в качестве носителя для экспрессии гетерологичного гена можно использовать дрожжи, такие как виды Saccharomyces cerevisi или Pichia pastoris (см. FEMS Microbiol Rev (2000 24(1):45-66).

Обзор принципов экспрессии гетерологичных генов в Saccharomyces cerevisiae и секреции продуктов генов приведен в E Hinchcliffe E Kenny (1993, "Yeast as a vehicle for the expression of heterologous genes", Yeasts, Vol 5, Anthony H Rose and J Stuart Harrison, eds, 2nd edition, Academic Press Ltd.).

Для трансформации дрожжей было разработано несколько протоколов трансформации. Например, трансгенные Saccharomyces по настоящему изобретению можно получать, следуя указаниям Hinnen et al., (1978, Proceedings of the National Academy of Sciences of the USA 75, 1929); Beggs, J D (1978, Nature, London, 275, 104); и Ito, H et al (1983, J Bacteriology 153, 163-168).

Селекцию трансформированных клеток дрожжей можно проводить с использованием различных селективных маркеров, таких как ауксотрофные маркеры и доминантные маркеры устойчивости к антибиотикам.

Трансформированные растения/клетки растений

Организм-хозяин, пригодный в рамках настоящего изобретения, может представлять собой растение. В этом отношении, основным принципом конструирования генетически модифицированных растений является встраивание генетической информации в геном растения, чтобы обеспечить стабильное поддержание встроенного генетического материала. Обзор основных способов может быть найден в статьях Potrykus (Annu Rev Plant Physiol Plant Mol Biol [1991] 42:205-225) и Christou (Agro-Food-Industry Hi-Tech March/April 1994 17-27).

Прямое инфицирование тканей растений посредством Agrobacterium является простым способом, который широко используют и который описан в Butcher D.N. et al., (1980), Tissue Culture Methods for Plant Pathologists, eds.: D.S. Ingrams and J.P. Helgeson, 203-208.

Другие способы трансформации растений включают баллистическую трансформацию, способ с карбидом кремния whisker (см. Frame BR, Drayton PR, Bagnaall SV, Lewnau CJ, Bullock WP, Wilson HM, Dunwell JM, Thompson JA & Wang K (1994) Production of fertile transgenic maize plants by silicon carbide whisker-mediated transformation, The Plant Journal 6: 941-948) и способы вирусной трансформации (например см. Meyer P, Heidmann I & Niedenhof I (1992) The use of cassava mosaic virus as a vector system for plants, Gene 110: 213-217).

Следующие способы трансформации растений могут быть найдены в EP-A-0449375.

Клетки растений можно выращивать и поддерживать в соответствии с хорошо известными способами культивирования тканей, например, посредством культивирования клеток в подходящей культуральной среде, дополненной необходимыми факторами роста, такими как аминокислоты, гормоны растений, витамины и т.д.

В следующем аспекте настоящее изобретение относится к векторной системе, которая содержит нуклеотидную последовательность или конструкцию по настоящему изобретению и которая способна вводить нуклеотидную последовательность или конструкцию в геном организма, такого как растение. Векторная система может содержать один вектор, однако она может содержать два вектора. В случае двух векторов векторную систему обычно называют бинарной векторной системой. Бинарные векторные системы описаны более подробно в Gynheung An et al., (1980), Binary Vectors, Plant Molecular Biology Manual A3, 1-19.

В одной широко используемой системе для трансформации клеток растений используется плазмида Ti из Agrobacterium tumefaciens или плазмида Ri из Agrobacterium rhizogenes An et al., (1986), Plant Physiol. 81, 301-305 и Butcher D.N. et al., (1980), Tissue Culture Methods for Plant Pathologists, eds.: D.S. Ingrams и J.P. Helgeson, 203-208. После каждого способа внесения желаемого промотора, или конструкции, или нуклеотидной последовательности по настоящему изобретению в растения, может быть необходимо присутствие и/или встраивание дополнительных последовательностей ДНК. Если, например, для трансформации используют Ti- или Ri-плазмиду клеток растений, то по меньшей мере правая граница, но часто и правая и левая границы T-ДНК Ti- и Ri-плазмиды, в качестве фланкирующих областей внесенных генов могут быть связаны. Применение T-ДНК для трансформации клеток растений широко исследовано и описано в EP-A-120516; Hoekema, in: The Binary Plant Vector System Offset-drukkerij Kanters B.B., Alblasserdam, 1985, Chapter V; Fraley, et al., Crit. Rev. Plant Sci., 4:1-46; и An et al., EMBO J. (1985) 4:277-284.

Культивирование и продукция

Клетки-хозяева, трансформированные нуклеотидной последовательностью по настоящему описанию и/или экспрессирующим вектором по настоящему описанию, можно культивировать в условиях, способствующих продуцированию кодируемого полипептида и способствующих выделению полипептида из клеток и/или культуральной среды.

Среда, используемая для культивирования клеток, может представлять собой любую общепринятую среду, пригодную для выращивания рассматриваемой клетки-хозяина и достижения экспрессии полипептида.

Белок, продуцируемый рекомбинантной клеткой, может экспонироваться на поверхности клетки.

Белок может секретироваться из клеток-хозяев и может быть удобным образом выделен из культуральной среды с использованием хорошо известных способов.

Секреция

В некоторых вариантах осуществления белок секретируется из экспрессирующего хозяина в культуральную среду, из которой белок можно выделять. В соответствии с настоящими изобретением, секреторную лидерную последовательность можно выбирать, исходя из желаемого экспрессирующего хозяина. В контексте настоящего изобретения также можно использовать гибридные сигнальные последовательности.

Типичными примерами гетерологичных секреторных лидерных последовательностей являются последовательности, происходящие из гена амилоглюкозидазы (AG) грибов (glaA - как версия из 18 аминокислот, так и версия из 24 аминокислот, например, из Aspergillus), ген a-фактора (дрожжи, например, Saccharomyces, Kluyveromyces и Hansenula) или ген α-амилазы (Bacillus).

В качестве примера, секреция гетерологичных белков в E. coli рассмотрена в Methods Enzymol (1990) 182:132-43.

Обнаружение

В данной области известны различные протоколы обнаружения и измерения экспрессии аминокислотной последовательности. Примеры включают твердофазный иммуноферментный анализ (ELISA), радиоиммунный анализ (RIA) и сортировку флюоресцентно-активированных клеток (FACS).

Специалистам в данной области известно широкое множество меток и способов конъюгации, и они могут быть использованы в различных анализах нуклеиновых кислот и аминокислот.

Ряд компаний, таких как Pharmacia Biotech (Piscataway, NJ), Promega (Madison, WI), и US Biochemical Corp (Cleveland, OH) поставляют коммерческие наборы и протоколы для этих способов.

Пригодные репортерные молекулы или метки включают радионуклиды, ферменты, флуоресцентные, хемилюминесцентные или хромогенные агенты, а также субстраты, кофакторы, ингибиторы, магнитные частицы и т.п. Патенты, в которых описано применение таких меток, включают US-A-3817837; US-A-3850752; US-A-3939350; US-A-3996345; US-A-4277437; US-A-4275149 и US-A-4366241.

Также рекомбинантные иммуноглобулины можно получать, как показано в US-A-4816567.

Слитые белки

Аминокислотную последовательность для применения в рамках настоящего описания можно продуцировать в качестве слитого белка, например, для облегчения экстракции и очистки. Примеры партнеров для слитого белка включают глутатион-S-трансферазу (GST), 6xHis, GAL4 (ДНК-связывающие домены и/или домены активации транскрипции) и β-галактозидазу. Может быть удобным включение участка протеолитического расщепления между партнером для слитого белка и представляющей интерес белковой последовательностью, чтобы обеспечить удаление последовательностей слитого белка.

Как правило, слитый белок не препятствует активности белковой последовательности.

Системы экспрессии слитых генов в E. coli рассмотрены в Curr Opin Biotechnol (1995) 6(5):501-6.

В другом варианте осуществления аминокислотная последовательность может быть лигирована с гетерологичной последовательностью, чтобы она кодировала слитый белок. Например, для скрининга пептидных библиотек в отношении средств, способных влиять на активность вещества, может быть пригодным кодирование химерного вещества, экспрессирующего гетерологичный эпитоп, который распознается коммерчески доступным антителом.

Кроме того, настоящее изобретение описано с помощью следующих неограничивающих примеров.

ПРИМЕРЫ

При применении на практике настоящего изобретения будут использоваться, если нет иных указаний, общепринятые способы химии, молекулярной биологии, микробиологии, рекомбинантных ДНК и иммунологии, которые входят в пределы способностей специалиста в данной области. Такие способы пояснены в литературе. См., например, J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Books 1-3, Col d Spring Harbor Laboratory Press; Ausubel, F. M. et al. (1995 and periodic supplements; Current Protocols in Molecular Biology, ch. 9, 13, and 16, John Wiley & Sons, New York, N.Y.); B. Roe, J. Crabtree, and A. Kahn, 1996, DNA Isolation and Sequencing: Essential Techniques, John Wiley & Sons; J. M. Polak and James O’D. McGee, 1990, In Situ Hybridization: Principles and Practice; Oxford University Press; M. J. Gait (Editor), 1984, Oligonucleotide Synthesis: A Practical Approach, Irl Press; D. M. J. Lilley and J. E. Dahlberg, 1992, Methods of Enzymology: DNA Structure Part A: Synthesis and Physical Analysis of DNA Methods in Enzymology, Academic Press; and E. M. Shevach and W. Strober, 1992 and periodic supplements, Current Protocols in Immunology, John Wiley & Sons, New York, NY. Каждый из этих общих справочников включен в настоящее описание в качестве ссылки.

Материалы и способы

ФЛАГЕЛЛИНЫ РОДА ROSEBURIA

Разнообразие флагеллинов

Флагеллины из бактерий рода Roseburia, в частности, Roseburia hominis и Roseburia intestinalis, были клонированы, экспрессированы, очищены и проанализированы.

На фиг.B1A и B1B представлен SDS-анализ рекомбинантных флагеллинов.

Номенклатура белков-флагеллинов:

Род Roseburia

Вид Roseburia

Roseburia hominis

FlaA1 Roseburia hominis (его также обозначают в настоящем описании как RhFlaA1 или Rh1)

FlaA2 Roseburia hominis (его также обозначают в настоящем описании как RhFlaA2 или Rh2)

Roseburia intestinalis

FlaA1 Roseburia intestinalis (его также обозначают в настоящем описании как RiFlaA1, или Ri1, или RI1)

FlaA2 Roseburia intestinalis (его также обозначают в настоящем описании как RiFlaA2, или Ri2, или RI2)

FlaA3 Roseburia intestinalis (его также обозначают в настоящем описании как RiFlaA3, или Ri3, или RI3)

FlaA4 Roseburia intestinalis (его также обозначают в настоящем описании как RiFlaA1, или Ri4, или RI4)

См.:

ELY, B., ELY, T.W., CRYMES, W.B.,JR and MINNICH, S.A., 2000. A family of six flagellin genes contributes to the Caulobacter crescentus flagellar filament. Journal of Bacteriology, 182(17), pp. 5001-5004.

IBRAHIM, G.F., FLEET, G.H., LYONS, M.J. and WALKER, R.A., 1985. Method for the isolation of highly purified Salmonella flagellins. Journal of clinical microbiology, 22(6), pp. 1040-1044.

NEVILLE, B.A., FORDE, B.M., CLAESSON, M.J., DARBY, T., COGHLAN, A., NALLY, K., ROSS, R.P. and O'TOOLE, P.W., 2012. Characterization of pro-inflammatory flagellin proteins produced by Lactobacillus ruminis and related motile Lactobacilli. PloS one, 7(7), pp. e40592.

NG, S.Y., CHABAN, B. and JARRELL, K.F., 2006. Archaeal flagella, bacterial flagella and type IV pili: a comparison of genes and posttranslational modifications. Journal of Molecular Microbiology and Biotechnology, 11(3-5), pp. 167-191.

WATSON, R.O. and GALAN, J.E., 2005. Signal transduction in Campylobacter jejuni-induced cytokine production. Cellular microbiology, 7(5), pp. 655-665.

Условия выращивания бактерий

R. hominis A2-183T (=DSM 16839T=NCIMB 14029T) выращивали в анаэробных условиях при 37°C в среде YCFA. Культуру осаждали центрифугированием и осадок ресуспендировали в одном мл среды YCFA, дополненной 2% цистеином (масс./об., Sigma-Aldrich) и 3% аскорбиновой кислотой (масс./об., Sigma-Aldrich).

R. intestinalis L1-82T (=DSM 14610T=NCIMB 13810T) выращивали в анаэробных условиях при 37°C в среде YCFA. Культуру осаждали центрифугированием и осадок ресуспендировали в одном мл среды YCFA, дополненной 2% цистеином (масс./об., Sigma-Aldrich) и 3% аскорбиновой кислотой (масс./об., Sigma-Aldrich).

Мыши

C3H/HeN и C57Bl/6 приобретали от Harlan Laboratories. GF C3H/HeN были предоставлены из и содержались в гнотобиотическом виварии для грызунов INRA в Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France). GF TLR5KO и C57Bl/6 дикого типа были предоставлены Andrew Gewirtz (Center for Inflammation, Immunity, and Infection and Department of Biology, Georgia State University, Atlanta, GA 30303, USA) и их содержали в гнотобиотическом виварии для грызунов INRA в Jouy-en-Josas. Обычные TLR5KO и BOY/J дикого типа были предоставлены Adam Cunningham (MRC Centre for Immune Regulation, Institute of Microbiology and Infection, Division of Immunity and Infection University of Birmingham UK). Организация и методики эксперимента были одобрены соответствующими местными комитетами этической экспертизы.

Эксперименты на животных

Эксперименты на безмикробных животных проводили в гнотобиотическом виварии для грызунов INRA в Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France). Самцов мышей GF C3H/HeN распределяли на контрольную группу (N=8) и группу введения (N=10) и содержали по отдельности в пластмассовых изоляторах. На 0, 1 и 2 сутки животным в группе введения вводили 100 мкл культуры R. hominis через зонд, в то время как контрольным животным вводили 100 мкл среды YCFA. Подвздошную кишку, восходящую ободочную кишку и слепую кишку извлекали на 14 сутки и 28 сутки.

Шести самцам мышей GF C3H/HeN вводили E. coli MG1655 (K12), как описано выше, и по трое животных умерщвляли на 10 сутки и 22 сутки, чтобы получить N=3. Трем мышам GF TLR5KO и трем мышам C57Bl/6 WT инокулировали культуру R. hominis, как описано выше, для оценки функциональной важности флагеллинов R. hominis. Через 28 суток этих животных умерщвляли вместе с их соответствующими животными GF. Двадцати двум самкам мышей C57BL/6 вводили каждые сутки 50 мкл 109 к.о.е. R. hominis в течение 14 суток. Контрольным животным вводили только культуральную среду. Начиная с 8 суток, мышам давали DSS (ММ 50 кДа, 30 г/л) в их питьевой воде в течение 6 суток. Животных умерщвляли на 14 сутки и проводили взятие образцов тканей, как описано выше.

Эксперименты с культурой тканей

Клетки Caco-2 (клетки эпителиальной колоректальной аденокарциномы Homo sapiens) и HT29 (колоректальная аденокарцинома Homo sapiens) выращивали в планшетах в анаэробной рабочей станции. Культуру R. hominis A2-183 или R. intestinalis L1-82T собирали на экспоненциальной фазе и в экспериментальные лунки добавляли 100 мкл бактериальной суспензии (108 к.о.е./мл). Бактериальные (не прикрепляющиеся и прикрепляющиеся) и эукариотические клетки (Caco-2 и HT-29) собирали после инкубации в течение 2 ч и 4 ч и хранили в RNAlater. Для экспериментов по культивированию тканей с рекомбинантными флагеллинами, 5x104 клеток Caco-2 выращивали в 24-ячеечных планшетах при 37°C в 75% увлажненной атмосфере с 5% CO2. Клетки достигали смыкания монослоя на 5-6 сутки и их использовали через трое суток после смыкания монослоя. Клетки инкубировали с рекомбинантными флагеллинами в конечной концентрации 100 нг/мкл в течение 2 ч при 37ºC в 75% увлажненной атмосфере с 5% CO2.

Анализ FISH

Анализы FISH проводили на фиксированных нейтрально забуференным формалином срезах тканей кишечника с использованием общего бактериального зонда Eub338 и вновь сконструированного специфического для R. hominis A2-183 зонда и специфического для R. intestinalis L1-82T зонда.

Конструирование библиотеки R. hominis

Хромосомную ДНК R. hominis для конструирования библиотеки малого размера и пиросеквенирования выделяли с использованием набора UltraClean™ Microbial DNA Isolation Kit (Mo Bio Laboratories Inc) и высокомолекулярную ДНК для фосмидных библиотек выделяли с использованием набора Wizard Genomic DNA Purification kit (Promega).

Анализы на микрочипах

Бактериальный микрочип

Бактериальную РНК выделяли из содержимого слепой кишки мышей и далее обрабатывали с использованием коммерческих наборов в соответствии с рекомендациями изготовителя. Продукты ПЦР, амплифицированные с 6000 клонов библиотеки плазмид R. hominis в E. coli, наносили в двух экземплярах на покрытые аминосиланом предметные стекла (Corning) с использованием MicroGrid II TAS (BioRobotics).

Анализ мышей на микрочипах

Тотальную РНК экстрагировали из ткани подвздошной кишки и восходящей ободочной кишки, преобразовывали в меченную биотином c-РНК/a-РНК (в зависимости от используемого набора Affymetrix), и гибридизовали с чипами GeneChip NuGO Mouse Array и GeneChip Mouse Genome Array (Affymetrix) с использованием стандартных способов. Анализ данных проводили с использованием пакетов программ R (http://www.r-project.org) и Bioconductor (http://www.bioconductor.org).

Анализ способом ОТ-ПЦР

Праймеры, специфические для R. hominis, 5’-CCCACTGACAGAGTATGTAATGTAC-3’ и 5’-GCACCACCTGTCACCAC-3’ использовали для анализа способом ПЦР образцов фекалий для подтверждения уровней колонизации кишечника. Анализ ПЦР в реальном времени проводили с использованием системы 7500 Fast Real-Time PCR System (Applied Biosystems) с использованием основной смеси Power SYBR Green PCR Master Mix (Applied Biosystems). Все образцы анализировали в трех экземплярах. В качестве эталонного гена для нормализации использовали GyrA. Для экспрессии гена в хозяине тотальную эукариотическую РНК, выделенную из подвздошной кишки и восходящей ободочной кишки, подвергали обратной транскрипции в кДНК с использованием набора High Capacity cDNA Reverse Transcription Kit (Applied Biosystems). Анализ ПЦР в реальном времени проводили с использованием системы 7500 Fast Real-Time PCR System (Applied Biosystems) с набором QuantiFast SYBR Green PCR Kit (Qiagen) и QuantiTect Primer Assays (Qiagen). Все образцы анализировали в трех экземплярах. В качестве эталонного гена для нормализации был выбран hprt. Все данные ОТ-ПЦР анализировали в логарифмическом масштабе с основанием 2 с использованием одностороннего ANOVA с порогом значимости P<0,05. Отличия обратно преобразовывали для вычисления кратности изменений.

Вестерн-блоттинг

Подвергнутые иммунной очистки поликлональные антитела кролика против FlaA1 и FlaA2 Roseburia hominis получали, как описано в Duck et al. (Duck et al. 2007). Для вестерн-блоттинга R. hominis выращивали в присутствии различных количеств (от 0,01 г до 1 г корма/10 мл культуры) УФ-облученного стандартного корма для мышей в течение 3 часов, фильтровали для удаления компонентов корма и разбавляли буфером laemmli, содержавшим 8M мочевину. Образцы наносили на гель NuPAGE® Novex® 4-12% Bis-Tris (Invitrogen) и подвергали электрофорезу, а затем обрабатывали с использованием системы WesternBreeze Chromogenic Immunodetection System (Invitrogen). Антитела против FlaA1 и FlaA2 использовали в разведении 1:1000 и антитело против ДНК-гиразы A (Abcam) в качестве нагрузочного контроля использовали в разведении 1:300, после которых использовали конъюгированное с щелочной фосфатазой антитело против антител кролика. Обнаружение проводили по развитию окраски субстрата относительно развития окраски нагрузочного контроля.

Иммунофлуоресценция

Иммунную локализацию флагеллина R. hominis исследовали в содержимом ободочной кишки мышей с использованием специфических антисывороток, индуцированных против определенных пептидных последовательностей как из белка флагеллина FlaA1, так и из белка флагеллина FlaA2. Мазки содержимого кишечника фиксировали в предварительно охлажденном метаноле, инкубировали с антисыворотками кролика против FlaA1 или против FlaA2 (CovaLabs) при 4°C в течение ночи и визуализировали с использованием антител осла против антител кролика с Alexa 488 (Molecular Probes).

T-клеточные маркеры исследовали на последовательных криосрезах толщиной 8 мкм. Фиксированные срезы ткани инкубировали с первичными антителами Ly6G-FITC, CD3-FITC, CD11b-FITC (BD Biosciences) с двойным мечением FoxP3 (Abcam), и CD3-FITC (BD Biosciences) или изоспецифическим IgG. Срезы подвергали контрастному окрашиванию посредством DAPI и заливали Vectashield (Vector Laboratories). Для количественного определения положительных клеток исследовали минимум пять полей зрения для каждого среза мыши.

Клонирование и очистка рекомбинантных флагеллинов

Гены флагеллинов выделяли из жидких бактериальных культур R. hominis, R. intestinalis, S. typhimurium, S. enteritidis, Eubacterium rectale 33656 и E. coli K12 посредством амплификации способом ПЦР и очистки. Клетки Caco-2 инкубировали с рекомбинантными флагеллинами при конечной концентрации 100 нг/мкл в течение 2 ч при 37°C в 75% увлажненной атмосфере из 5% CO2.

Выделение клеток тонкого кишечника и клеток MLN

Клетки выделяли из тонкого кишечника и брыжеечного лимфатического узла, как описано ранее, с незначительными модификациями (Monteleone et al. 2008). В кратком изложении, суспензии клеток инкубировали с 100 Е/мл коллагеназы VIII (Sigma-Aldrich) в RPMI, дополненной 20% FBS, при 37oC в течение 20 мин (брыжеечные лимфатические узлы) или 1 часа (фрагменты тонкого кишечника). Затем суспензии единичных клеток анализировали проточной цитометрией (как описано).

Получение происходящих из костного мозга дендритных клеток и культур

Костный мозг извлекали из бедренной и большеберцовой кости мышей C3H/HeN и C57Bl6. Для полученных с помощью GMCSF дендритных клеток клетки костного мозга ресуспендировали при 1x106/мл в RPMI, дополненной 10% FCS и 20 нг/мл rmGM-CSF и высевали в количестве 10 мл/планшет в 100-мм2 планшетах для культивирования тканей. После культивирования в течение трех суток неплотно прикрепившиеся клетки собирали и пересевали в среду, дополненную GM-CSF, в количестве 1x106/мл в 12-луночных планшетах для культивирования тканей. На 5 сутки клетки стимулировали 100 нг/мл флагеллинов, а затем на 6 сутки собирали. Для полученных с помощью Flt3L дендритных клеток, клетки костного мозга ресуспендировали в количестве 2x106/мл в RPMI, дополненной 10% FCS и 200 нг/мл rmFlt3, и высевали в количестве 2 мл/лунка в 12-луночные планшеты для культивирования тканей. Клетки культивировали в течение 10 суток причем в каждую лунку добавляли среду, дополненную Flt3, на 4 сутки. На 9 сутки клетки стимулировали посредством 100 нг/мл флагеллинов, а затем собирали на 10 сутки и анализировали проточной цитометрией.

Проточная цитометрия

Суспензии единичных клеток собственной пластинки и дендритных клеток инкубировали в блокирующем буфере (содержавшем сыворотку и антитело против CD16/CD32) при 4oC в течение 15 мин, а затем окрашивали специфическими конъюгированными с флуорохромом антителами. Клетки собственной пластинки метили антителами к белкам мыши: CD4-FITC и CD25-APC (eBioscience), CD8-APC-Cy7 и CD3-PerCP (Biolegend), и B220-BV570 (BD Biosciences). Внутриклеточное мечение FoxP3 проводили после внеклеточного окрашивания и фиксации/увеличения проницаемости клеток в соответствии с инструкциями изготовителя (eBioscience). Полученные с помощью GMCSF дендритные клетки метили антителами CD11c-PE-Cy7, CD11-PerCP Cy5, I-A/I-E -APC-Cy7, CD80-PE, CD86-APC, CD8-FITC, B220-BV570. Полученные с помощью Flt3 дендритные клетки метили посредством CD11c-PE-Cy7-, CD11b- или Siglec-H-PerCP Cy5-, I-A/I-E -APC-Cy7, CD317 -PE, CD40-APC, CD103-FITC, B220-BV570. Клетки анализировали с использованием программного обеспечения FACSArria (BD Biosciences) и FlowJo версии 7.2.5.

Цитометрическая гранульная матрица (CBA)

Клетки костного мозга выделяли из бедренной и большеберцовой кости мышей C3H/HeN и C57Bl/6 с использованием среды RPMI и увеличивали в количестве с помощью Flt3L, как описано выше. Клетки стимулировали 100 нг/мл флагеллина (например флагеллин Roseburia) после культивирования в течение 9 суток, и супернатант собирали на 10 сутки. Эксперимент проводили три раза для получения N=3.

Анализ CBA проводили на клеточных супернатантах с использованием набора Cytometric Bead Array Mouse Enhanced Sensitivity Master Buffer Kit (BD Biosciences). Стандарты и образцы наносили в 96-луночный планшет для измерения в FACSArray (BD Biosciences). Результаты анализировали с использованием программного обеспечения BD FCAP (BD Biosciences).

Гистология

Образцы ткани восходящей ободочной кишки фиксировали в нейтрально-забуференном формалине (Sigma), заключенном в смолу холодного отверждения, и 4-мкм срезы тканей окрашивали с использованием стаднартных способов гематоксилина/эозина. Область полного поперечного сечения ободочной кишки каждого животного визуализировали при увеличении x200 на микроскопе Zeiss Axioskop с использованием камеры QImaging, контролируемой программным обеспечением Image Pro Plus. Затем каждое поле зрения оценивали в диапазоне 0-4 согласно способу на основе Berg et al. (Berg et al. 1996). Средний процент полей зрения с данной степенью вычисляли и группы введения сравнивали с использованием t-критерия Стьюдента.

Следующие детальные протоколы описаны в дополнительных материалах и способах.

Дополнительная информация (SI). Материалы и способы

Условия роста бактерий

R. hominis A2-183T (=DSM 16839T=NCIMB 14029T) выращивали в анаэробных условиях на синтетической среде YCFA или комплексной среде M2GSC. Культуру инокулировали из замороженного исходного раствора в пробирки Hungate и инкубировали в течение ночи при 37°C. Затем бактерии выращивали на чашках с агаром M2GSC в течение 48 ч в анаэробной рабочей станции MACS-MG-1000 (Don Whitley Scientific) при 80% N2, 10% CO2, и 10% H2 при 37°C. Эффект муцина исследовали посредством добавления 0,5% (масс./об.) муцина типа III из желудка свиньи (Sigma-Aldrich) в среду YCFA.

Для колонизации безмикробных (GF) мышей R. hominis выращивали в среде YCFA в течение ночи при 37°C. Культуру осаждали центрифугированием и осадок ресуспендировали в одном мл среды YCFA, дополненной 2% цистеином (масс./об., Sigma-Aldrich) и 3% аскорбиновой кислотой (масс./об., Sigma-Aldrich).

Мыши

C3H/HeN и C57Bl/6 приобретали от Harlan Laboratories. Мышей содержали в изоляторах из гибкого пленочного материала с фильтрацией HEPA (Bell Isolation Systems) в University of Aberdeen. GF C3H/HeN были предоставлены из и содержались в гнотобиотическом виварии для грызунов INRA в Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France). Без микробные TLR5KO и C57Bl/6 дикого типа были предоставлены Andrew Gewirtz (Center for Inflammation, Immunity, and Infection and Department of Biology, Georgia State University, Atlanta, GA 30303, USA) и их содержали в гнотобиотическом виварии для грызунов INRA в Jouy-en-Josas. Организация и методики эксперимента были одобрены соответствующими местными комитетами этической экспертизы.

Эксперименты на животных

Восемнадцать самцов мышей GF C3H/HeN распределяли в группу контроля (N=8) и введения (N=10) и содержали по отдельности в пластмассовых изоляторах в пластмассовых изоляторах. Мышей кормили без ограничений стерилизованным коммерческим кормом (R03-40; UAR). На 0, 1 и 2 сутки животным в группе введения вводили 100 мкл культуры R. hominis через зонд, в то время как контрольным животным вводили 100 мкл среды YCFA. На 14 сутки и 28 сутки, четырех контрольных животных и пять животных, которым вводили R. hominis, умерщвляли. Подвздошную кишку и восходящую ободочную кишку разделяли на четыре разных части и переносили в RNAlater (Ambion), нейтрально забуференный формалин (NBF; Sigma-Aldrich) или жидкий азот. Всю слепую кишку переносили в RNAlater.

Чтобы продемонстрировать специфичность ответа на R. hominis, шести самцам мышей GF C3H/HeN вводили E. coli MG1655 (K12), и трех животных умерщвляли на 10 сутки и 22 сутки, как описано выше, с получением N=3.

Трем мышам GF TLR5KO и трем мышам C57Bl/6 WT инокулировали культуру R. hominis, как описано выше, для оценки функциональной значимости флагеллинов R. hominis. Через 28 суток этих животных умерщвляли вместе с соответствующими им мышами GF.

Двадцать две самки мышей C57BL/6 (в возрасте 6 недель) использовали для оценки терапевтического эффекта R. hominis в процессе индуцируемого DSS колита. После периода акклиматизации 7-10 суток мышам вводили 50 мкл 109 к.о.е. R. hominis в течение 14 суток. Контрольным животным вводили только культуральную среду. Начиная с 8 суток, мышам вводили DSS (ММ 50 кДа, 30 г/л) в их питьевой воде в течение 6 суток. Животных умерщвляли на 14 сутки и проводили взятие образцов тканей, как описано выше.

Эксперименты с культурой тканей

Все реагенты для культивирования клеток, если нет иных указаний, были предоставлены Sigma-Aldrich. Для этих экспериментов с культивированием в анаэробных условиях 2x105 клеток Caco-2 или HT29 в 1,5 мл среды DMEM (высокое содержание глюкозы, HEPES), дополненной инактивированной нагреванием эмбриональной телячьей сывороткой (Gibco), пенициллином, стрептомицином, амфотерицином B и L-глутамином, высевали в верхние отделения шестиячеечного планшета Transwell (Corning). Нижние отделения содержали 3,0 мл той же среды. Клетки инкубировали при 37°C в атмосфере с 5% CO2 в течение трех суток после смыкания монослоя, промывали раствором Хэнкса для удаления антибиотиков и FCS и опускали в DMEM, дополненную L-глутамином, селенитом натрия и трансферрином, на 24 ч без антибиотиков. Затем вставки планшетов Transwell переносили в бокс для анаэробного культивирования в анаэробной рабочей станции при 37°C. Верхнее отделение каждого вкладыша было заполнено анаэробной клеточной средой DMEM, в то время как нижнее отделение было заполнено оксигенированной DMEM.

Культуру R. hominis A2-183 собирали на экспоненциальной фазе посредством центрифугирования при 3500x g в течение 5 мин. Осадок промывали и ресуспендировали в 0,8 мл анаэробной DMEM. Сто микролитров бактериальной суспензии (108 CFU/мл) добавляли в экспериментальные лунки. В контрольные лунки добавляли то же количество среды без бактериальных клеток. Дополнительные контроли включали бактериальные клетки, инкубированные без клеток Caco-2 или HT29. Бактериальные и эукариотические клетки собирали через 2 ч и 4 ч после инкубации. Как не прикрепившиеся, так и прикрепившиеся, бактерии аспирировали в RNAlater (Ambion). Жизнеспособность клеток R. hominis исследовали посредством посева на планшеты с YCFA. Клетки Caco-2 или клетки HT-29 собирали из лунок и также хранили в RNAlater.

Культуру R. intestinalis L1-82T (=DSM 14610T=NCIMB 13810T) собирали на экспоненциальной фазе посредством центрифугирования при 3500x g в течение 5 мин. Осадок промывали и ресуспендировали в 0,8 мл анаэробной DMEM. В экспериментальные лунки добавляли сто микролитров бактериальной суспензии (108 к.о.е./мл). В контрольные лунки добавляли то же количество среды без бактериальных клеток. Дополнительные контроли включали бактериальные клетки, инкубированные без клеток Caco-2 или HT29. Бактериальные и эукариотические клетки собирали после инкубации в течение 2 ч и 4 ч. Как не прикрепившиеся, так и прикрепившиеся, бактерии аспирировали и хранили в RNAlater (Ambion). Жизнеспособность клеток R. intestinalis исследовали посредством посева на планшеты с YCFA. Клетки Caco-2 или клетки HT-29 собирали из лунок и также хранили в RNAlater.

Для экспериментов по культивированию тканей с рекомбинантными флагеллинами, 5x104 клеток Caco-2 высевали в 24-луночные планшеты в среду DMEM (высокое содержание глюкозы, HEPES), дополненную инактивированной нагреванием эмбриональной телячьей сывороткой (Gibco), пенициллином, стрептомицином, амфотерицином B и L-глутамином при 37°C в 75% увлажненной атмосфере с 5% CO2. Клетки достигали смыкания монослоя на 5-6 сутки и их использовали через 3 суток после смыкания монослоя. Перед какой-либо обработкой клетки промывали два раза сбалансированным солевым раствором Хэнкса и держали в DMEM, дополненной L-глутамином, селеном и трансферрином, в течение 24 часов.

Конструирование библиотеки R. hominis

Хромосомную ДНК R. hominis малого размера и пиросеквенирования выделяли с использованием набора UltraClean™ Microbial DNA Isolation Kit (Mo Bio Laboratories Inc) и высокомолекулярную ДНК для фосмидных библиотек выделяли с использованием набора Wizard Genomic DNA Purification Kit (Promega). Целостность ДНК подтверждали гель-электрофорезом.

ДНК механически расщепляли с использованием Nebulizer Kit (Invitrogen) и фракционировали гель-электрофорезом. Фрагменты ДНК желаемого размера вырезали из геля и очищали с использованием Wizard® SV Gel и PCR Clean-Up System (Promega). Репарацию концов провдили с использованием набора DNA Terminator End Repair Kit (Lucigen). Фрагменты размером 1,5-3,5 т.п.н. клонировали с использованием набора CloneSmart® LCAmp Kit (Lucigen) и библиотеку размером 4-8 т.п.н. конструировали с использованием pJAZZO®-C Vector (Lucigen). Фосмидные библиотеки конструировали с использованием набора CopyControl™ Fosmid Library Production Kit (Epicentre Biotechnologies). Колонии отбирали с использованием автоматизированного устройства для сбора колоний (BioRobotics BioPick, Genomic Solutions) и сохраняли в 384-луночных микропланшетах для титрования, содержавших 70 мкл 2x среды LB, дополненной 10% глицерином и соответствующим антибиотиком. Клетки выращивали в течение ночи при 37ºC при встряхивании и хранили при -80ºC.

Секвенирование, сборка и аннотирование

Матрицы для секвенирования библиотек малого размера получали способом ПЦР с использованием одного мкл биомассы клонов и праймеров SL1 и SR2, окружающих участок клонирования pSMART-LCAmp. Продукты ПЦР очищали с использованием фильтрационных планшетов Multiscreen PCR Clean-up filter plates (Millipore). Рекомбинантную ДНК из клонов pJAZZ®-OC выделяли с использованием системы для очистки плазмидной ДНК Wizard® SV 96 (Promega). Фосмидную ДНК выделяли с использованием набора для очистки ДНК FosmidMAX™ (Epicentre). Данные концевого считывания фрагментов ДНК из библиотек R. hominis WGS с различными размерами вставок получали с использованием ДНК-секвенаторов CEQ8000 (Beckman Coulter) и ABI 3770 (Applied Biosystems). Геномную ДНК из R. hominis также секвенировали с использованием секвенаторов 454 GS20 (454 Life Sciences) и 454 FLX (Roche). Данные секвенирования по методу Сэнгера и данные секвенирования с использованием 454 получали с помощью MIRA версии 3 (http://chevreux.org/projects_mira.html; (1)). Информационный канал для аннотирования RAST (http://rast.nmpdr.org; (2)) использовали для автоматизированного и ручного аннотирования генома и для сравнительных геномных анализов. Аннотированная геномная последовательность R. hominis A2-183 была представлена в GenBank под номером доступа CP003040.

Анализ на микрочипах

Бактериальный микрочип

Бактериальную РНК выделяли из содержимого слепой кишки мышей с использованием набора RNeasy Mini Kit (Qiagen), и далее обрабатывали с использованием набора MICROBEnrich™ Kit (Ambion), набора MICROBExpress™ Bacterial mRNA Enrichment Kit (Ambion) и набора MessageAmp™ II-Bacteria RNA Amplification Kit (Applied Biosystems). РНК метили либо dCTP-Cy3, либо dCTP-Cy5 в процессе синтеза кДНК (набор CyScribe First Strand cDNA Labelling Kit; Amersham). Меченные продукты очищали с использованием набора для очистки CyScribe GFX Purification Kit (Amersham). Продукты ПЦР, амплифицированные с 6000 клонов библиотеки плазмид R. hominis RA8 в E. coli, наносили в двух экземплярах на покрытые аминосиланом предметные стекла (Corning) с использованием a MicroGrid II TAS (BioRobotics). Амплифицированные фрагменты генов домашнего хозяйства rpoD и gyrA случайным образом распределяли на матрицы в качестве контролей. Гибридизацию микрочипов проводили на станции для гибридизации GeneTAC (Genomic Solutions). Краситель для мечения заменяли для второй гибридизации, и отдельно очищенную РНК также метили и гибридизовали два раза, чтобы убедиться в воспроизводимости и получить статистически значимые результаты. Всего четыре предметных стекла подвергали гибридизации для каждого сравнения всего с 12 точками гибридизации на амплифицированный клон. Флуоресценцию измеряли в двух каналах с использованием GeneTAC LS IV (Genomic Solutions) с использованием программного обеспечения GeneTac Integrator версии 3.0.1. Интенсивность пятен подвергали логарифмическому преобразованию и использовали нормализацию Loess для устранений отличий в мечении зонда и эффективности гибридизации. Одновыборочный t-критерий использовали для величин лолгарифмического соотношения для исследования дифференциальной экспрессии. Данные считали значимыми, когда кратность изменения >2 и P<0,05.

Анализ мышей на микрочипах

Ткань подвздошной кишки и восходящей ободочной кишки извлекали из RNAlater и лизировали в Trizol (Invitrogen). РНК выделяли с использованием стандартных стадий с хлороформом/изопропанолом. Тотальную РНК далее очищали с использованием набора RNeasy Kit (Qiagen), включая стадию расщепления свободной от РНК-аз ДНК-азы I (Qiagen). Целостность РНК определяли с использованием Agilent 2100 Bioanalyzer (Agilent Technologies). Тотальную РНК преобразовывали в меченную биотином кДНК с использованием набора One-Cycle Target Labeling Kit (Affymetrix) или меченной биотином a-РНК с использованием набора 3' IVT Express Kit (Affymetrix). Гибридизацию с GeneChip NuGO Mouse Array и GeneChip Mouse Genome Array (Affymetrix) на GeneChip Fluidics Station 450 (Affymetrix) проводили в Institute of Medical Sciences Microarray Core Facility (University of Aberdeen, UK). Чипы сканировали с использованием Affymetrix GeneChip Scanner 3000 (Affymetrix). Анализ качества изображений проводили с использованием программного обеспечения Gene Chip Operating Software (GCOS) (Affymetrix). Следующий анализ данных проводили с использованием свободно доступных пакетов программ R (http://www.r-project.org) и Bioconductor (http://www.bioconductor.org). Модерируемый F-критерий, предоставляемый пакетом программ limma от Bioconductor, использовали для исследования дифференциальной экспрессии. Данные считали значимыми при P<0,05 с использованием способа определения ложноположительных результатов Benjamini и Hochberg. Статистический анализ проводили по отдельности для каждого из двух моментов времени. Все дифференциально экспрессируемые гены (P<0,05) импортировали в аналитическое программное обеспечение MetaCore (GeneGo, St Joseph, MI) для получения карт каскадов. Интегрированный анализ усиления каскадов проводили с использованием основанных на знаниях канонических каскадов и эндогенных метаболических каскадов. Ранжирование соответствующих интегрированных каскадов было основано на значениях P, вычисленных с использованием гипергеометрического распределения. Значения P соответствовали вероятности данного ряда генов из списка ввода, что они соответствуют определенному ряду генов в карте случайным образом, рассматривая ряды генов в эксперименте против рядов генов в карте в полном наборе генов на картах.

Функциональную интерпретацию данных на основе онтологии генов (GO) проводили с использованием DAVID (http://david.abcc.ncifcrf.gov), расширенной версии оригинальной доступной через Интернет программы (3). Значимо отличающиеся транскрипты (P<0,05) относили к категории GO "Биологический процесс" для выявления профилей экспрессии генов, значительно усиленных для определенных условий GO.

Данные микрочипов предоставляли в Gene Expression Omnibus в National Center for Biotechnology Information (NCBI) (номер доступа GSE25544; http://www.ncbi.nlm.nih.gov/geo).

Анализ способом ОТ-ПЦР

Праймеры, специфические для R. hominis, 5’-CCCACTGACAGAGTATGTAATGTAC-3’ и 5’-GCACCACCTGTCACCAC-3’ использовали для полуколичественного анализа и анализа способом ПЦР в реальном времени образцов фекалий для подтверждения уровней колонизации кишечника. Кроме того, праймеры для ПЦР для бактерий конструировали с использованием доступного через Интернет инструмента Primer3Plus (4) и приобретали от Sigma-Aldrich. Анализ способом ПЦР в реальном времени проводили с использованием системы 7500 Fast Real-Time PCR System (Applied Biosystems) со смесью Power SYBR Green PCR Master Mix (Applied Biosystems). ПЦР проводили следующим образом: один цикл при 95°C в течение 10 мин, а затем 40 циклов при 95°C в течение 15 с и 60°C в течение 1 мин, завершая стадией диссоциации. Все образцы анализировали в трех экземплярах. GyrA использовали в качестве эталонного гена для нормализации вследствие его низкого варьирования между образцами.

Для экспрессии генов хозяина, 2 мкг тотальной эукариотической РНК, выделенной из подвздошной кишки и восходящей ободочной кишки, подвергали обратной транскрипции в кДНК с использованием High Capacity cDNA Reverse Транскрипция Kit (Applied Biosystems) со случайными праймерами. Анализ ПЦР в реальном времени проводили с использованием системы 7500 Fast Real-Time PCR System (Applied Biosystems) с набором QuantiFast SYBR Green ПЦР Kit (Qiagen) и QuantiTect Primer Assays (Qiagen). Условия проведения циклов ПЦР были следующими: один цикл при 95°C в течение 5 мин, а затем 40 циклов при 95°C в течение 10 секунд и 60°C в течение 30 секунд, оканчивающихся стадией диссоциации. Все образцы анализировали в трех экземплярах. В качестве эталонного гена для нормализации был выбран hprt, вследствие его низкого варьирования между образцами.

Все данные ОТ-ПЦР анализировали в логарифмическом масштабе с основанием 2 с использованием одностороннего ANOVA с порогом значимости P<0,05. Отличия обратно преобразовывали для вычисления кратности изменений.

Вестерн-блоттинг

Подвергнутые иммунной очистки поликлональные антитела кролика против FlaA1 и FlaA2 Roseburia hominis получали, как описано в Duck et al. (5). В кратком изложении, самок новозеландских белых кроликов иммунизировали синтетическим пептидом в полном адъювант Фрейнда и подвергали усиливающей иммунизации несколько раз. Для Fla1 R. hominis, использовали пептид NH2-CRSQVRGLNKASDNA-CONH2 и пептид NH2-IDGNFTSKKLQVGSLC-COOH, в то время как для R. hominis Fla2 использовали пептид C-AQYNDDAKSVLEILK-COOH и пептид C-GLNKASRNSQDGIS-CONH2. После иммунизации антитела очищали на иммуноаффинной колонке, полученной связыванием пептидов с 1 мл активированных гранул сефарозы.

Для вестерн-блоттинга R. hominis выращивали в присутствии различных количеств (от 0,01 г до 1 г корма/10 мл культуры) УФ-облученного стандартного корма для мышей в течение 3 часов, фильтровали для удаления компонентов корма и разбавляли буфером laemmli, содержавшим 8M мочевину. Тридцать мкл каждого образца наносили в лунки геля NuPAGE® Novex® 4-12% Bis-Tris (Invitrogen) и подвергали электрофорезу, а затем обрабатывали с использованием системы WesternBreeze Chromogenic Immunodetection System (Invitrogen). Антитела против FlaA1 и FlaA2 разбавляли 1:1000 и антитело против ДНК-гиразы A (Abcam) в качестве нагрузочного контроля разбавляли 1:300 в разбавителе для антител и инкубировали в течение ночи при 4°C, а затем 1 ч при комнатной температуре с конъюгированным с щелочной фосфатазой антителом против антител кролика. Обнаружение проводили по развитию окраски субстрата относительно развития окраски нагрузочного контроля.

Анализ FISH

Ткани, фиксированные в нейтрально забуференном формалине, заключали в Technovit 8100 (Heraeus Kulzer). Получали срезы размером два микрометра с использованием ротационного микротома (Leica/Reichert Autocut). Получали три среза на предметное стекло на глубине 100 мкм, 200 мкм и 300 мкм в ткани с получением девяти срезов на животное.

Предметные стекла дегидратировали посредством последовательных инкубаций в 50% (об./об.), 80% и 96% этаноле и сушили при комнатной температуре (RT). Использованные зонды FISH для 16S рРНК представляли собой общий бактериальный зонд Eub338 (GCTGCCTCCCGTAGGAGT; Cy3) и вновь сконструированный специфический зонд A2-183 R. hominis (GTACATTACATACTCTGTCAGTG; FITC), которые тщательно исследовали в отношении специфичности против панели изолятов бактерий кишечника. Десять микролитров зонда (30 нг/мкл) в 100 мкл буфера для гибридизации наносили на дегидратированный образец и инкубировали при специфической для зонда температуре. Предметные стекла промывали в промывочном буфере при 50˚C в течение 30 мин, погружали в ледяную воду для удаления остаточного буфера и сушили потоком сжатого воздуха. Контрастное окрашивание проводили с использованием 4’,6-диамидино-2-фенилиндола(DAPI; Vector Laboratories Inc) и предметные стекла заливали средой для заливки Vectashield для флуоресценции (Vector Laboratories Inc) для предотвращения выцветания. Бактерии визуализировали с использованием флуоресцентного микроскопа Leica DM RBE (Leitz GMBH) и фотографировали с помощью камеры Penguin 600CL (Pixera) и программного обеспечения Viewfinder 3.0 (Studio Lite). Изображения с высоким увеличением (x630) получали с использованием системы Apochromatics (Leica).

Иммунофлуоресценция

Иммунную локализацию флагеллина R. hominis исследовали в содержимом ободочной кишки мышей, колонизированных R. hominis, с использованием специфических антисывороток, индуцированных против определенных пептидных последовательностей как из белка флагеллина FlaA1, так и из белка флагеллина FlaA2. Содержимое кишечника разбавляли в PBS, наносили на предметные стекла и сушили воздухом. Мазки фиксировали в предварительно охлажденном метаноле в течение 5 мин при -20°C, инкубировали с антисыворотками кролика против FlaA1 или против FlaA2 (1:125, CovaLabs) при 4°C в течение ночи и визуализировали с использованием антител осла против антител кролика с Alexa 488 (1:1000, Molecular Probes).

Срезы фиксировали заранее охлажденным метанолом в течение 30 мин при -20ºC. Иммунную локализацию T-клеточных маркеров исследовали на последовательных криостатных срезах (8 мкм). Срезы фиксировали либо заранее охлажденным метанолом в течение 30 мин при -20ºC (Ly6G FITC, CD3 FITC, CD11b FITC, все при 1:50 (BD Biosciences)), либо для FoxP3 с двойным окрашиванием (1:500, Abcam) CD3 FITC (1:100, BD Biosciences)), фиксировали 1% параформальдегидом (PFA) в течение 2 мин при RT, а затем в течение 3 мин в 0,01% Triton X в PBS. Все срезы блокировали 10% BSA (Sigma), содержавшим 10% соответствующие доиммунные сыворотки в PBS (pH 7,4). Фиксированные метанолом ткани инкубировали с первичными антителами в течение 1 ч при RT. Фиксированные PFA срезы инкубировали с антителами в течение ночи при 4°C. FoxP3 визуализировали с использованием антител козы против антител кролика Alexa 594 (1:1000, Molecular Probes). Срезы подвергали контрастному мечению посредством DAPI и заливали Vectashield (Vector Laboratories). Для количественного определения положительных клеток исследовали минимум пять полей зрения для каждого среза мыши с использованием программного обеспечения и настроек микроскопа, описанных выше.

Гистология

Образцы ткани восходящей ободочной кишки фиксировали в нейтрально-забуференном формалине (Sigma) при комнатной температуре при постоянном встряхивании. Образцы ополаскивали PBS, а затем переносили в 70% этанол и хранили при комнатной температуре, а затем ориентировали для получения поперечных срезов и погружали в смолу холодного отверждения с использованием Technovit 8100 (Heraeus Kulzer) в соответствии с инструкциями изготовителя. Залитую ткань помещали на Histoblocs с использованием Technovit 3040 (Heraeus Kulzer). Срезы размером четыре микрометра нарезали с использованием ротационного микротома (Leica Autocut), оборудованного стеклянным ножом (TAAB Laboratories Equipment Ltd.). Срезы тканей окрашивали с использованием стандартных способов с гематоксилином/эозином. Область полного поперечного сечения восходящей ободочной кишки каждого животного визуализировали при увеличении x200 на микроскопе Zeiss Axioskop с использованием камеры QImaging, контролируемой программным обеспечением Image Pro Plus. Затем каждое поле зрение оценивали в диапазоне 0-4 согласно способу на основе Berg et al. (6). Показатели гистопатологии составляли 0 = мелкие крипты, отсутствие или мало инфильтрирующих клеток, интактный эпителий, бокаловидные клетки выглядят заполненными муцином (без патологии); 1 = крипты могут проявлять небольшую гиперплазию эпителиальных клеток, между криптами могут наблюдаться некоторые диффузные инфильтрирующие воспалительные клетки, эпителий просвета выглядит интактным, бокаловидные клетки могут выглядеть несколько обедненными муцином; 2 = крипты выглядят более глубокими с отчетливыми признаками гиперплазии эпителия, обеднения бокаловидных клеток муцином, явными инфильтрирующими воспалительными клетками, которые могут быть многоочаговыми по своей природе, хотя инфильтраты не наблюдаются в подслизистой оболочке; 3 = очаги повреждения вовлекают площадь слизистой оболочки большего размера и /или являются боле частыми, чем наблюдается при степени 2. Очаги повреждения не вовлекают подслизистую оболочку. Эпителиальные клетки просвета проявляют небольшие эрозии. Очаги повреждения не являются трансмуральными; 4 = Эпителий крипт выглядит разрушенным. Могут присутствовать абсцессы. Клетки эпителия просвета выглядят нерегулярными, иногда полностью утрачиваются. Наблюдают трансмуральный инфильтрат, часто ассоциированный с полной утратой эпителиальных клеток в просвет.

Средний процент полей зрения с данной степенью вычисляли и группы введения сравнивали с использованием t-критерия Стьюдента.

Клонирование и очистка рекомбинантных флагеллинов

Гены флагеллинов выделяли из жидких бактериальных культур R. hominis, R. intestinalis, S. typhimurium, S. enteritidis, Eubacterium rectale 33656 и E. coli K12 посредством амплификации способом ПЦР и очистки. Очищенный фрагмент флагеллина из R. hominis встраивали в экспрессирующий вектор pT7-MAT-Tag-FLAG (Sigma) и фрагменты флагеллина из S. enteritidis и E. coli K12 встраивали в экспрессирующий вектор pGEX-6P-1 (GE Healthcare). Рекомбинантный флагеллин экспрессировали посредством трансформации плазмидной ДНК в клетки E. coli BL21 Rosetta и E. coli BL21 (DE3), соответственно, и индукции посредством 1 мМ IPTG (изопропил b-D-галактозидаза). Флагеллины выделяли из клеточных лизатов с использованием гранул FLAG (Sigma) и гранул Ni-NTA (никель-нитрилоуксусная кислота) (Clontech, Takara) в соответствии с инструкциями изготовителя. Чистоту препарата оценивали посредством SDS-PAGE с окрашиванием раствором кумасси синим. Активность фрагментов флагеллинов определяли с использованием люциферазного анализа (Promega) в соответствии с инструкциями изготовителя с использованием клеточной линии Caco-2 с трансформированным NF-κB.

Клетки Caco-2 инкубировали с рекомбинантными флагеллинами при конечной концентрации 100 нг/мкл в течение 2 ч при 37°C в 75% увлажненной атмосфере из 5% CO2. После обработки клетки промывали раствором PBS два раза и собирали для выделения тотальной РНК.

Выделение клеток тонкого кишечника и клеток MLN

Клетки выделяли из тонкого кишечника и брыжеечного лимфатического узла, как описано ранее, с незначительными модификациями (7). В кратком изложении, суспензии клеток инкубировали с 100 Е/мл коллагеназы VIII (Sigma-Aldrich) в RPMI, дополненной 20% FBS, при 37oC в течение 20 мин (брыжеечные лимфатические узлы) или 1 часа (фрагменты тонкого кишечника). Затем суспензии единичных клеток анализировали проточной цитометрией (как описано).

Получение происходящих из костного мозга дендритных клеток и культур

Костный мозг извлекали из бедренной и большеберцовой кости мышей C3H/HeN и C57Bl6, как описано ранее (8-11). Для полученных с помощью GMCSF дендритных клеток клетки костного мозга ресуспендировали при 1x106/мл в RPMI, дополненной 10% FCS и 20 нг/мл rmGM-CSF и высевали в количестве 10 мл/планшет в 100-мм2 планшетах для культивирования тканей. После культивирования в течение трех суток неплотно прикрепившиеся клетки собирали и пересевали в среду, дополненную GM-CSF, в количестве 1x106/мл в 12-луночных планшетах для культивирования тканей. На 5 сутки клетки стимулировали 100 нг/мл флагеллинов, а затем на 6 сутки собирали. Для полученных с помощью Flt3L дендритных клеток, клетки костного мозга ресуспендировали в количестве 2x106/мл в RPMI, дополненной 10% FCS и 200 нг/мл rmFlt3, и высевали в количестве 2 мл/лунка в 12-луночные планшеты для культивирования тканей. Клетки культивировали в течение 10 суток причем в каждую лунку добавляли среду, дополненную Flt3, на 4 сутки. На 9 сутки клетки стимулировали посредством 100 нг/мл флагеллинов, а затем собирали на 10 сутки. Клетки собирали с планшетов осторожным пипетированием и анализировали проточной цитометрией.

Проточная цитометрия

Суспензии единичных клеток собственной пластинки и дендритных клеток брыжеечного лимфатического узла инкубировали в блокирующем буфере (содержавшем сыворотку и антитело против CD16/CD32) при 4oC в течение 15 мин, а затем окрашивали специфическими конъюгированными с флуорохромом антителами. Клетки собственной пластинки метили антителами к белкам мыши: CD4-FITC и CD25-APC (eBioscience), CD8-APC-Cy7, CD3-PerCP Cy5.5 и B220-BV570 (Biolegend). Внутриклеточное мечение FoxP3-PE проводили после внеклеточного окрашивания и фиксации/увеличения проницаемости клеток в соответствии с инструкциями изготовителя (eBioscience). Полученные с помощью GMCSF дендритные клетки метили антителами CD11b-PerCP Cy5.5 (BD Biosciences), CD11c-PE-Cy7, I-A/I-E -APC-Cy7, CD80-PE, CD86-APC, CD8-FITC, B220-BV570 (Biolegend). Полученные с помощью Flt3 дендритные клетки метили посредством CD11c-PE-Cy7-, CD11b- или Siglec-H-PerCP Cy5.5 (Bioegend), I-A/I-E -APC-Cy7, CD317-PE, CD40-Alexa Fluor 647, CD103-FITC, B220-BV570. Клетки анализировали с использованием программного обеспечения FACSArria (BD Biosciences) и FlowJo версии 7.2.5.

Цитометрическая гранульная матрица (CBA)

Клетки костного мозга выделяли из бедренной и большеберцовой кости мышей C3H/HeN и C57Bl/6 с использованием среды RPMI и увеличивали в количестве с помощью Flt3L, как описано выше. Клетки стимулировали 100 нг/мл флагеллина (например флагеллин Roseburia) после культивирования в течение 9 суток, и супернатант собирали на 10 сутки. Эксперимент проводили три раза для получения N=3.

Анализ CBA проводили на клеточных супернатантах с использованием набора Cytometric Bead Array Mouse Enhanced Sensitivity Master Buffer Kit (BD Biosciences) в соответствии с инструкциями изготовителя. Стандарты и образцы наносили в 96-луночный планшет для измерения в FACSArray (BD Biosciences). Результаты анализировали с использованием программного обеспечения BD FCAP (BD Biosciences).

Анализ туши в отношении сухой массы тела и липидов

Потрошеную тушу взвешивали, лиофилизировали до постоянной массы, а затем измельчали для анализа. Содержание липидов определяли посредством экстракции (1:100 масс./об.) хлороформом/метанолом (2:1 об./об.), как описано ранее (12).

Клонирование флагеллинов Roseburia.

Амплификация способом ПЦР гена флагеллина из жидкой бактериальной культуры.

Последовательности флагеллина Roseburia hominis A2-183 были получены с web-сайта National Center for biotechnology Information (NCBI) (http://www.ncbi.nlm.nih.gov/).

Последовательности флагеллина Roseburia intestinalis L1-82T (NCIMB = 13810; DSM = 14610T) были получены с web-сайта National Center for biotechnology Information (NCBI) (http://www.ncbi.nlm.nih.gov/). Номера доступа для генов и белков флагеллина представлены в таблице B (таблица B - обобщенное представление номеров доступа для флагеллинов Roseburia, описанных в настоящем описании) ***

Выделение тотальной РНК из бактерий

Тотальную РНК выделяли из 1 мл жидкой культуры бактерий на логарифмической фазе роста с использованием набора RNAeasy minkit (Qiagen, Sussex, UK), сопряженного с расщеплением свободной от РНКаз ДНКазой I (Qiagen) и на основе протокола изготовителя. В кратком изложении, один миллилитр жидкой культуры помещали в 1,5-мл пробирку, центрифугировали при 5000 × g в течение 5 мин при 4°C и супернатант выбрасывали. Бактериальный осадок ресуспендировали в 100 мкл содержавшего лизоцим буфера TE (10 мМ Tris-HCl, 1 мМ EDTA, pH 8,0) и инкубировали при RT (комнатная температура). Грамположительные бактерии RH (Roseburia hominis) инкубировали в течение 10 мин при концентрации лизоцима 3 мг/мл. Затем в пробирку добавляли триста пятьдесят микролитров лизирующего буфера, содержащего 1% β-меркаптоэтанол, для разрушения клеток посредством встряхивания и добавляли 250 мкл 100% этанола (Molecular grade, Merck). Семьсот микролитров полученной суспензии наносили на колонку RNeasy mini, оборудованную пробиркой для улавливания, центрифугировали в течение 15 секунд при 8000 × g и извлекали содержимое из пробирки для улавливания. Вновь, 350 мкл промывочного буфера наносили на колонку, которую центрифугировали в течение 15 с при 8000 × g и прошедшую фракцию выбрасывали. Расщепление ДНК проводили посредством добавления в каждую колонку, 30 единиц ДНК-азы I, смешанной с 70 мкл буфера RDD, и инкубации при RT в течение 15 мин. Колонку вновь промывали, как описано ранее, 350 мкл буфера для промывания, а затем два раза 500 мкл буфера RPE. После высушивания воздухом колонки центрифугированием пустой колонки в течение 1 мин при 8000 × g, 40 мкл свободной от РНКазы воды добавляли прямо в колонку и инкубировали в течение 1 мин при RT, а затем центрифугировали в течение 1 мин при 8000 × g. Элюат, содержавший тотальную РНК, измеряли спектрофотметрически с использованием способа Nanodrop для определения концентрации. Целостность РНК проверяли в геномном отделении RINH (University of Aberdeen, UK) с использованием Agilent 2100 Bioanalyzer (Agilent Technologies). РНК с числом целостности (RIN) от 9,5 до 10, считали имеющей превосходное качество. Тотальную РНК хранили при -80°C до последующего применения.

Обратная транскрипция

Тотальную РНК подвергали обратной транскрипции с использованием набора для обратной транскрипции Quantitect (Qiagen), в соответствии с инструкциями изготовителя. В кратком изложении один микрограмм тотальной РНК в общем объеме 12 мкл инкубировали в течение 2 мин при 42°C с 1 X буфером для разрушения геномной ДНК и далее смешивали с 1X буфером Quantiscript RT (3 мкл), смесь праймеров для RT (2 мкл) и обратной транскриптазой Quantiscript (1 мкл) в конечном объеме 20 мкл. Программа обратной транскрипции представляла собой 15 мин при 42°C, а затем 3 мин при 95°C для инактивации фермента. Полученная концентрация комплементарной ДНК (кДНК) составляла 50 нг/мкл и кДНК хранили при -20°C до последующего применения.

Амплификация способом ПЦР генов флагеллина

Для амплификации флагеллина с геномной ДНК прямой и обратный праймеры конструировали вручную и приобретали от Sigma-Aldrich (Poole, UK). Амплификацию способом ПЦР фрагментов флагеллина проводили с использованием прямого праймера, встраивающего участок рестрикции BglII на 5’-конце, и обратного праймера, встраивающего участок рестрикции XhoI на 3’-конце.

Roseburia hominis (fla1)

Прямой праймер (5’-3’): CTCGAGATATGGTAGTACAGCACAA

Обратный праймер (5’-3’): CTTAGATCTCTGTAATAAGGATAATA

Roseburia hominis (fla2)

Прямой праймер (5’-3’): CTCGAGATATGGTGGTTAATCATAA

Обратный праймер (5’-3’): CTTAGATCTTTTCAAAATCTCAAGCAC

Roseburia intestinalis (Fla1)

Прямой праймер (5’-3’): GCAGGATCCATGCGTGGCGGAGACAAT

Обратный праймер (5’-3’): AATGTGGTGGTGGTGGTGGTGCTGCAGAATCTGCAA

Roseburia intestinalis (Fla2)

Прямой праймер (5’-3’): CTCGAGATATGGTAGTTAATCATAA

Обратный праймер (5’-3’): CTTAGATCTTTTTAACATTTCCAACAC

Roseburia intestinalis (Fla3)

Прямой праймер (5’-3’): CTCGAGATATGGTAGTACAGCACAA

Обратный праймер (5’-3’): CTTAGATCTCTGTAACAGAGAAAGTA

Roseburia intestinalis (Fla4)

Прямой праймер (5’-3’): CCGGGATCCATGGTAGTACAGCACAAT

Обратный праймер (5’-3’): TTAGTGGTGGTGATGATGATGCTGTAACAGAGAAAG

С использованием 1 мкл бактериальной культуры в качестве матрицы, гены флагеллина амплифицировали способом ПЦР. Температурная программа для амплификации была адаптирована из Fermentas (Fermentas GMBH, Germany) для оптимального функционирования полимеразы KOD (Novagen, Madison, WI) и она представляла собой 95°C в течение 2 мин для активации полимеразы, затем 34 циклов амплификации, 95°C в течение 20 c, температура отжига в течение 10 с и 70°C в течение 20 с, оканчивающаяся 2 мин при 70°C с использованием полимеразы KOD. Детали смеси для ПЦР приведены в таблице 1. Продукты ПЦР анализировали на 1% агарозном геле в течение 30 мин при 120 В и представляющие интерес полосы вырезали и очищали. Вставку сначала клонировали в клонирующий вектор PCR™-Blunt II-TOPO с использованием набора для клонирования Zero Blunt TOPO PCR cloning kit (Invitrogen) в соответствии с инструкциями изготовителя и путем смешения, как описано на фиг.1A и в таблице 1.

Таблица 1
Состав смеси для встраивания продукта ПЦР в клонирующий вектор PCR-Blunt II-TOPO. Солевой раствор и смесь вектор-фермент представляли собой готовые для применения растворы
Компоненты Объем (мкл)
Продукт ПЦР 2
Солевой раствор 1
H2O 2
Смесь вектор-фермент 1
Итого 6

Электрофоретическое разделение и очистка продуктов ПЦР

Для визуализации выделенного продукта флагеллина, амплифицированного способом ПЦР, реакционную смесь для ПЦР смешивали с 1X красителем для нанесения Blue-orange loading dye (Promega) и наносили на 1% агарозный гель (изготовленный из 1% агарозы, разбавленной буфером TAE (40 мМ основание Tris, 0,1% (об./об.) уксусная кислота, 1 мМ EDTA), доведенной до кипения и перелитой в лоток для геля), содержавшим 0,5 мкг/мл бромида этидия для окрашивания нуклеиновых кислот. Образцы разделяли в течение 30 мин при 120 В с использованием TAE в качестве подвижного буфера. Когда миграция завершалась, гель визуализировали под ультрафиолетовым (УФ) излучением и продукт идентифицировали с использованием эталона и вырезали с использованием чистого скальпеля. Затем фрагмент геля переносили в предварительно взвешенную пробирку Eppendorf, и его массу регистрировали путем вычитания из массы пустой пробирки. Продукт ПЦР очищали. К фрагменту геля добавляли мембраносвязывающий раствор в соотношении 10 мкл раствора на 10 мг фрагмента агарозного геля. Затем смесь инкубировали при 65°C в течение 10 мин при часом встряхивании до тех пор, пока фрагмент геля не растворялся полностью. Пробирку кратковременно центрифугировали при RT, чтобы гарантировать, что все содержимое находится на дне пробирки, а затем проводили очистку ДНК. С этого момента времени и далее очистка продуктов ПЦР вовлекала использование геля Wizard® SV Gel и системы PCR Clean-up system (Promega, Southampton, UK) в соответствии с инструкциями изготовителя. Одну миниколонку SV на продукт ПЦР вставляли в пробирку для сбора. Продукт ПЦР добавляли в собранную конструкцию миниколонки SV и инкубировали в течение 1 мин при комнатной температуре (RT). Колонку центрифугировали при 16000 × g в течение 1 мин, и прошедшую фракцию выбрасывали. Затем колонку промывали добавлением 700 мкл раствора для промывания мембраны и центрифугировали в течение 5 мин при RT. Прошедшую жидкость выбрасывали и собранную конструкцию вновь центрифугировали в течение 1 мин и сушили при RT в течение 2 мин для выпаривания какого-либо остаточного этанола. Затем колонку переносили в свежую 1,5-мл пробирку, свободную от нуклеазы. Для выделения продукта ПЦР 25 мкл свободной от нуклеазы воды наносили в центр колонки и ДНК элюировали посредством инкубации в течение 1 мин при RT и осаждения в течение 1 мин при 16000 × g. Концентрацию элюата измеряли спектрофотометрически с использованием Nanodrop (Thermo Fisher Scientific) и хранили при -20°C.

Расщепление флагеллина и экспрессирующего вектора.

Двести микролитров свежеразмороженных компетентных клеток DH5α держали на льду и добавляли 4 мкл смеси продуктов ПЦР, и оставляли на льду на 5 мин. Тепловой шок выполняли в течение 1 мин при 42°C и клетки возвращали на лед на 5 мин, а затем добавляли 400 мкл среды SOC. Среда SOC (Sigma) представляет собой богатую среду, используемую в основном на стадиях восстановления при трансформации компетентных клеток Escherichia coli. Использованием SOC максимизирует эффективность трансформации компетентных клеток.

Клетки росли при 37°C в течение 1 часа и 200 мкл смеси высевали на планшет с агаром LB, дополненный 50 мкг/мл канамицина. Положительные клоны получали в качестве минипрепаратов, разделенных на нанокапли и расщепленных BamH1 и Xho1 в течение 2 часов для вырезания флагеллина. Экспрессирующий вектор pT7-MAT-Tag-FLAG-2 (Sigma), представленный на фиг.2A, также расщепляли посредством BamH1 и Xho1. После разделения продукта на 1% агарозном геле и очистки расщепленного вектора и фрагмента, вектор и вставку лигировали при 4°C в течение ночи и трансформировали в E.coli DH5a. Продукты лигирования высевали на агар LB, дополненный 100 мкг/мл ампициллина. Положительные клоны получали в качестве минипрепаратов и трансформировали в компетентные клетки E.coli BL21 (DE3). Положительные клоны секвенировали соответствующими праймерами для проверки присутствия вставки. Из положительных клонов получали аликвоты глицерина. Экспрессирующие векторы, кодирующие флагеллины Roseburia, далее приготавливали в качестве минипрепаратов и трансформировали в компетентные клетки E.coli для повышения выхода очистки; для Rh1, Rh2 и Ri2 компетентные клетки E. coli представляли собой E.coli BL21 Rosetta и для RI3, Ri1 Ri4, Se, St, K12 и Er компетентные клетки E. coli представляли собой E.coli BL21 (DE3).

Экспрессия и очистка флагеллинов Roseburia

Трансформированные E.coli (например, BL21, Rosetta), кодирующие ген флагеллина (RH1 или FLaA1), выращивали в 1 литре среды LB с ампициллином (100 мкг/мл) и дополняли хлорамфениколом (50 мкг/мл) в случае клеток Rosetta при 37°C при встряхивании 180 об./мин. до логарифмической фазы. Культуру индуцировали в течение 3 часов посредством 1 мМ IPTG в тех же условиях для обеспечения специфической экспрессии белка флагеллина. Бактерии осаждали центрифугированием 4000 × g, 4°C, в течение 10 мин и ресуспендировали в 60 мл буфера 1 (50 мМ Tris (pH 7,4), 150 мМ NaCl) и обрабатывали ультразвуком с помощью Soniprep 150 (Sanyo, Japan), в течение 1 мин при использовании BL21 (DE3), или 3 мин при использовании Rosetta с 1 мин покоя после каждой минуты. Клеточный лизат центрифугировали при 9000 × g в течение 10 мин при 4°C и супернатант выбрасывали. Осадок, который содержал нерастворимые белки, ресуспендировали в 60 мл буфера 2 (50 мМ Tris (pH 8,0), 100 мМ NaCl, 5 мМ EDTA, 0,5% Triton-X100, 1 мМ DTT), вновь обрабатывали ультразвуком до полного ресуспендирования и центрифугировали при 5000 × g в течение 15 мин при 4°C. Нерастворимую фракцию промывали второй и третий раз буфером 2. Последнее промывание проводили с использованием буфера 2 без Tx-100 и DTT, как описано выше. Для солюбилизации белков нерастворимую фракцию ресуспендировали с использованием обработки ультразвуком в 4 мл буфера на основе мочевины (2 M мочевина, 50 мМ Tris (pH 7,4), 150 мМ NaCl) и центрифугировали при 5000 × g, 5 мин при RT. Супернатант выбрасывали посредством декантации и осадок ресуспендировали в 2 мл 4 M мочевины, 50 мМ Tris (pH7,4), 150 мМ NaCl, посредством обработки ультразвуком и центрифугировали при 5000 × g, 5 мин при RT. Супернатант собирали посредством декантации и осадок ресуспендировали в 2 мл 8 M раствора мочевины, 50 мМ Tris (pH 7,4), 150 мМ NaCl, посредством обработки ультразвуком и центрифугировали при 5000 × g, 5 мин RT. Супернатант собирали посредством декантации и смешивали с фракцией 4 M мочевины, с получением 6 M раствора мочевины, содержащего солюбилизированные флагеллины. Один миллилитр смолы Talon (Clontech, Takara, UK) промывали два раза 2 мл буфера 1 (50 мМ Tris (pH7,4), 150 мМ NaCl) и центрифугировали при 1000 × g, 2 мин при RT. Супернатант выбрасывали и добавляли фракцию 6 M мочевины, содержавшую флагеллин, и оставляли для вращения при 4°C в течение 1 часа. После центрифугирования при 1000 × g в течение 2 мин при RT смолу промывали два раза буфером, содержавшим 2 M мочевину, 50 мМ Tris (pH 7,4), 150 мМ NaCl, 15 мМ имидазол. После центрифугирования смолу инкубировали в течение 10 мин с 300 мкл буфера для элюирования (360 мМ Tris-HCl, 680 мМ имидазол, 360 мМ NaCl, 0,35 Н HCl, 1,43 M мочевина), осторожно перемешивали и элюлат собирали после центрифугирования при 2000 × g в течение 2 мин при RT. Элюирование повторяли один раз и два элюата смешивали. Вторую стадию очистки с использованием магнитных грану с антителом против FLAG M2 (Sigma) проводили для повышения чистоты препарата белка. Четыреста микролитров сверхчистой воды медленно добавляли к элюату смолы Talon до конечной концентрации мочевины 0,9 M, пригодной для гранул FLAG. Двести пятьдесят микролитров магнитных гранул FLAG промывали два раза посредством 750 мкл буфера 1, смешивая и оставляя на магнитном стенде (Ambion) для удаления супернатанта. К гранулам добавляли элюат Talon и центрифугировали в течение 30 мин при 4°C. Гранулы промывали пять раз 1 мл 0,9 M мочевины, 50 мМ Tris (pH7,4), 150 мМ NaCl. Элюирование состояло в добавлении к гранулам 250 мкл раствора пептида FLAG в концентрации 200 мкг/мл, содержавшего 0,9 M мочевину, 50 мМ Tris (pH7,4), 150 мМ NaCl, тщательном перемешивании и инкубации в течение 30 мин при RT. Пробирки помещали на магнитный стенд и конечный продукт собирали. Эту стадию элюирования повторяли один раз и 500 мкл конечных продуктов далее подвергали диализу в PBS с 0,9 M мочевиной в течение 1 часа при 4°C, разделяли на аликвоты и хранили при -80°C. Чистоту препаратов оценивали посредством SDS-PAGE с окрашиванием раствором кумасси синим (фиг.3A). Непосредственно перед применением аликвоту белка подвергали диализу в течение 1 часа против PBS, заменяя буфер два раза, в slide-a-lyser с порогом молекулярной массы 20 кДа (Pierce, UK) и концентрацию белка измеряли с использованием способа Брэдфорд. Измерение эндотоксинов подтвердило, что величины составляли <0,25 МЕ/мл.

Нуклеотидная последовательность, кодирующая Fla1, представлена в SEQ ID NO: 1 и аминокислотная последовательность Fla1 представлена в SEQ ID NO: 2.

ATGGTAGTACAGCACAATCTTACAGCAATGAACGCTAACAGACAGTTAGGTATCACAACAGGCGCACAGGCTAAGTCTTCTGAGAAGTTATCTTCTGGTTACAAGATCAACCGCGCAGCAGATGACGCAGCAGGTCTTACGATTTCCGAGAAGATGAGAAGCCAGGTTAGAGGCTTAAATAAAGCTTCTGACAACGCACAGGATGGTGTATCCCTTATTCAGGTAGCTGAGGGTGCATTAAGTGAGACACACTCCATCTTACAGCGTATGAATGAGTTAGCAACTCAGGCAGCAAACGATACCAATACAACCTCAGACAGAACTGCAGTTCAGCAGGAGATCAACCAGTTAGCATCTGAGATCACCAGAATCGCTTCTACAACTCAGTTCAACACAATGAACCTGATCGATGGTAACTTCACAAGTAAGAAGCTTCAGGTAGGTTCCCTTTGCGGACAGGCTATCACAATCGATATCTCTGATATGTCTGCTACAGGTCTTGGCGTTAGCGGATTAGTAGTATCTTCCTTCTCTGCAGCTGGTAAGGCAATGTCTGCAGCTCAGGATGCTATCAGCTACGTATCTTCTATGCGTTCTAAGCTGGGTGCATTACAGAACAGACTTGAGCACACAATCTCCCACCTGGACAACATTTCTGAGCACACATCTTCTGCAGAGTCTCGTATCCGTGATACAGATATGGCTGAAGAGATGGTTGAGTACAGCAAGAACAACATCCTTGCTCAGGCAGGACAGTCTATGCTTGCTCAGGCTAACCAGTCTACTCAGGGTGTATTATCCTTATTACAGTAA (SEQ ID NO: 1).

MVVQHNLTAMNANRQLGITTGAQAKSSEKLSSGYKINRAADDAAGLTISEKMRSQVRGLNKASDNAQDGVSLIQVAEGALSETHSILQRMNELATQAANDTNTTSDRTAVQQEINQLASEITRIASTTQFNTMNLIDGNFTSKKLQVGSLCGQAITIDISDMSATGLGVSGLVVSSFSAAGKAMSAAQDAISYVSSMRSKLGALQNRLEHTISHLDNISEHTSSAESRIRDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ (SEQ ID NO: 2).

Структура флагеллина состоит из четырех доменов: DO, D1, D2 и D3. См. фиг.4A.

D0: N-концевая α-спираль начинается с Gln 2 и продолжается до Ser 32 (ND0). C-концевая α-спираль начинается с Ala 459 и продолжается до Ser 491 (CD0).

Область перекладины, которая соединяет домены D0 и D1 домены, состоит из двух цепей (Ns и Cs), одна от Ser 32 до Ala 44, а другая от Glu 454 до Ala 459.

D1: N-концевой сегмент продолжается от Ala 44 до Gln 176 и C-концевой сегмент продолжается от Asn 406 до Glu 454. N-концевой сегмент состоит из α-спирали (от Ala 44 до Ala 99) (ND1a), за которой следует петля, связывающая со второй более короткой α-спиралью (ND1b), которая проходит вниз и цепь продолжается двумя β-поворотами, β-шпилькой, указывающей вниз и вытянутой вверх цепью, а остальная часть цепи в итоге переходит в домен D2. C-концевая α-спираль в домене 1 (CD1) начинается с Asn 406 и продолжается до Glu 454.

Домен D0 и D1 упакованы в структуру протофиламентов так, что N-D0 ориентирован наружу и C-D0 экспонирован к центральному каналу.

Домен D2 содержит два сегмента: N-концевой сегмент от Lys 177 до Gly 189 и C-концевой сегмент от Ala 284 до Glu 405. Он состоит в основном из β-цепей за исключением двух спиралей: 285-289 и 288-298.

Домен D3 содержит центральный сегмент от Tyr 190 до Val 283. По большей части состоит из β-цепей с одним коротким участком спиральной укладки (199-209).

Без связи с теорией, полагают, что две необходимых области белка флагеллина, вовлеченных в распознавание и активацию TLR5, представляют собой аминокислоты в положениях 79-117 SEQ ID NO: 2 (домен N-D1) и аминокислоты в положениях 408-439 SEQ ID NO: 2 (домен C-D1), а также аминокислоту аланин (A) в положении 411 SEQ ID NO: 2, аминокислоту глутамин (Q) в положении 412 SEQ ID NO: 2 и аминокислоту серин (S) в положении 420 SEQ ID NO: 2.

ПРИМЕРЫ

R. hominis предпочтительно колонизируют ободочную кишку

Безмикробным мышам C3H/HeN (GF) проводили инокулцяцию R. hominis посредством трех зондов в течение трех последовательных суток. Авторы изобретения сообщают о первой успешной моноколонизации безмикробных мышей одним видом бактерий из типа Firmicutes. Успешной колонизации достигали с использованием среды для инокуляции, содержавшей 3% аскорбиновую кислоту и 2% цистеин для защиты этих чувствительных к кислороду бактерий. Анализ ткани кишечника посредством флуоресцентной гибридизации in situ (FISH) выявил, что R. hominis колонизировали как подвздошную кишку, так и ободочную кишку, но обнаруживались в значительно более высоких количествах в ободочной кишке. Также было обнаружено, что бактерии тесно ассоциированы со слизистой оболочкой ободочной кишки (фиг.S1A). Колонизацию далее подтверждали и количественно определяли способом ПЦР с использованием праймеров, специфичных к R. hominis, с количествами, приближающимися к 1x1010 бактерий/г фекалий (фиг.S1B-C). Тесты фекалий животных GF в отношении каких-либо бактерий были отрицательными.

В геном R. hominis выявлены уникальные гены, стимулирующие взаимодействия с хозяином

Была получена полная геномная последовательность R. hominis A2-183 и она представлена одной хромосомой размером 3592125 п.н. (фиг.1A). Автоматизированное и ручное аннотирование генома с использованием платформы RAST выявило присутствие четырех рибосомальных оперонов, 66 РНК и 3273 спрогнозированных белков. Наибольшая группа генов принадлежала к категории подсистемы "Углеводы" (271 гены), кодирующей белки, вовлеченные в метаболизм углеводов, за которой следовали "Метаболизм белков" (197) и "Аминокислоты и производные" (175) (фиг.1B). Другие важные функциональные категории включали "Подвижность и хемотаксис" (49) и "Латентность и споруляцию" (12). Сравнительный геномный анализ показал, что наиболее близким родственником с точки зрения геномной структуры и функции среди полных бактериальных геномов является Eubacterium rectale (Mahowald et al. 2009), что является неудивительным, учитывая тесное таксономическое родство этих организмов (Duncan et al. 2006, Aminov et al. 2006). Сравнительное реконструирование двух геномов с 1095 генами выявило, что они отличались приблизительно 25% генов. В частности, эти отличия охватывали гены, кодирующие важные функции для взаимодействия с хозяином. Например, гены категории "Подвижность и хемотаксис", кодирующие белки типа IV сборки фимбрий PilB и PilC, присутствовали в E. rectale, но отсутствовали в R. hominis, в то время как жгутиковый стержневидный белок базального тела FlgC, жгутиковый комплексный белок крюк-базальное тело FliE, белок флагеллина FlaB и белок переключения мотора жгутиков FliG были уникальными для R. hominis (Таблица S1). Эти два бактериальных генома также отличались 42 генами углеводов, что отражает их различные пищевые потребности. Интересно, что R. hominis являются уникальными, поскольку они экспрессируют два гена флагеллина, оба из которых принадлежат типу FLA, в противоположность флагеллинам, гомологичным FliC, экспрессируемому видами бактерий Salmonella и E. coli.

Таблица S1. Сравнительный анализ геномов R. hominis и E. rectale. Сравнительный геномный анализ показал, что Eubacterium rectale является наиболее близким известным родственником R. hominis с точки зрения геномной структуры и функции и эти два генома различались приблизительно 25% генов. (A) Гены, присутствующие в R. hominis, но отсутствующие в E. rectale, и (B) гены, присутствующие в E. rectale, но отсутствующие в R. hominis.

Таблица S1A
Гены, присутствующие R. hominis, но отсутствующие в E. rectale.
Подкатегория Роль
Аминокислоты и производные
Аланин, серин и глицин Дегидратаза L-серина, альфа-субъединица
Аланин, серин и глицин Дегидратаза L-серина, бета-субъединица
Аргинин; цикл образования мочевины, полиамины Регуляторный белок каскада аргинина ArgR, репрессор arg-регулона
Аргинин; цикл образования мочевины, полиамины NADP-специфическая глутаматдегидрогеназа
Аргинин; цикл образования мочевины, полиамины Орнитиндекарбоксилаза
Аргинин; цикл образования мочевины, полиамины Пермеазный компонент ABC-траспортера спермидина-путресцина potC
Ароматическиие аминокислоты и производные Биосинтетическая аминотрансфераза-альфа ароматических аминокислот
Аминокислоты с разветвленной цепью Треониндегидратаза
Глутамин, глутамат, аспартат, аспарагин Аспартатаминотрансфераза
Глутамин, глутамат, аспартат, аспарагин L-аспарагиназа
Лизин, треонин, метионин и цистеин Сульфатпермеаза
Лизин, треонин, метионин и цистеин Лизиндекарбоксилаза
Лизин, треонин, метионин и цистеин Аденозилгомоцистеиназа
Лизин, треонин, метионин и цистеин ATP-связывающий белок ABC-транспортера метионина

Лизин, треонин, метионин и цистеин Пермеазный белок ABC-транспортера метионина
Лизин, треонин, метионин и цистеин Субстрат-связывающий белок ABC-трнанспортера метионина
Лизин, треонин, метионин и цистеин S-рибозилгомоцистеинлиаза
Лизин, треонин, метионин и цистеин Серогнозированный функциональный аналог гомосеринкиназы
Углеводы
Аминосахара Бета-гексозаминидаза
Центральный метаболизм углеводов 6-фосфоглюколактоназа
Центральный метаболизм углеводов Альдозо-1-эпимераза
Центральный метаболизм углеводов 4-Гидрокси-2-оксоглутаратальдолаза
Центральный метаболизм углеводов Пируват:ферредоксиноксидоредуктаза, альфа-субъединица
Центральный метаболизм углеводов Пируват:ферредоксиноксидоредуктаза, бета-субъединица
Центральный метаболизм углеводов Пируват: ферредоксиноксидоредуктаза, дельта-субъединица
Центральный метаболизм углеводов Пируват:ферредоксиноксидоредуктаза, гамма-субъединица
Центральный метаболизм углеводов Малатпермеаза
Ди- и олигосахариды Антитерминатор бета-глюкозидного bgl-оперона, семейство BglG
Ди- и олигосахариды Репрессор оперона галактозы, семейство GalR-LacI регуляторов транскрипции
Ди- и олигосахариды Система ABC-транспорта галактоза/метилгалактозид, пермеазный белок MglC

Ди- и олигосахариды ABC-транспортер множества сахаров, ATP-связывающий белок
Ферментация Еноил-CoA-гидратаза
Ферментация D-лактатдегидрогеназа
Моносахариды 2-дегидро-3-дезоксиглюконаткиназа
Моносахариды 2-дегидро-3-дезоксифосфоглюконатальдолаза
Моносахариды 2-дезокси-D-глюконат-3-дегидрогеназа
Моносахариды Альфа-глюкозидаза
Моносахариды Альтронатгидролазы
Моносахариды Альтронатоксидоредуктаза
Моносахариды Бета-глюкуронидаза
Моносахариды D-маннонатоксидоредуктаза
Моносахариды Маннонатдегидратаза
Моносахариды Белок деградации рамногалактуронидов RhiN
Моносахариды Уронатизомераза
Моносахариды Регулатор утилизации сахарных дикислот SdaR
Моносахариды Система ABC-транспорта рибозы, ATP-связывающий белок RbsA
Моносахариды Система ABC-транспорта рибозы, белок пермеаза RbsC
Моносахариды Пиримидиннуклеозидфосфорилаза
Моносахариды Фруктокиназа
Моносахариды Транскрипционный репрессор фруктозного оперона, семейство DeoR
Моносахариды Манноза-1-фосфатгуанилилтрансфераза
Моносахариды Манноза-6-фосфатизомераза
Моносахариды Возможный ABC-транспортер альфа-ксилозидов, субстрат-связывающий компонент

Одноуглеродный Серин-пируватаминотрансфераза
Сахарные спирты Белок, спосодствующий захвату глицерина
Сахарные спирты ABC-транспортер глицерин-3-фосфата, периплазматический глицерин-3-фосфат-связывающий белок
Нет подкатегории Регулятор запасания углерода
Клеточная стенка и капсула
Капсульные и внеклеточные полисахариды D,D-гептозо-7-фосфаткиназа
Капсульные и внеклеточные полисахариды GDP-L-фукозосинтетаза
Капсульные и внеклеточные полисахариды dTDP-4-дегидрорамнозо-3,5-эпимераза
Капсульные и внеклеточные полисахариды Деацетилаза N-ацетилглюкозамина пептидогликана
Капсульные и внеклеточные полисахариды Деацетилаза полисахаридов
Капсульные и внеклеточные полисахариды Глюкоза-1-фосфаттимидилилтрансфераза
Капсульные и внеклеточные полисахариды Пермеазный белок транслокации тейхоевых кислот TagG
Капсульные и внеклеточные полисахариды dTDP-4-дегидрорамнозоредуктаза
Капсульные и внеклеточные полисахариды dTDP-глюкоза-4,6-дегидратаза
Капсульные и внеклеточные полисахариды Система транспорта TRAP-типа, малый пермеазный компонент, прогнозируемый транспортер N-ацетилнейрамината
Капсульные и внеклеточные полисахариды Глюкоза-1-фосфатцитидилитрансфераза
Нет подкатегории N-ацетилмуамаоил-L-аланинамидаза

Подсистемы на основе кластеризации
Хемотаксис, регуляторы ответа Дигуанилатциклаза (домен GGDEF) с сенсором PAS/PAC
Подсистемы на основе кластеризации Белок споруляции стадии II, родственный металлопротеиназам (SpoIIQ)
Биогенез цитохромов Глутамат-1-полуальдегидаминотрансфераза
Экспорт белков? Мембранные белки, родственные металлоэндопептидазам
Экспорт белков? Белок семейства NLP/P60
Экспорт белков? Фактор высвобождения пептидных цепей 2
Экспорт белков? Гипотетический белок BH3604
Нет подкатегории Белок клеточного деления FtsW
Нет подкатегории FIG003307: гипотетический белок
Нет подкатегории Рибосомальный белок SSU S1p
Кофакторы, витамины, простетические группы, пигменты
Кофермент A 2-дегидропантоат-2-редуктаза
Кофермент A Пантотенат:Na+ симпортер
Кластеры Fe-S Белок сборки кластера железо-сера SufD
NAD и NADP L-аспартатдегидрогеназа
Пиридоксин Прогнозируемый регулятор транскрипции метаболизам пиридоксина
Тетрапирролы Альфа-рибазол-5’-фосфатфосфатаза
Нет подкатегории Прогнозируемый транспортер гидроксиметилпиримидинов CytX
Метаболизм ДНК
CRISPs CRISPR-ассоциированный белок Cas2

Репарация ДНК Урацил-ДНК-гликозилаза, семейство 1
Репарация ДНК Паралог субъединицы A эксцинуклеазы ABC с неизвестной функцией
Репарация ДНК A/G-специфическая аденингликозилаза
Репарация ДНК Малая субъединица экзодезоксирибонуклеазы VII
Репарация ДНК Экзонуклеаза SbcC
Репарация ДНК Экзонуклеаза SbcD
Репарация ДНК Предполагаемая ATP-зависимая ДНК-хеликаза YjcD
Репликация ДНК Субъединицы ДНК-полимеразы III гамма и тау
Репликация ДНК Белок DNAC репликации ДНК
Нет подкатегории ДНК-связывающий белок HBsu
Латентность и споруляция
Защита ДНК спор Малый растворимый в кислотах белок спор, бета-типа SASP
Нет подкатегории Белок созревания спор A
Нет подкатегории Белок созревания спор B
Жирные кислоты, липиды и изопреноиды
Жирные кислоты 4’-фосфопантетиенилтрансфераза
Триацилглицерины Лизофосфолипаза
Триацилглицерины Лизофосфолипаза L2
Триацилглицерины Моноглицеридлипаза
Мембранный транспорт
ABC-переносчики ATP-связывающий белок ABC-транспортера фосфонатов
ABC-переносчики Пермеазный белок ABC-транспортера фосфонатов phnE1
ABC-переносчики Пермеазный белок ABC-транспортера фосфонатов phnE2

ABC-переносчики ATP-связывающий белок транспорта дипептидов DppD
ABC-переносчики ATP-связывающий белок транспорта дипептидов DppF
ABC-переносчики Пермеазный белок системы транспорта дипептидов DppB
ABC-переносчики Пермеазный белок системы транспорта дипептидов DppC
ABC-переносчики Дипептид-связывающий ABC-транспортер, периплазматический субстрат-связывающий компонент
Нет подкатегории Дуплицированный ATP-азный компонент BL0693 модуля активации прогнозируемого ECF-транспортера
Нет подкатегории Дуплицированный ATP-азный компонент MtsB модуля активации метионин-регулируемого ECF-транспортера
Нет подкатегории Субстрат-специфический компонент BL0695 прогнозируемого ECF-транспортера
Нет подкатегории Субстрат-специфический компонент MtsA прогнозируемого ECF-транспортера
Нет подкатегории Субстрат-специфический компонент PdxU2 пиридоксин-регулируемого ECF-транспортера
Нет подкатегории Субстрат-специфический компонент ThiT ECF-транспортера тиамина
Нет подкатегории Трансмембранный компонент BL0694 модуля активации прогнозируемого ECF-транспортера
Нет подкатегории Трансмембранный компонент MtsC модуля активации метионин-регулируемого ECF-транспортера

Прочее
Проект DOE растения-прокариоты Аспартил-тРНК(Asn)-амидотрансфераза, субъединица A
Проект DOE растения-прокариоты Аспартил-тРНК(Asn) амидотрансфераза, субъединица B
Проект DOE растения-прокариоты Глутамил-тРНК(Gln) амидотрансфераза, субъединица A
Проект DOE растения-прокариоты Глутамил-тРНК(Gln) амидотрансфераза, субъединица B
Проект DOE растения-прокариоты Фосфоглюкозаминмутаза
Проект DOE растения-прокариоты Фосфоманномутаза
Проект DOE растения-прокариоты Система транспорта ABC, сахар-связывающий белок
Проект DOE растения-прокариоты Альфа-L-арабинофуранозидаза II, предшественник
Проект DOE растения-прокариоты Альфа-N-арабинофуранозидаза
Проект DOE растения-прокариоты Альфа-N-арабинофуранозидаза 2
Проект DOE растения-прокариоты Секретируемый белок COG3533
Проект DOE растения-прокариоты L-арабинозоизомераза
Проект DOE растения-прокариоты Репрессор транскрипции арабинозного оперона
Проект DOE растения-прокариоты Рамногалактуронанацетилэстераза
Нет подкатегории Предполагаемый регулятор активности мембранной протеазы YbbK
Подвижность и хемотаксис

Подвижность жгутиков прокариот Стержневидный белок базального тельца жгутиков FlgC
Подвижность жгутиков прокариот Белок комплекса крюк-базальное тельце жгутика FliE
Подвижность жгутиков прокариот Белок флагеллин FlaB
Нет подкатегории Белок переключения мотора жгутиков FliG
Метаболизм азота
Нет подкатегории Азот-регулирующий белок P-II
Нет подкатегории Регулятор транскрипции Hcp, HcpR (Семейство Crp/Fnr)
Нуклеозиды и нуклеотиды
Пурины Адениндезаминаза
Пиримидины Уридинкиназа
Нет подкатегории Рибонуклеотидредуктаза класса III (анаэробная), большая субъединца
Метаболизм фосфора
Нет подкатегории Экзополифосфатаза
Нет подкатегории Пермеазный белок системы транспорта фосфатов PstA
Нет подкатегории Пермеазный белок системы транспорта фосфатов PstC
Нет подкатегории Натрий-зависимый транспортер фосфатов
Метаболизм калия
Нет подкатегории Потенциалзависимый калиевый канал, подсемейство KQT
Метаболизм белков
Биосинтез белков Возможная GTP-аза, родственная EngC
Биосинтез белков Аспартил-тРНК(Asn)-синтетаза
Биосинтез белков тРНК-Ala-CGC
Биосинтез белков тРНК-Gly-CCC
Биосинтез белков тРНК-Pro-GGG

Биосинтез белков тРНК-Ser-CGA
Биосинтез белков тРНК-Ser-GGA
Биосинтез белков тРНК-Val-CAC
Фолдинг белков Предшественник белка фолдазы PrsA
Процессинг и модификация белков [NiFe] Гидрогеназный белок включения никеля HypA
Процессинг и модификация белков [NiFe] Гидрогеназный ассоциироваанный с включением никеля белок HypB
Метаболизм РНК
Процессинг и модификация РНК Пептидил-пролил цис-транс-изомераза
Процессинг и модификация РНК Компонент рибонуклеазного белка P
Транскрипция Прогнозируемый регулятор транскрипции цистеинсинтазы, семейство Rrf2
Транскрипция Сигма-фактор РНК-полимеразы SigV
Регуляция и клеточная передача сигнала
Запрограммированная гибель клеток и системы токсин-антитоксин Белок-токсин YafQ
Нет подкатегории Бифункциональный аутолизин Atl
Нет подкатегории Ассоциированный с клеточной оболочкой аттенюатор трансксрипции LytR-CpsA-Psr, подсемейство F2
Нет подкатегории Регулятор транскрипции, использующий ароматические углеводороды CatR (семейство LysR)
Нет подкатегории Белок контроля катаболитов A
Нет подкатегории HPr-подобный белок репрессии катаболитов Crh

Респирация
Нет подкатегории Ферредоксин
Ответ на стрессс
Холодовой шок Белок холодового шока CspG
Вирулентность, заболевание и защита
Устойчивость к антибиотикам и токсические соединения Возможный белок сляния мембран системы оттока Co/Zn/Cd
Устойчивость к антибиотикам и токсические соединения Регулятор транскрипции, семейство MerR
Устойчивость к антибиотикам и токсические соединения Транслоцирующая тяжелые металлы (Cd/Co/Hg/Pb/Zn) ATP-аза P-типа:транслоцирующая тяжелые металлы ATP-аза P-типа
Устойчивость к антибиотикам и токсические соединения Белок устойчивости к ванкомицину B-типа VanW
Устойчивость к антибиотикам и токсические соединения Белок устойчивости к тетрациклину TetW

Таблица S1B
Гены, присутствующие в E. rectale, но отсутствующие в R. hominis
Подкатегория Роль
Аминокислоты и производные
Аргинин; цикл образования мочевины, полиамины Регулятор транскрипции, семейство MerR, ближний транспортер полиаминов
Лизин, треонин, метионин и цистеин Сульфатаденилилтрансфераза, субъединица 2
Лизин, треонин, метионин и цистеин ATP-связывающий белок импорта сульфатов и тиосульфатов CysA
Лизин, треонин, метионин и цистеин Пермеазный белок системы транспорта сульфатов CysW
Лизин, треонин, метионин и цистеин Метиониновый транспортер MetT

Углеводы
Аминосахара Система транспорта ABC N-ацетил-D-глюкозамина, пермеазный белок 1
Ди- и олигосахариды Система транспорта ABC галактоза/метилгалактозид, ATP-связывающий белок MglA
Ди- и олигосахариды Мальтодекстринглюкозидаза
Ди- и олигосахариды PTS-сиистема, специфичный к мальтозе и глюкозе компонент IIB
Ди- и олигосахариды PTS-система, специфичный к мальтозе и глюкозе компонент IIC
Ферментация NADH-зависимая бутанолдегидрогеназа A
Ферментация Алкогольдегидрогеназа
Моносахариды Прогнозируемый ABC-транспортер бета-ксилозида, субстрат-связыващий компонент
Одноуглеродный метаболизм Фумаратгидратаза класса I, аэробная
Органические кислоты Серин-глиоксалатаминотрансфераза
Полисахариды Белок биосинтеза гликогена GlgD, семейство глюкоза-1-фосфатаденилилтрансферазы
Полисахариды Белок, родственный ферменту, расщепляющему разветвленную структуру гликогена
Сахарные спирты Глицериндегидрогеназа
Клеточная стенка и капсула
Компоненты стенки грамположительных клеток Белок семейства якорей поверхности клеточной стенки
Подсистемы на основе кластеризации
Деление клеток FIG001960: FtsZ-взаимодействующий белок, связанный с делением клеток

Биосинтез изопреноидов/клеточной стенки: спрогнозированная ундекапренил дифосфатфосфатаза пенициллин-связывающий белок, предполагаемый
Возможно связанный с устойчивостью к органическим гидропероксидам гипотетический белок Гомосеринкиназа
Нет подкатегории Фактор топологической специфичности деления клеток MinE
Нет подкатегории Низкомолекулярныая протеинтирозинфосфатаза
Кофакторы, витамины, простетические группы, пигменты
Биотин 3-кетоацил-CoA-тиолаза
Биотин Биотинсинтаза
Пиридоксин 4-гидрокситреонин-4-фосфатдегидрогеназа
Пиридоксин Пиридоксалькиназа
Пиридоксин Глутаминамидотрансфераза биосинтеза пиридоксина, субъединица глутаминазы
Пиридоксин Глутаминамидотрансфераза биосинтеза пиридоксина, субъединица синтазы
Татрапирролы Аденозилтрансфераза кобаламина(I)
Татрапирролы Уропорфириноген-III-метилтрансфераза
Татрапирролы ABC-транспортер витамина B12, B12-связывающий компонент BtuF
Нет подкатегории Белок аденилилтрансфераза переносчика серы ThiF
Нет подкатегории Белок биоссинтеза тиазола ThiG
Нет подкатегории Белок биосиснтеза тиазола ThiH
Метаболизм ДНК
CRISPs CRISPR-ассоциированный белок Cas7
Репарация ДНК Белок рекомбинционной репарации ДНК RecT (ассоциированный с профагом)

Репликация ДНК ATP-зависимая ДНК-хеликаза RecQ
Жирные кислоты, липиды и изопреноиды
Фосфолипиды CDP-диацилглицерин-серин-O-фосфатидилтрансфераза
Фосфолипиды Диацилглицеринкиназа
Усвоение и метаболизм железа
Нет подкатегории Сортаза A, LPXTG-специфическая
Мембранный транспорт
Нет подкатегории Субстрат-специфический компонент FolT транспортера фолалов ECF
Подввижность и хемотаксис
Социальная подвижность и нежгутиковое плавание бактерий Белок сборки фибрий типа IV, PilC
Социальная подвижность и нежгутиковое плавание бактерий Белок сборки фибрий типа IV, ATP-аза PilB
Нуклеозиды и нуклеотиды
Детоксикация Белок-мутатор mutT (7,8-дигидро-8-оксогуанинтрифосфатаза)
Пурины Урацилксантинпермеаза
Пурины Аденинфосфорибозилтрансфераза
Пурины Аденозиндезаминаза
Пиримидины Уридинфосфорилаза
Фаги, профаги, мобильные элементы, плазмиды
Фаги, профаги Белок мерной ленты длины хвоста фага
Метаболизм белков
Биосинтез белков Сходный с псевдоуридинсинтазой D большой субъединицы рибосом, типа YjbO Bacillus subtilis
Биосинтез белков тРНК (гуанин37-N1)-метилтрансфераза
Биосинтез белков Белок семейства аланил-тРНК-синтетазы
Деградация белков Аминопептидаза C
Деградация белков Беблокирующая аминопептидаза
Метаболизм РНК

Процессинг и модификация РНК COG1720: Неохарактеризованный консервативный белок
Процессинг и модификация РНК тРНК(Ile)-лизидинсинтетаза
Дыхание
Реакции акцептирования электронов Аденилилсульфатредуктаза, альфа-субъединица
Реакции акцептирования электронов Аденилилсульфатредуктаза, бета-субъединица
Реакции акцептирования электронов Диссимилятивная сульфитредуктаза (дисульфовиридин), альфа- и бета-субъединицы
Ответ на стресс
Осмотический стресс Холин-связывающий белок A
Осмотический стресс Саркозиноксидаза, альфа-субъединица
Нет подкатегории Белок углеродного голодания A
Нет подкатегории Регулятор транскрипции, семейство PemK
Метаболизм серы
Нет подкатегории Бета-галактозидаза, большая субъединица
Нет подкатегории Бета-галактозидаза, малая субъединица
Вирулентность, заболевание и защита
Устойчивость к антибиотикам и токсические соединения Аминогликозид-N6’-ацетилтрансфераза
Устойчивость к антибиотикам и токсические соединения Цитоплазматический белок гомеостаза меди cutC

R. hominis отвечают на среду кишечника активацией генов подвижности, мобилизации и хемотаксиса

Для определения генов, дифференциально экспрессируемых R. hominis в ответ на ассоциацию с хозяином и рацион, микрочип конструировали с использованием 6000 фрагментов ПЦР из библиотеки секвенирования вставок малого размера. После этого проводили подтверждение способом ПЦР в реальном времени для 42 дифференциально экспрессируемых генов (таблицы S2 и S3), которые кластеризуются в конкретных областях генома R. hominis, как проиллюстрировано на фиг.2A. Для различения эффектов среды кишечника и компонентов рациона, бактериальную РНК выделяли из четырех различных экспериментальных условий: (i) in vivo, из слепой кишки моноассоциированных мышей; (ii) in vitro, из бактерий, выращенных в культуральных средах; (iii) in vitro, из бактерий, выращенных в присутствии компонентов рациона; и (iv) из бактерий, инкубированных на поверхности смыкающегося монослоя клеток Caco-2 и HT-29.

Таблица S2. Анализ ПЦР в реальном времени бактериальной РНК с использованием специфических праймеров R. hominis. Бактериальные праймеры для ПЦР конструировали для дифференциально экспрессируемых генов с использованием Primer3Plus. Все образцы анализировали в трех экземплярах. В качестве эталонного гена для нормализации использовали GyrA.

Таблица S2
Название гена Rh14d - контроль Rh28d - контроль Rh14d - In Vitro+рацион Rh28d - In Vitro+рацион In Vitro + рацион - In Vitro
FC Значение P FC Значение P FC Значение P FC Значение P FC Значение P
3-гидроксиацил-CoA-дегидрогеназа 5,62 0,00393 8,62 0,00000 -0,85 0,69927 1,30 0,38670 6,62 0,00124
Ацетил-CoA-ацетилтрансфераза 10,25 0,00304 18,27 0,00000 1,38 0,51556 2,46 0,01882 7,44 0,00048
Белок семейства альдозоэпимеразы 7,20 0,00002 11,09 0,00001 22,65 0,03173 34,89 0,02105 -0,32 0,30489
Альфа-цепь ATP-синтазы 1,62 0,12713 2,50 0,00003 3,25 0,00645 5,00 0,00000 -2,00 0,00147
Альфа-цепь 2 ATP-синтазы 11,94 0,00122 5,50 0,00001 2,71 0,18580 1,25 0,72876 4,41 0,06479
Бета-цепь ATP-синтазы 1,85 0,08341 3,14 0,00056 4,00 0,00397 6,80 0,00001 -2,16 0,00241
Бета-цепь 2 ATP-синтазы 8,27 0,00058 6,13 0,00025 1,64 0,33264 1,21 0,67923 -5,05 0,01400
Гамма-цепь ATP-синтазы 2,31 0,02994 3,58 0,00027 4,22 0,00238 6,52 0,00001 -1,82 0,01276

Гамма-цепь2 ATP-синтазы -9,59 0,00081 -10,55 0,00013 -1,59 0,40064 -1,75 0,29398 -6,02 0,01363
Бутирил-CoA-дегидрогеназа 13,31 0,00166 19,32 0,00000 1,48 0,39908 2,14 0,02840 9,03 0,00039
Флавопротеин переноса электронов, альфа-субъединица 6,32 0,00729 15,55 0,00000 -0,80 0,61916 1,96 0,03441 7,94 0,00030
Флавопротеин переноса электронов, бета-субъединица 7,94 0,00414 12,31 0,00000 1,13 0,78504 1,76 0,08347 7,00 0,00078
Белок вращения мотора жгутиков MotA -0,94 0,71937 2,37 0,00023 1,69 0,02442 4,25 0,00001 -0,56 1,00000
Белок вращения мотора жгутиков MotB -0,57 0,01030 1,19 0,00938 -0,75 0,14601 1,58 0,01676 -0,76 0,08011
Белок флагеллин FlaA1 -3,05 0,00125 -1,93 0,01193 3,13 0,01261 4,95 0,00249 -9,57 0,00079
Белок флагеллин FlaA2 1,04 0,84732 -1,28 0,05814 1,45 0,29909 1,09 0,77089 -1,39 0,28105
Белок флагеллин FlaA3 1,14 0,41467 1,94 0,00312 1,63 0,08606 2,77 0,00477 -1,43 0,17174
Белок флагеллин flaB 1,02 0,97319 -4,99 0,00568 1,96 0,40946 -2,60 0,14359 -1,92 0,25258

Глюкуронидпермеаза -9,34 0,00001 -13,81 0,00022 -13,97 0,00001 -20,65 0,00003 -1,50 0,13959
L-треонин-3-O-фосфат декарбоксилаза 1,62 0,00963 3,70 0,00002 1,66 0,07350 3,78 0,00186 -0,98 0,92518
Переносчик магния 372,00 0,00123 11,20 0,03391 4,42 0,32048 -0,13 0,18758 84,10 0,01672
Метил-акцептирующий белок хемотаксиса 1 -1,18 0,54522 -1,83 0,02731 -2,90 0,01211 -1,87 0,05778 -0,29 0,00389
Метил-акцептирующий белок хемотаксиса 2 -2,46 0,00400 -2,95 0,00154 1,48 0,10070 1,24 0,33586 -3,65 0,00043
Метил-акцептирующий белок хемотаксиса 3 1,13 0,54189 1,86 0,04504 3,17 0,00033 5,25 0,00055 -2,81 0,00020
Метил-ацептирующий хемотаксический сенсорный трансдуктор 1 1,33 0,01743 2,15 0,00001 1,58 0,05704 2,56 0,00396 -1,19 0,38997
Метил-ацептирующий хемотаксический сенсорный трансдуктор 2 2,03 0,00671 2,34 0,00017 4,94 0,00007 5,71 0,00003 -2,44 0,00163

Белок MobA/MobL семейства 4/предполагаемый белок конъюгационного переноса 84,83 0,00177 5,77 0,01561 3,67 0,34227 -4,00 0,29305 23,10 0,04583
Белок MobA/MobL 1 257,93 0,00472 9,27 0,04437 8,72 0,25455 -3,19 0,50297 29,57 0,07733
Белок MobA/MobL 2 714,11 0,00172 11,64 0,08286 8,17 0,29225 -7,51 0,31871 87,43 0,04300
Белок MobA/MobL 3 362,26 0,00144 11,10 0,03880 7,77 0,27426 -4,20 0,43208 46,62 0,06260
Белок MobA/MobL 4 219,75 0,00147 6,52 0,08511 7,99 0,17452 -4,22 0,34388 27,49 0,04519
ABC-транспортер олигопептидов, периплазматический олигопептид-связывающий белок oppA 1,26 0,49437 1,11 0,45125 1,28 0,49171 1,13 0,53525 -1,02 0,92102
ATP-связывающий белок транспорта олигопептидов oppD -1,29 0,05256 1,08 0,40875 -1,40 0,07422 -1,00 0,98737 1,09 0,60319
Гистидинкиназа осмочувствительного K+ канала KdpD 3,98 0,00004 7,07 0,00000 5,58 0,00005 9,91 0,00001 -0,71 0,12049

Сенсорный белок фосфатного регулона PhoR 2,73 0,00211 1,54 0,04166 3,80 0,00919 2,14 0,07191 -1,39 0,34941
Фосфоенолпируват-карбоксикиназа [ATP] 2,30 0,05000 3,22 0,00004 1,15 0,70105 1,61 0,04623 2,00 0,00988
Белок захвата калия, интегральный мембранный компонент, KtrB 7,74 0,00006 10,81 0,00002 50,92 0,02191 71,15 0,01638 -0,15 0,15959
Предполагаемый сопряженный белок-переносчик MobA/MobL 183,02 0,00023 9,49 0,01454 8,09 0,08695 -2,39 0,44355 22,63 0,02615
Пируват-флаводоксин-оксидоредуктаза -0,52 0,05848 -0,92 0,52386 -0,36 0,01504 -0,65 0,09510 1,42 0,16352
Сигма-фактор РНК-полимеразы для оперона жгутиков -0,76 0,02253 1,93 0,00032 -0,82 0,08962 2,08 0,00013 -0,93 0,40060

Таблица S3. Индекс экспериментов ПЦР с R. hominis, нанесенный на кольцевую карту генома. Перечень экспериментов ПЦР с R. hominis, как показано на кольцевой карте генома

Таблица S3
Пример Праймер Начало Конец Длина Ген
1 gyrA-N-F 7803 7889 87 п.н. gyrA
2 1602-F 95664 95740 77 п.н. Сенсорный белок фосфатного регулона PhoR
3 1653-F 153403 153483 81 п.н. Белок флагеллин FlaA1
4 1686-F 189295 189382 88 п.н. Белок флагеллин FlaA2
5 1718-F 221205 221279 75 п.н. Белок флагеллин FlaA3
6 1735-F 250582 250674 93 п.н. Метил-акцептирующий белок хемотаксиса 1
7 1769-F 290546 290628 83 п.н. Метил-акцептирующий хемотаксический сенсорный трансдуктор 1
8 1770-F 291722 291808 87 п.н. Метил-акцептирующий белок хемотаксиса2
9 1831-N-F 348711 348810 100 п.н. Белок 4 MobA/MobL
10 1842-F 364775 364851 77 п.н. Белок 2 MobA/MobL
11 1867-2652-F 391044 391120 77 п.н. Белок 4 семейства MobA/MobL /предполагаемый белок сопряженного переноса
12 2055-F 600837 600928 92 п.н. Ацетил-CoA-ацетилтрансфераза
13 2056-F 602279 602363 85 п.н. 3-гидроксиацил-CoA-дегидрогеназа
14 2057-F 602961 603037 77 п.н. Бутирил-CoA-дегидрогеназа
15 2058-F 604411 604504 94 п.н. Флавопротеин переноса электронов, бета-субъединица
16 2059-F 605434 605516 83 п.н. Флавопротеин переноса электронов, альфа-субъединица
17 129-F 653987 654066 80 п.н. ABC-транспортер олигопептидов, периплазматический олигопептид-связывающий белок oppA

18 132-F 658435 658516 82 п.н. ATP-связывающий белок транспорта олигопептидов oppD
19 805-R 934310 934406 97 п.н. Осмочувствительная гистидинкиназа K+ канала KdpD
20 807-R 935306 935394 89 п.н. Белок семейства альдозоэпимеразы
21 808-R 936111 936190 80 п.н. Белок захвата калия, интегральный мембранный компонент, KtrB
22 909-F 1053529 1053604 76 п.н. Пируват-флаводоксин оксидоредуктаза
23 1235-F 1434705 1434785 81 п.н. Белок 3 MobA/MobL
24 1296-F 1495460 1495544 85 п.н. Метил-акцептирующий белок хемотаксиса 3
25 1297-R 1497854 1497931 78 п.н. L-треонин-3-O-фосфатдекарбоксилаза
26 1335-F 1540579 1540671 93 п.н. Белок вращения мотора жгутиков MotA
27 1336-F 1541416 1541511 96 п.н. Белок вращения мотора жгутиков MotB
28 1356-F 1559143 1559227 85 п.н. Сигма-фактор РНК-полимеразы для жгутикового оперона
29 3119-F 2211612 2211705 94 п.н. Фосфоенолпируваткарбоксикиназа [ATP]
30 3117-R 2213046 2213139 94 п.н. Метил-акцептирующий хемотаксический сенсорный трансдуктор 2
31 1867-2652-R 2736100 2736176 77 п.н. Белок 4 семейства MobA/MobL/предполагаемый белок сопряженного переноса
32 1552M-R 2984489 2984566 78 п.н. Транспортер магния

33 397-R 3153341 3153427 87 п.н. ATP-синтаза, бета-цепь 2
34 398-R 3153616 3153699 84 п.н. ATP-синтаза, гамма-цепь 2
35 399-R 3155799 3155898 100 п.н. ATP-синтаза, альфа-цепь 2
36 404-R 3159387 3159467 81 п.н. Глюкуронидпермеаза
37 2399-R 3308172 3308265 94 п.н. Предполагаемый белок сопряженного переноса MobA/MobL
38 2323-R 3366526 3366615 90 п.н. Белок флагеллина flaB
39 2281-R 3416947 3417042 96 п.н. ATP-синтаза, бета-цепь
40 2280-R 3418736 3418824 89 п.н. ATP-синтаза, гамма-цепь
41 2279-R 3418857 3418942 86 п.н. ATP-синтаза, альфа-цепь
42 641-R 3467164 3467255 92 п.н. Белок 1 MobA/MobL

Было идентифицировано пятьдесят дифференциально экспрессируемых генов (in vivo против in vitro). Наиболее неожиданным открытием было была высокая активация in vivo генов, вовлеченных в конъюгацию/мобилизационный перенос, гены, подобные mobA и mobL (фиг.2A). Присутствие таких генов в исследованиях транскрипции было неожиданным, поскольку не было поддающихся идентификации генов, присвоенных фагам, профагам, мобильным элементам и плазмидам в признаке категории подсистемы. Это отличие в обнаружении и распределении генов, вероятно, является следствием общепризнанных ограничений аннотирования категории подсистемы. Стимулирующий эффект соединений рациона был значительно менее выраженным, что указывает на то, что сама по себе среда кишечника является основным индуктором генов, вовлеченных в горизонтальный перенос генов.

Другие индуцируемые окружением кишечник подсистемы включали мембранный транспорт, в частности транспорт магния, и подвижность и хемотаксис, включая множество метил-акцептирующих белков хемотаксиса и генов жгутикового оперона (фиг.2B). R. hominis обладает множеством генов флагеллинов: flaA1, flaA2, flaA3 и flaB. В среде кишечника мыши экспрессия флагеллина была подтверждена вестерн-блоттином и иммуногистохимией с использованием бактерий, выделенных как из мышей, колонизированных in vivo, так и из культур in vitro, выращенных в присутствии корма, со специфическими антителами, индуцированными против рекомбинантных белков-флагеллинов FlaA1 и FlaA2 (RH1 и RH2) (фиг.2C). Это положительное подтверждение экспрессии флагеллина in vivo согласуется с предшествующими сообщениями, указывающими на то, что только определенные подгруппы Firmicutes образуют жгутики in vivo (Turnbaugh et al. 2008), в отличие от других видов бактерий, которые активно подавляют экспрессию бактериального белка. Также среда кишечника влияла на экспрессию генов катаболического метаболизма в R. hominis в среде кишечника (фиг.2D). Вовлеченные гены включали ацетил-CoA-ацетилтрансферазу, 3-гидроксиацил-CoA-дегидрогеназу, бутирил-CoA-дегидрогеназу и фосфоенолпируваткарбоксикиназу [ATP].

Чтобы далее исследовать эффекты адаптации к хозяину транскриптома R. hominis, проводили стимуляцию in vitro эпителиальных клеток кишечника человека (Caco-2 и HT-29). Это показало, что белок 1 mobA/mobL гена конъюгации/мобилизационного переноса, который индуцировался адаптацией к кишечнику мыши, также активировался в обеих клеточных линиях (фиг.2E). В соответствии с данными in vivo, ген флагеллин MotA активировался в клетках Caco-2. Гены, вовлеченные в метаболизм бутирата, продемонстрировали различия между двумя клеточными линиями, причем в клетках Caco-2 наблюдали подавление и в клетках HT-29 наблюдали активацию.

R. hominis в наибольшей степени влияет на естественные каскады передачи сигнала в кишечнике

Колонизация мышей GF посредством R. hominis коррелировала с увеличенной экспрессией генов хозяев, которая была наиболее высокой в ободочной кишке (фиг.3A и таблица S4). Дифференциальная экспрессия была наиболее выражена через 28 суток после колонизации, причем 159 генов активировались и 143 гена подавлялись. Число дифференциально экспрессируемых генов в подвздошной кишке на 14 сутки было сходным с восходящей ободочной кишкой, причем 79 генов активировались и 119 генов подавлялись. Дифференциальная экспрессия в подвздошной кишке была очень низкой на 28 сутки, что согласуется со сниженными уровнями колонизации. Транскриптомный ответ различался в два момента времени, как показано четким разделением значимых транскриптов в анализе тепловой карты (фиг.3B). Положительное подтверждение с использованием ПЦР в реальном времени данных Affymetrix представлено на фиг.3C.

Таблица S4. Данные Affymetrix между животными, которым инокулировали R. hominis, и животными GF. Анализ на микрочипах Affymetrix проводили на РНК, выделенной из ткани восходящей ободочной кишки и подвздошной кишки. Данные считали значимыми при P<0,05 с использованием способа обнаружения ложноположительных результатов Benjamini и Hochberg. (A) Транскрипты, дифференциально экспрессированные в восходящей ободочной кишке на 14 сутки. (B) Транскрипты, дифференциально экспрессированные в восходящей ободочной кишке на 28 сутки. (C) Транскрипты, дифференциально экспрессированные в подвздошной кишке на 14 сутки. (D) Транскрипты, дифференциально экспрессированные в подвздошной кишке на 28 сутки.

Таблица S4A
Транскрипты, дифференциально экспрессированные в восходящей ободочной кишке через 14 суток между животными, которым инокулировали R. hominis, и безмикробными животными
ID Обозначение Название FC Значение P B
1424973_at Cyp3a25 Цитохром P450, семейство 3, подсемейство a, полипептид 25 26,35 4,09E-05 8,91
1449375_at Ces6 Карбоксилэстераза 6 22,80 5,71E-16 29,28
1428400_at 2200002K05Rik Ген RIKEN cDNA 2200002K05 6,22 6,65E-09 17,20
1419393_at Abcg5 ATP-связывающая кассета, подсемейство G (WHITE), представитель 5 5,81 0,002156 4,51
1429726_at Slc16a9 Семейство переносчиков растворенных веществ 16 (транспортеры монокарбоновых кислот), представитель 9 4,38 0,001103 5,26
1430641_at 9030605I04Rik Ген RIKEN cDNA 9030605I04 4,36 0,000358 6,52
1436575_at Grin3a Ионотропный рецептор глутамата, NMDA3A 3,91 0,018503 1,71
1422749_at Ly6g6c Комплекс лифмоцитарного антигена 6, локус G6C 3,71 0,004044 3,79
NuGO_emt070648_at Abca12 ATP-связывающая кассета, подсемейство A (ABC1), представитель 12 3,69 0,000333 6,62
1428682_at Zc3h6 Белок, содержащий цинковые пальцы типа CCCH, 6 3,28 0,002747 4,26

1431554_a_at Anxa9 Аннексин A9 3,00 3,25E-05 9,18
1423556_at Akr1b7 Альдо-кеторедуктаза, семейство 1, представитель B7 2,87 0,018503 1,70
1424451_at Acaa1b Ацетил-кофермент-A-ацилтрансфераза 1B 2,70 0,000404 6,33
1418486_at Vnn1 Ванин 1 2,66 0,001531 4,93
1418606_at Hoxd10 Гомео-бокс D10 2,60 0,000102 7,97
1435207_at Dixdc1 Белок 1, содержащий домен DIX 2,55 0,014337 2,11
1427072_at Stard8 Белок 8, содержащий домен START 2,48 0,027058 1,15
1442560_at NA NA 2,42 0,006928 3,17
1420998_at Etv5 Вариант 5 гена Ets 2,33 0,017697 1,81
1440925_at Rhoq Семейство генов гомологов Ras, представитель Q 2,32 0,013564 2,22
1428902_at Chst11 Сульфотрансфераза углеводов 11 2,30 0,000154 7,46
1416607_at 4931406C07Rik Ген RIKEN cDNA 4931406C07 2,28 7,26E-11 21,08
1435673_at Hoxd3 Гомео-бокс D3 2,26 0,019944 1,60
1426663_s_at Slc45a3 Семейство переносчиков растворенных веществ 45, представитель 3 2,21 0,007554 3,07
1419651_at 2610200G18Rik Ген RIKEN cDNA 2610200G18 2,21 0,000406 6,29
1422188_s_at NA NA 2,20 0,000397 6,39
1435468_at D230025D16Rik Ген RIKEN cDNA D230025D16 2,15 0,018503 1,71
1417991_at Dio1 Дейодиназа, йодотиронин, тип I 2,12 0,026066 1,24
1451557_at Tat Тирозинаминотрансфераза 2,11 0,046376 0,38

1428989_at 0710001D07Rik Ген RIKEN cDNA 0710001D07 2,03 0,04028 0,54
1456680_at B3gnt6 UDP-GlcNAc:betaGal бета-1,3-N-ацетилглюкозаминилтрансфераза 6 (синтаза кора 3) 2,01 0,024447 1,35
1443235_at Eif2ak4 Эукариотический фактор инициации трансляции 2, альфа-киназа 4 1,97 0,002156 4,51
1419759_at Abcb1a ATP-связывающая кассета, подсемейство B (MDR/TAP), представитель 1A 1,97 0,009639 2,79
1456389_at Zeb2 E-бокс-связывающий гомеобокс 2 с цинковыми пальцами 1,96 0,013795 2,16
1440840_at D630004K10Rik Ген RIKEN cDNA D630004K10 1,96 0,017697 1,80
1457619_at Ces6 Карбоксилэстераза 6 1,94 0,04028 0,55
1449049_at Tlr1 Toll-подобный рецептор 1 1,92 0,018503 1,72
NuGO_emt049113_at Ptprh Протеинтирозинфосфатаза, рецепторного типа, H 1,89 0,002961 4,17
1424376_at Cdc42ep1 Эффекторный белок CDC42 (связывающий GTP-азу Rho) 1 1,88 0,014337 2,10
1436566_at Rab40b Rab40b, представитель семейства онкогенов RAS 1,87 0,028805 1,04
1432590_at LOC621549 NA 1,83 0,012459 2,38
1430543_at Clip3 Линкерный белок 3, содержащий домен CAP-GLY 1,82 6,24E-05 8,47
1435553_at Pdzd2 Белок 2, содержащий домен PDZ 1,81 0,048735 0,32

1428271_at Acbd4 Белок 4, содержащий домен, связывающий ацил-кофермент A 1,80 0,014378 2,09
1418059_at Eltd1 EGF, содержащий семикратно трансмембранный домен латрофилина, 1 1,79 0,005331 3,47
1456532_at Pdgfd Тромбоцитарный фактор роста, полипептид D 1,77 0,007554 3,05
1437393_at AI875142 Экспрессируемая последовательность AI875142 1,77 0,03504 0,78
1428332_at 1500004A08Rik Ген RIKEN cDNA 1500004A08 1,77 0,038684 0,61
1434015_at Slc2a6 Переносчик растворенных веществ, семейство 2 (облегченный транспортер глюкозы), представитель 6 1,75 0,000437 6,19
1449403_at Pde9a Фосфодиэстераза 9A 1,71 0,03504 0,79
1428260_at Spg3a Гомолог белка спастической параплегии 3A (человека) 1,69 0,011437 2,55
1417803_at 1110032A04Rik Ген RIKEN cDNA 1110032A04 1,66 0,001103 5,27
1430245_at Fxr1h Ген умственной отсталости при ломкой X-хромосоме 1, аутосомный гомолог 1,66 0,012459 2,36
1422542_at Gpr34 Сопряженный с G-белком рецептор 34 1,65 0,031372 0,95
1427020_at Scara3 Рецептор-мусорщик класса A, представитель 3 1,60 0,010425 2,69
1430211_at 4930415O20Rik Ген RIKEN cDNA 4930415O20 1,57 0,045 0,42
1452809_at 9030607L17Rik Ген RIKEN cDNA 9030607L17 1,53 0,013564 2,22

NuGO_emt066282_at Defb37 Дефензин-бета 37 1,51 0,005422 3,44
1451498_at BC004853 Последовательность кДНК BC004853 1,50 0,037045 0,69
1434140_at Mcf2l Белок, подобный трансформирующей последовательности Mcf.2 1,49 0,025597 1,30
1452650_at Trim62 Белок 62, содержащий тройной мотив 1,46 0,02652 1,19
1427492_at Pof1b Белок 1B синдрома истощения яичников 1,46 0,004679 3,61
1426601_at Slc37a1 Переносчик растворенных веществ, семейство 37 (переносчик глицерин-3-фосфата), представитель 1 1,42 0,032433 0,90
1448188_at Ucp2 Разобщающий белок 2 (митохондриальный, переносчик протонов) 1,42 0,008209 2,96
1460409_at Cpt1a Карнитинпальмитоилтрансфераза 1a, печень 1,40 0,025932 1,26
1460652_at Esrra Эстроген-связанный рецептор, альфа 1,39 0,038182 0,65
1453869_at LOC328277 NA 1,36 0,017271 1,86
1435985_at Farp2 Белок 2 с доменом FERM, RhoGEF и плекстрина 2 1,34 0,037045 0,70
1454706_at Uvrag Ген, ассоциированный с устойчивостью к УФ-излучению 1,34 0,021704 1,51
1451232_at Cd151 Антиген CD151 1,31 0,049274 0,31
1423570_at Abcg1 ATP-связывающая кассета, подсемейство G (WHITE), представитель 1 1,30 0,04028 0,55

1418817_at Chmp1b Хроматин-модифицирующий белок 1B 1,25 0,010981 2,61
1441059_at 1700049G17Rik Ген RIKEN cDNA 1700049G17 1,25 0,028805 1,05
NuGO_emt061346_at NA NA 1,24 0,026697 1,17
1420503_at Slc6a14 Переносчик растворенных веществ, семейство 6 (переносчик нейротрансмиттера), представитель 14 1,22 0,012499 2,32
NuGO_emt073103_x_at NA NA 1,21 0,01946 1,63
1452592_at Mgst2 Микросомальная глутатион S-трансфераза 2 1,18 0,038684 0,60
1441135_at NA NA -1,10 0,01646 1,92
1428482_at Akap10 Якорный белок 10 A-киназы (PRKA) -1,20 0,022427 1,47
1426679_at Zfp706 Белок с цинковыми пальцами 706 -1,26 0,028805 1,05
1415816_at Cct7 Субъединица 7 шаперонина (эта) -1,26 0,011936 2,47
1445024_at Stard7 Белок 7, содержащий START-домен -1,27 0,03504 0,79
1453591_at 5730437N04Rik Ген RIKEN cDNA 5730437N04 -1,32 0,02652 1,19
1450788_at Saa1 Сывороточный амилоид A 1 -1,32 0,002156 4,54
1436157_at Ccar1 Регулятор цикла деления клеток и апоптоза 1 -1,33 0,034783 0,81
1450987_a_at 2310004I24Rik Ген RIKEN cDNA 2310004I24 -1,35 0,0361 0,73
1433850_at Ppp4r2 Протеинфосфатаза 4, регуляторная субъединица 2 -1,36 0,018503 1,71
1434835_at Wapal Wings apart-подобный гомолог (Drosophila) -1,37 0,027058 1,14

NuGO_emt090017_s_at Cdk7 Циклин-зависимая киназа 7 (гомолог cdk-активирующей киназы Xenopus MO15) -1,37 0,044186 0,44
1422579_at Hspe1 Белок теплового шока 1 (шаперонин 10) -1,38 0,017697 1,81
1455726_at Gm71 Модель гена 71 (NCBI) -1,42 0,029302 1,02
1420461_at Mst1r Рецептор белка 1, стимулирующего макрофаги 1 (c-met-связанная тирозинкиназа) -1,49 0,046838 0,37
1453264_at Marveld3 Белок 3, содержащий домен MARVEL (мембраноассоциирующий) -1,49 0,005522 3,40
1425030_at Zfp622 Белок с цинковыми пальцами 622 -1,49 0,000586 5,89
1458507_at 2810055G22Rik Ген RIKEN cDNA 2810055G22 -1,50 0,032433 0,89
1443988_at Rbm39 Белок 39 с РНК-связывающим мотивом -1,51 0,037045 0,68
1460465_at A930038C07Rik Ген RIKEN cDNA A930038C07 -1,51 0,004627 3,64
1428784_at Gmip Взаимодействующий с геном белок -1,51 0,045 0,42
1451621_at 5830417C01Rik Ген RIKEN cDNA 5830417C01 -1,65 0,014536 2,07
1422837_at Scel Сциеллин -1,68 0,0361 0,74
1454617_at Arrdc3 Белок 3, содержащий домен аррестина -1,71 0,038496 0,62
1452047_at Cacybp Кальциклин-связывающий белок -1,72 0,018495 1,75
1434724_at Usp31 Убиквитин-специфическая пептидаза 31 -1,75 0,024018 1,39
1417032_at Ube2g2 Убиквитин-конъюгирующий фермент E2G 2 -1,76 0,04028 0,56
1448628_at Scg3 Секретогранин III -1,77 0,016351 1,93
1443877_a_at Rapgef6 Фактор обмена гуаниновыми нуклеотадиами Rap (GEF) 6 -1,82 0,004044 3,80

1427944_at Caprin2 Представитель 2 семейства каприна -1,85 0,04248 0,49
1415909_at Stip1 Стресс-индуцируемый фосфопротеин 1 -1,89 0,024018 1,38
1422452_at Bag3 Bcl2-ассоциированный атаноген 3 -1,89 0,026066 1,24
1438041_at Pde7a Фосфодиэстераза 7A -1,91 0,025597 1,29
1433927_at Uspl1 Белок 1, подобный убиквитин-специфической пептидазе -1,92 0,024018 1,38
1422860_at Nts Нейротензин -1,94 1,84E-07 14,19
1451194_at Aldob Альдолаза 2, изоформа B -1,94 7,08E-06 10,59
1441662_at Cyp4x1 Цитохром P450, семейство 4, подсемейство x, полипептид 1 -1,95 0,00019 7,22
1445490_at C77805 Экспрессируемая последовательность C77805 -1,96 0,003479 4,00
NuGO_emt066852_at NA NA -2,07 0,013658 2,19
1442427_at NA NA -2,11 0,033207 0,86
1430185_at Akap13 Якорный белок 13 A-киназы (PRKA) -2,12 0,0361 0,74
1452462_a_at Banp Btg3-ассоциированный ядерный белок -2,16 0,038182 0,64
1446158_at Exoc6b Компонент 6B комплекса экзоцисты -2,19 0,010302 2,72
1418113_at Cyp2d10 Цитохром P450, семейство 2, подсемейство d, полипептид 10 -2,24 0,012383 2,42
1426645_at Hsp90aa1 Белок теплового шока 90 кДа альфа (цитозольный), представитель 1 класса A -2,30 0,012459 2,34

1420150_at Spsb1 Белок 1, содержащий SplA/домен рецептора рианодина и SOCS-бокс -2,36 0,015257 2,01
1452382_at Dnm3os Динамин 3, противоположная цепь -2,37 0,025932 1,26
1460645_at Chordc1 Цинк-связывающий белок 1, содержащий цистеин и гистидин-богатый домен (CHORD) -2,38 0,002156 4,53
1457477_at NA NA -2,39 0,027058 1,14
1430175_at Tmtc2 Трансмембранный и содержащий тетратрикопептидный повтор белок 2 -2,40 0,028805 1,05
1433266_at 2810416A17Rik Ген RIKEN cDNA 2810416A17 -2,43 0,0361 0,73
1416756_at DNAjb1 Гомолог DNAJ (Hsp40), подсемейство B, представитель 1 -2,50 0,013658 2,19
1415938_at Spink3 Ингибитор сериновой протеазы, Kazal-типа 3 -2,53 0,012459 2,35
1429273_at Bmper BMP-связывающий эндотелиальный регулятор -2,53 0,012459 2,34
1450518_at Hnf4g Ядерный фактор гепатоцитов 4, гамма -2,53 0,019018 1,66
1440227_at BF642829 Экспрессируемая последовательность BF642829 -2,58 0,038494 0,63
1451924_a_at Edn1 Эндотелин 1 -2,63 0,011568 2,51
1425952_a_at Gcg Глюкагон -2,65 2,76E-06 11,57
1459253_at Arrdc3 Белок 3, содержащий домен аррестина -2,69 0,026081 1,23
1416288_at DNAja1 Гомолог DNAJ (Hsp40), подсемейство A, представитель 1 -2,75 0,000154 7,45

1435160_at 1110064P04Rik Ген cDNA RIKEN 1110064P04 -2,76 0,011568 2,52
1460179_at DNAja1 Гомолог DNAJ (Hsp40), подсемейство A, представитель 1 -2,78 0,000251 6,92
1419349_a_at Cyp2d9 Цитохром P450, семейство 2, подсемейство d, полипептид 9 -2,78 0,000134 7,68
NuGO_emt044299_at Sstr1 Рецептор соматостатина 1 -2,80 3,73E-07 13,38
1449493_at Insl5 Инсулин-подобный 5 -2,91 5,33E-08 15,35
NuGO_emt054105_at D630013G24Rik Ген RIKEN cDNA D630013G24 -2,99 0,004044 3,83
1419185_a_at Mlxipl Белок, подобный MLX-взаимодействующему белку -3,16 4,43E-06 11,08
1449939_s_at Dlk1 Гомолог Delta-подобного белка 1 (Drosophila) -3,29 9,19E-11 20,69
1458385_at Hspa4l Белок, подобный белку теплового шока 4 -3,36 0,032433 0,90
1422639_at Calcb Кальцитонин-связанный полипептид, бета -3,75 0,010981 2,62
1425993_a_at Hsp110 Белок теплового шока 110 -4,08 0,028805 1,05
NuGO_emt091063_at NA NA -6,03 3,11E-07 13,63
1419473_a_at Cck Холицистокинин -10,87 4,94E-11 21,66
1452388_at Hspa1a Белок теплового шока 1A -25,30 0,02652 1,19

Таблица S4B
Транскрипты, дифференциально экспрессируемые в восходящей ободочной кишке на 28 сутки между животными, которым инокулировали R. hominis, и безмикробными животными
ID Обозначение Название FC Значение P B
1416809_at Cyp3a11 Цитохром P450, семейство 3, подсемейство a, полипептид 11 89,84 1,45E-06 12,00
1424973_at Cyp3a25 Цитохром P450, семейство 3, подсемейство a, полипептид 25 52,30 7,31E-07 12,67
1419393_at Abcg5 ATP-связывающая кассета, подсемейство G (WHITE), представитель 5 42,06 1,60E-09 18,55
1449375_at Ces6 Карбоксилэстераза 6 26,10 1,75E-16 31,66
1422749_at Ly6g6c Комплекс 6 лимфоцитарного антигена, локус G6C 25,49 2,06E-10 20,64
1448964_at S100g Кальций-связывающий белок G S100 17,88 4,82E-07 13,11
1455540_at Cps1 Карбамоилфосфатсинтетаза 1 11,50 0,010507 1,76
1449133_at Sprr1a Малый пролин-богатый белок 1A 11,27 0,009303 1,97
NuGO_emt070648_at Abca12 ATP-связывавющая кассета, подсемейство A (ABC1), представитель 12 7,97 4,05E-08 15,43
1448485_at Ggt1 Гамма-глутамилтрансфераза 1 7,45 0,020934 0,94
1417828_at Aqp8 Аквапорин 8 6,67 0,001582 4,30
1437060_at Olfm4 Ольфактомедин 4 5,80 0,023469 0,77

1420437_at Indo Индоламин-пиррол 2,3 диоксигеназа 5,18 0,000637 5,44
1425452_s_at AW125753 Экспрессируемая последовательность AW125753 4,97 0,001639 4,20
1439934_at Slc30a10 Переносчик растворенных веществ, семейство 30, представитель 10 4,68 0,000119 7,49
1430641_at 9030605I04Rik Ген RIKEN cDNA 9030605I04 4,47 0,000199 6,89
1423556_at Akr1b7 Альдо-кеторедуктаза, семейство 1, представитель B7 4,36 0,000304 6,44
1428400_at 2200002K05Rik Ген RIKEN cDNA 2200002K05 4,31 4,81E-07 13,18
1424626_at 2010003K11Rik Ген RIKEN cDNA 2010003K11 4,25 0,024887 0,68
1439727_at Clca6 Хлоридный канал, активируемый кальцием, 6 4,09 0,000869 5,07
1450355_a_at Capg Кэппирующий белок (актиновый филамент), гельсолин-подобный 3,90 4,67E-05 8,59
1427119_at Spink4 Ингибитор сериновой пептидазы, Kazal-типа 4 3,67 0,007507 2,25
NuGO_emt092118_s_at NA NA 3,51 0,040399 -0,04
1451239_a_at Slc26a1 Переносчик растворенных веществ, семейство 26 (сульфатный переносчик), представитель 1 3,36 0,004508 2,94
1418283_at Cldn4 Клаудин 4 2,97 0,002809 3,51
1418165_at Itlna Интелектин a 2,88 0,0005 5,82

1440192_at 1810054D07Rik Ген RIKEN cDNA 1810054D07 2,86 0,000108 7,65
1426980_s_at E130012A19Rik Ген RIKEN cDNA E130012A19 2,83 0,002052 3,91
1431042_at Paqr8 Представитель семейства VIII рецепторов прогестина и adipoQ 2,67 0,000637 5,46
1424688_at Creb3l3 Белок 3, подобный белку 3, связывающему cAMP-отвечающий элемент 2,67 0,035165 0,19
NuGO_emt049113_at Ptprh Протеинтирозинфосфатаза, рецепторный тип, H 2,54 6,75E-06 10,55
1432358_at Muc16 Муцин 16 2,47 0,044391 -0,20
1419759_at Abcb1a ATP-связывающая кассета, подсемейство B (MDR/TAP), представитель 1A 2,46 0,00017 7,13
NuGO_emt033610_at Nox1 NADPH-оксидаза 1 2,43 0,035165 0,20
1418661_at Abhd2 Белок 2, содержащий домен абидролазы 2,41 0,043727 -0,17
1420499_at Gch1 GTP-циклогидролаза 1 2,38 0,040391 -0,03
1416607_at 4931406C07Rik Ген RIKEN cDNA 4931406C07 2,31 3,39E-11 22,26
1417991_at Dio1 Дейодиназа, йодотиронин, тип I 2,29 0,006845 2,39
1455455_at Glt28d2 Белок 2, содержащий домен гликозилтрансферазы 28 2,16 0,015457 1,33
1417164_at Dusp10 Фосфатаза 10 с двойной специфичностью 2,13 0,031006 0,40
1428937_at Atp2b1 ATP-аза, Ca++-транспортирующая, плазматической мембраны 1 2,13 1,13E-05 9,98
1429833_at Ly6g6e Комплекс 6 лимфоцитарного антигена, локус G6E 2,10 0,042694 -0,12

1419582_at Cyp2c55 Цитохром P450, семейство 2, подсемейство c, полипептид 55 2,06 0,022426 0,83
1448562_at Upp1 Уридинфосфорилаза 1 2,06 0,007369 2,29
1444254_at NA NA 2,05 0,009642 1,90
1428936_at Atp2b1 ATP-аза, Ca++-транспортирующая, плазматической мембраны 1 2,05 0,000378 6,15
1421268_at Ugcg Церамидглюкозилтрансфераза UDP-глюкозы 2,05 0,035029 0,21
1419478_at Sectm1b Секретируемый и трансмембранный белок 1B 2,02 0,004814 2,83
1428336_at Agpat4 1-ацилглицерин-3-фосфат-O-ацилтрансфераза 4 (ацилтрансфераза лизофосфатидной кислоты, дельта) 2,02 0,047797 -0,32
1456231_at Pla2g3 Фосфолипаза A2, группа III 1,99 0,000365 6,21
1421709_a_at Fmo5 Флавинсодержащая монооксигеназа 5 1,97 0,02187 0,86
1455104_at NA NA 1,95 0,010934 1,71
1417133_at Pmp22 Периферический белок миелина 1,95 0,027135 0,58
1418206_at Sdf2l1 Белок 1, подобный происходящему из стромальных клеток фактору 2 1,94 0,045914 -0,25
1436614_at AI843639 Экспрессируемая последовательность AI843639 1,94 0,006795 2,41
1452070_at Dedd2 ДНК-связывающий белок 2, содержащий эффекторный домен смерти 1,92 0,046848 -0,28

1417404_at Elovl6 Представитель 6 семейства ELOVL, удлинение длинноцепочечных жирных кислот (дрожжи) 1,90 0,012549 1,55
1417277_at Cyp4f16 Цитохром P450, семейство 4, подсемейство f, полипептид 16 1,87 0,000119 7,50
1422983_at Itgb6 Интегрин-бета 6 1,87 0,03266 0,33
1454746_at Plekhm1 Белок, содержащий домен гомологии плекстрина, семейство M (с доменом RUN), представитель 1 1,86 0,001042 4,88
1425079_at Tm6sf2 Представитель 6 суперсемейства трансмембранного белка 6 1,85 0,001269 4,60
1455099_at Mogat2 Моноацилглицерин-O-ацилтрансфераза 2 1,85 0,024887 0,68
1435749_at Gda Гуаниндезаминаза 1,82 0,002467 3,67
1416488_at Ccng2 Циклин G2 1,81 0,003976 3,09
1418256_at Srf Сывороточный фактор ответа 1,79 0,033108 0,26
1426744_at Srebf2 Фактор 2, связывающий стерин-регуляторный элемент 1,76 0,041026 -0,07
1457253_at Trim40 Белок 40, содержащий тройной мотив 1,75 0,001269 4,61
1433556_at Centa1 Центаурин, альфа 1 1,75 0,009141 2,01
NuGO_emt084792_x_at NA NA 1,74 0,020944 0,92
1417823_at Gcat Глицин C-ацетилтрансфераза (2-амино-3-кетобутират-кофермент-A лигаза) 1,74 0,049235 -0,38

NuGO_emt066282_at Defb37 Дефензин-бета 37 1,74 6,42E-05 8,25
1429550_at Entpd8 Эктонуклеозидтрифосфатдифосфогидролаза 8 1,73 0,004814 2,85
1430594_at Rab11fip1 Взаимодействующий белок 1 семейства RAB11 (класс I) 1,73 0,033108 0,27
1420913_at Slco2a1 Переносчик растворенных веществ семейства транспортеров органических анионов, представитель 2a1 1,73 0,001791 4,09
NuGO_emt043440_at 2210010C17Rik Ген RIKEN cDNA 2210010C17 1,73 0,01702 1,21
1430674_at 1700016C15Rik Ген RIKEN cDNA 1700016C15 1,73 0,036022 0,14
1430890_at 2210010C17Rik Ген RIKEN cDNA 2210010C17 1,72 0,011201 1,68
1417803_at 1110032A04Rik Ген RIKEN cDNA 1110032A04 1,71 0,000358 6,25
1449873_at Bmp8a Морфогенетический белок костей 8a 1,71 0,044796 -0,22
1434130_at Lhfpl2 Белок 2, подобный партнеру слияния HMGIC липомы 1,71 0,004814 2,83
1448605_at Rhoc Семейство генов гомологов Ras, представитель C 1,70 0,001099 4,79
1432363_at 2410018E23Rik Ген RIKEN cDNA 2410018E23 1,69 0,04853 -0,34
1427878_at 0610010O12Rik Ген RIKEN cDNA 0610010O12 1,68 2,48E-05 9,21
1416379_at Panx1 Паннексин 1 1,67 0,002404 3,74
1434059_at B230312A22Rik Ген RIKEN cDNA B230312A22 1,65 0,001763 4,12
1452475_at Pcsk5 Конвертаза пробелков субтилизинового/кексинового типа 5 1,65 0,036022 0,12

1454399_at 2010003H20Rik Ген RIKEN cDNA 2010003H20 1,62 0,016629 1,24
1460550_at Mtmr11 Миотубуларин-родственный белок 11 1,62 0,010762 1,73
NuGO_emt070892_at NA NA 1,62 0,020773 0,95
1436710_at Zswim4 Белок 4 с цинковыми пальцами, содержащий домен SWIM 1,62 0,009718 1,88
1420663_at Zbtb7b Белок 7B с цинковыми пальцами и содержащий домен BTB 1,61 0,042694 -0,13
1418991_at Bak1 BCL2-антагонист/киллер 1 1,61 0,01094 1,71
1417990_at Ppp1r14d Протеинфосфатаза 1, регуляторная (ингибиторная) субъединица 14D 1,59 0,003746 3,16
1452837_at Lpin2 Липин 2 1,58 0,035702 0,16
NuGO_emt021769_s_at Slc17a4 Переносчик растворенных веществ, семейство 17 (фосфат натрия), представитель 4 1,57 0,015878 1,30
1418671_at Capn5 Кальпаин 5 1,57 0,041629 -0,09
1417751_at Stk10 Серин/треониновая киназа 10 1,57 0,027636 0,55
1452294_at Pcdh1 Протокадгерин 1 1,56 0,003042 3,42
1429154_at Slc35f2 Переносчик растворенных веществ, семейство 35, представитель F2 1,56 0,004185 3,02
1450982_at Slc9a3r1 Переносчик растворенных веществ, семейство 9 (обменник натрий/водород), изоформа 3, регулятор 1 1,56 0,008755 2,06

1434015_at Slc2a6 Переносчик растворенных веществ, семейство 2 (облегченный транспортер глюкозы), представитель 6 1,55 0,005093 2,72
1418712_at Cdc42ep5 Эффекторный белок CDC42 (связывающий GTP-азу Rho) 5 1,55 0,003976 3,09
1424809_at Crb3 Гомолог 3 Crumbs (Drosophila) 1,53 0,014107 1,43
1428953_at Otud7b Белок 7B, содержащий домен OTU 1,53 0,035702 0,17
1424090_at Sdcbp2 Синдекан-связывавющий белок (синтенин) 2 1,53 0,023574 0,76
1418215_at Mep1b Меприн 1 бета 1,53 0,027636 0,55
1434456_at Gm440 Модель гена 440, (NCBI) 1,53 0,032752 0,32
1423521_at Lmnb1 Ламин B1 1,53 0,007369 2,31
1425298_a_at Naip1 Семейство NLR, белок-ингибитор апоптоза 1 1,51 0,002438 3,70
1456619_at Liph Липаза, представитель H 1,50 0,044796 -0,22
1418976_s_at Cideb Индуцирующий гибель клеток фактор фрагментации ДНК, подобный альфа-субъединице эффектор B 1,49 0,020944 0,93
1423376_a_at Dok4 Белок стыковки 4 1,49 0,005089 2,73
1415793_at Pnpo Пиридоксин 5'-фосфатоксидаза 1,48 0,00252 3,63
1435461_at Magi3 Мембраноассоциированная гуанилаткиназа 3, содержащая домен WW и PDZ 1,48 0,001623 4,23

1444951_at BC042698 Последовательность кДНК BC042698 1,45 0,042694 -0,14
1452214_at Skil SKI-подобный белок 1,45 0,020383 0,99
1426284_at Krt20 Кератин 20 1,43 0,021519 0,88
1460406_at AI427122 Экспрессируемая последовательность AI427122 1,42 0,016225 1,27
1419331_at Cdh17 Кадгерин 17 1,41 0,009399 1,94
1428509_at Myo1e Миозин IE 1,41 0,043727 -0,17
1429117_at Tradd Белок, ассоциированный с TNFRSF1A через домен смерти 1,41 0,020944 0,91
1460681_at Ceacam2 CEA-связанная молекула 2 клеточной адгезии 1,41 0,036022 0,14
1455678_at NA NA 1,41 0,048555 -0,36
1440218_at BC040758 Последовательность кДНК BC040758 1,41 0,026321 0,62
1416009_at Tspan3 Тетраспанин 3 1,40 0,002052 3,91
1456200_at Ipmk Инозитолполифосфатмультикиназа 1,40 0,033108 0,28
1424126_at Alas1 Синтаза 1 аминолевулиновой кислоты 1,39 0,040391 -0,03
1434482_at D4Ertd22e Сегмент ДНК, Chr 4, ERATO Doi 22, экспрессируемый 1,39 0,038213 0,05
1416690_at Gtpbp2 GTP-связывающий белок 2 1,38 0,035702 0,16
1417895_a_at Tmem54 Трансмембранный белок 54 1,38 0,001332 4,53
1424245_at Ces2 Карбоксилэстераза 2 1,37 0,020383 0,99
1434559_at Stx3 Синтаксин 3 1,37 0,032755 0,31
1426733_at Itpk1 Инозитол-1,3,4-трифосфат 5/6 киназа 1,35 0,010099 1,81

1451139_at Slc39a4 Переносчик растворенных веществ, семейство 39 (транспортер цинка), представитель 4 1,34 0,04853 -0,34
1417398_at Rras2 Гомолог 2 родственного RAS вирусного (r-ras) онкогена 1,34 0,040085 -0,02
1427203_at Myo15b Миозин XVB 1,33 0,020944 0,92
1428331_at 2210016F16Rik Ген RIKEN cDNA 2210016F16 1,32 0,047659 -0,30
1427128_at Ptpn23 Протеинтирозинфосфатаза, нерецепторный тип 23 1,31 0,042694 -0,13
1420426_at Myo7b Миозин VIIb 1,30 0,036022 0,13
1452304_a_at Arhgef5 Фактор 5 обмена гуаниновыми нуклеотидами (GEF) Rho 1,30 0,047797 -0,31
1434303_at Raph1 Домены 1 ассоциации с Ras (RalGDS/AF-6) и гомологии с плекстрином 1,29 0,024887 0,69
1433885_at AI788777 Экспрессируемая последовательность AI788777 1,28 0,018321 1,10
1415765_at Hnrpul2 Гетерогенный ядерный рибонуклеопротеин, U-подобный, 2 1,28 0,009181 2,00
1448110_at Sema4a Домен Sema, домен иммуноглобулина (Ig), трансмембранный домен (TM) и короткий цитоплазматический домен, (семфорин) 4A 1,27 0,00151 4,40
1423960_at Mboat5 Белок 5, содержащий мембраносвязанный домен O-ацилтрансферазы домен 1,27 0,043727 -0,18

1415676_a_at Psmb5 Субъединица протеасомы (просома, макропаин), бета-типа 5 1,27 0,040399 -0,04
1434345_at Clrn3 Кларин 3 1,27 0,027133 0,59
1426014_a_at Mucdhl Белок, подобный муцину и кадгерину 1,27 0,036152 0,11
1420503_at Slc6a14 Переносчик растворенных веществ, семейство 6 (транспортер нейтротрансмиттера), представитель 14 1,26 0,001582 4,31
1418817_at Chmp1b Модифицирующий хрматин белок 1B 1,25 0,004961 2,78
1423686_a_at Prr13 Пролин-богатый белок 13 1,25 0,026919 0,60
1420826_at Letm1 Трансмембранный белок 1, содержащий лейциновую молнию-EF-hand 1,24 0,036022 0,13
1448618_at Mvp Главный белок vault 1,24 0,031006 0,39
1417178_at Gipc2 Семейство, содержащее домен GIPC PDZ, представитель 2 1,24 0,014863 1,38
1416627_at Spint1 Ингибитор сериновой протеазы, Kunitz-типа 1 1,23 0,048555 -0,36
1428163_at Sar1b Гомолог B гена SAR1 (S. cerevisiae) 1,22 0,036022 0,13
1416193_at Car1 Карбоангидраза 1 1,21 0,009728 1,87
1444884_at Ppt1 Пальмитоил-протеинтиоэстераза 1 1,18 0,032755 0,31
1448279_at Arpc3 Комплекс актин-связанного белка 2/3, субъединица 3 1,14 0,049367 -0,38
1417282_at Mmp23 Матриксная металлопептидаза 23 -1,14 0,024366 0,72

1429615_at Zfp91 Белок с цинковыми пальцами 91 -1,22 0,038424 0,04
1453577_at 2610018I03Rik Ген RIKEN cDNA 2610018I03 -1,22 0,04853 -0,35
1417999_at Itm2b Интегральный мембранный белок 2B -1,22 0,020944 0,91
1454994_at Klhl20 Kelch-подобный 20 (Drosophila) -1,24 0,040433 -0,05
1435563_at Mrps5 Митохондриальный рибосомальный белок S5 -1,25 0,022222 0,84
1445561_at NA NA -1,27 0,04853 -0,34
1436854_at Trpc2 Неустойчивый катионный канал рецепторного потенциала, подсемейство C, представитель 2 -1,27 0,002008 3,97
1416452_at Oat Орнитинаминотрансфераза -1,27 0,009757 1,86
1415961_at Itm2c Интегральныймембранный белок 2C -1,28 0,007369 2,28
1448933_at Pcdhb17 Протокадгерин-бета 17 -1,28 0,048555 -0,35
1440391_at Gcn1l1 Белок 1, подобный белку 1 общего контроля синтеза аминокислот GCN1 (дрожжи) -1,29 0,030585 0,42
1450788_at Saa1 Сывороточный амилоид A 1 -1,31 0,001623 4,23
1444451_at Pappa2 Паппализин 2 -1,31 0,038548 0,03
1457029_at C030010B13Rik Ген RIKEN cDNA C030010B13 -1,31 0,023793 0,74
1417088_at Zfp346 Белок с цинковыми пальцами 346 -1,33 0,039077 0,01
1436220_at Zfp287 Белок с цинковыми пальцами 287 -1,33 0,022441 0,82
1445824_at Zfp458 Белок с цинковыми пальцами 458 -1,37 0,044011 -0,18
1420191_s_at D16Bwg1494e Сегмент ДНК, Chr 16, Brigham & Women's Genetics 1494, экспрессируемый -1,37 0,035165 0,19

1415871_at Tgfbi Трансформирующий фактор роста, бета, индуцируемый -1,38 0,039653 0,00
1442731_at 9030416H16Rik Ген RIKEN cDNA 9030416H16 -1,41 0,012107 1,59
1424889_at Nupl2 Нуклеопорин-подобный белок 2 -1,42 0,001582 4,31
1416178_a_at Plekhb1 Белок, содержащий домен гомологии с плекстрином, семейство B (эвектины) представитель 1 -1,44 0,047797 -0,32
1447946_at Adam23 Домен 23 дезинтегрина A и металлопептидазы -1,44 0,017961 1,13
NuGO_emt080869_at NA NA -1,45 0,032755 0,31
1452050_at Camk1d Кальций/кальмодулин-зависимая протеинкиназа ID -1,45 0,006002 2,56
1442447_at Znrf3 Белок с цинковыми и кольцевыми пальцами 3 -1,45 9,00E-06 10,24
1416865_at Fgd1 Белок 1, содержащий домен FYVE, RhoGEF и PH -1,46 0,049235 -0,37
1442197_at AI480624 Экспрессируемая последовательность AI480624 -1,47 0,033108 0,27
1427020_at Scara3 Рецептор-мусорщик класса A, представитель 3 -1,47 0,029906 0,45
1434961_at Asb1 Белок 1, содержащий анкириновый повтор и SOCS-бокс -1,48 0,0093 1,97

1431873_a_at Tube1 Эпсилон-тубулин 1 -1,48 0,033108 0,26
1424367_a_at Homer2 Гомолог 2 Homer (Drosophila) -1,49 0,00269 3,56
1441662_at Cyp4x1 Цитохром P450, семейство 4, подсемейство x, полипептид 1 -1,50 0,028455 0,51
1429086_at Grhl2 Grainyhead-подобный 2 (Drosophila) -1,51 0,04298 -0,15
1439078_at Klhl4 Kelch-подобный 4 (Drosophila) -1,52 0,020679 0,96
1451194_at Aldob Альдолаза 2, B-изоформа -1,54 0,002438 3,70
1449913_at Zfp2 Белок с цинковыми пальцами 2 -1,55 0,033108 0,29
1431820_at 4632404H12Rik Ген RIKEN cDNA 4632404H12 -1,56 0,036071 0,12
1437900_at 4930523C07Rik Ген RIKEN cDNA 4930523C07 -1,56 0,044391 -0,20
1449462_at 3110049J23Rik Ген RIKEN cDNA 3110049J23 -1,57 0,041709 -0,09
1457373_at Cdh19 Кадгерин 19, типа 2 -1,57 0,032755 0,31
1423072_at 6720475J19Rik Ген RIKEN cDNA 6720475J19 -1,58 0,006244 2,51
1422542_at Gpr34 Сопряженный с G-белком рецептор 34 -1,58 0,040399 -0,04
1448475_at Olfml3 Ольфактомедин-подобный 3 -1,58 0,032964 0,30
1417676_a_at Ptpro Протеинтирозинфосфатаза, рецепторного типа, O -1,59 0,001623 4,24
1456763_at AA536749 Экспрессируемая последовательность AA536749 -1,59 0,017774 1,15
1417732_at Anxa8 Аннексин A8 -1,59 0,027267 0,57
1425510_at Mark1 MAP/регулирующая аффинност микротрубочек киназа 1 -1,60 0,004814 2,85

1417234_at Mmp11 Матриксная металлопептидаза 11 -1,61 0,036152 0,11
1416194_at Cyp4b1 Цитохром P450, семейство 4, подсемейство b, полипептид 1 -1,62 0,002404 3,74
1429679_at Fbxl13 Белок 13 с F-боксом и лейцин-богатым повтором -1,64 0,010507 1,76
1428260_at Spg3a Гомолог 3A белка спастической параплегии (человека) -1,68 0,007369 2,28
1426413_at Neurod1 Белок нейрогенной дифференцировки 1 -1,68 0,009718 1,88
1455500_at Rnf213 Белок с кольцевыми пальцами 213 -1,68 0,017961 1,13
1456532_at Pdgfd Тромбоцитарный фактор роста, полипептид D -1,70 0,008375 2,11
1419754_at Myo5a Миозин Va -1,71 0,020595 0,97
1460147_at NA NA -1,71 0,037207 0,08
1440014_at Pacs1 Кислотный белок кластерной сортировки фосфофурин 1 -1,72 7,34E-05 8,05
1451342_at Spon1 Спондин 1, внеклеточный матриксный белок (f-спондин) -1,73 0,045023 -0,23
1438530_at Tfpi Ингибитор каскада тканевого фактора -1,76 0,001582 4,29
1449563_at Cntn1 Контактин 1 -1,77 0,029208 0,48
1435829_at B930008K04Rik Ген RIKEN cDNA B930008K04 -1,78 0,004961 2,78
NuGO_emt010210_at Cacna2d2 Кальциевый канал, потенциалзависимый, альфа 2/дельта субъединица 2 -1,80 0,035702 0,17
1455633_at Zfp647 Белок с цинковыми пальцами 647 -1,80 0,041245 -0,08

1420416_at Sema3a домен Sema, домен иммуноглобулина (Ig), короткий основный домен, секретируемый, (семафорин) 3A -1,81 0,000506 5,78
1417644_at Sspn Саркоспан -1,83 0,003984 3,08
1419687_at D930010J01Rik Ген RIKEN cDNA D930010J01 -1,83 0,045963 -0,25
1439618_at Pde10a Фосфодиэстераза 10A -1,83 0,017774 1,16
1440430_at Elp4 Гомолог белка элонгации 4 (S. cerevisiae) -1,84 0,023065 0,79
1425069_at BC018285 Последовательность кДНК BC018285 -1,84 0,042264 -0,11
1419376_at 1110018M03Rik Ген RIKEN cDNA 1110018M03 -1,85 0,009718 1,88
1434194_at Mtap2 Ассоциированный с микротрубочками белок 2 -1,85 0,007048 2,36
1459707_at Pacs1 Кислотный белок клестерной сортировки фосфофурин 1 -1,86 0,004814 2,86
1434475_at Ppig Пептидил-пролилизомераза G (циклофилин G) -1,86 0,045576 -0,24
1449158_at Kcnk2 Калиевый канал, подсемейство K, представитель 2 -1,87 0,004961 2,77
1460606_at Hsd17b13 Дегидрогеназа 13 гидроксистероидов (17-бета) -1,88 0,003153 3,38
1436087_at Dpp10 Дипептидилпептидаза 10 -1,89 0,043727 -0,17
NuGO_emt029633_at Npy2r Нейропептид Y, рецептор Y2 -1,90 0,000199 6,88
1418606_at Hoxd10 Гомеобокс D10 -1,91 0,007866 2,18

1417411_at Nap1l5 Белок 5, подобный белку 1 сборки нуклеосом -1,91 0,047023 -0,29
NuGO_emt034831_at Nr2e3 Ядерный рецептор, подсемейство 2, группа E, представитель 3 -1,91 0,040798 -0,06
1434740_at Scarf2 Рецептор-мусорщик, класс F, представитель 2 -1,91 0,046195 -0,26
1420858_at Pkia Ингибитор протеинкиназ, альфа -1,92 0,003616 3,21
1457072_at Bcl11a Белок B-клеточной CLL/лимфомы 11A (белок с цинковыми пальцами) -1,93 0,04853 -0,35
1428347_at Cyfip2 Цитоплазматический взаимодействующий с FMR1 белок 2 -1,93 0,000484 5,87
1448823_at Cxcl12 Лиганд 12 хемокинов (C-X-C мотив) -1,95 0,007369 2,28
1436051_at Myo5a Миозин Va -1,95 0,000596 5,61
1425065_at Oas2 2'-5'-олигоаденилатсинтетаза 2 -1,96 0,032484 0,34
1454876_at Rab23 RAB23, представитель семейства онкогенов RAS -1,97 0,029208 0,48
NuGO_emt022150_at Cartpt Препропептид CART -1,98 0,008035 2,16
1423396_at Agt Ангиотензиноген (ингибитор пептидазы серпинов, клад A, представитель 8) -1,98 0,017774 1,15
1418213_at Krt23 Кератин 23 -1,99 0,031284 0,38
1444670_at Smyd3 Белок 3, содержащий домен SET и MYND -2,02 0,022766 0,80
1453251_at Dhx30 Полипептид 30 бокса DEAH (Asp-Glu-Ala-His) -2,03 0,027622 0,56

1440925_at Rhoq Семейство генов гомологов Ras, представитель Q -2,05 0,031006 0,40
1422640_at Pcdhb9 Протокадгерин-бета 9 -2,07 0,015304 1,34
1450708_at Scg2 Секретогранин II -2,09 0,010099 1,81
1435673_at Hoxd3 Гомеобокс D3 -2,09 0,029426 0,47
1416710_at Tmem35 Трансмембранный белок 35 -2,10 0,007507 2,24
1423150_at Scg5 Секретогранин V -2,11 0,002438 3,69
1418392_a_at Gbp3 Белок 3, связывающий гуанилатные нуклеотиды -2,11 0,020383 0,99
1436566_at Rab40b Rab40b, представитель семейства онкогенов RAS -2,12 0,003512 3,25
1441231_at EG665123 Спрогнозированный ген, EG665123 -2,14 0,035789 0,15
1419349_a_at Cyp2d9 Цитохром P450, семейство 2, подсемейство d, полипептид 9 -2,14 0,003512 3,25
1445481_at AI317158 Экспрессированная последовательность AI317158 -2,18 0,033108 0,26
1443698_at Fbxo39 Белок 39 с F-box -2,19 0,009359 1,95
1424900_at Slc29a4 Переносчик растворенных веществ, семейство 29 (нуклеозидные транспортеры), представитель 4 -2,22 0,001105 4,77
1419185_a_at Mlxipl Белок, подобный MLX-взаимодействующему белку -2,23 0,000867 5,09
1435504_at Clip4 Семейство линкерных белков, содержащих домен CAP-GLY, представитель 4 -2,24 0,006244 2,51

1438868_at Phf11 Белок 11 с пальцами PHD -2,24 0,000857 5,12
1422860_at Nts Нейротензин -2,28 1,04E-09 19,02
1451860_a_at Trim30 Белок 30 с тройным мотивом -2,28 0,038792 0,03
1434788_at D930050A07Rik Ген RIKEN cDNA D930050A07 -2,33 0,009359 1,95
1450684_at Etv1 Ген 1 варианта Ets -2,38 0,000606 5,57
1433536_at Lrp11 Белок 11, родственный рецептору липопротеинов низкой плотности -2,39 0,000793 5,21
NuGO_emt060551_at 9030421J09Rik Ген RIKEN cDNA 9030421J09 -2,44 0,044497 -0,20
1428758_at Tmem86a Трансмембранный белок 86A -2,45 0,004961 2,76
1445881_at NA NA -2,54 0,031006 0,39
1451426_at D11Lgp2e Сегмент ДНК, Chr 11, Lothar Hennighausen 2, экспрессируемый -2,55 0,0093 1,98
1416639_at Slc2a5 Переносчик растворенных веществ, семейство 2 (облегченный транспортер глюкозы), представитель 5 -2,67 0,006738 2,43
1429313_at Ror1 Подобный рецепторной тирозинкиназе сиротский рецептор 1 -2,70 0,001269 4,59
1433184_at 6720477C19Rik Ген RIKEN cDNA 6720477C19 -2,72 0,017774 1,16
1419136_at Akr1c18 Альдо-кето редуктаза, семейство 1, представитель C18 -2,77 0,0113 1,66
1418113_at Cyp2d10 Цитохром P450, семейство 2, подсемейство d, полипептид 10 -2,79 0,000483 5,90

1417988_at Resp18 Регулируемый специфический для эндокринной системы белок 18 -2,83 0,003512 3,26
1453196_a_at Oasl2 Белок 2, подобный 2'-5' олигоаденилатсинтетазе -2,84 0,011794 1,62
1423555_a_at Ifi44 Интерферон-индуцируемый белок 44 -2,86 0,042694 -0,13
1449939_s_at Dlk1 Гомолог Delta-подобного белка 1 (Drosophila) -2,99 5,20E-10 19,73
NuGO_emt091063_at NA NA -3,08 0,000637 5,49
1436998_at Ankrd43 Домен 43 с анкириновыми повторами -3,13 0,001056 4,85
1418293_at Ifit2 Интерферон-индуцируемый белок с тетратрикопептидными повторами 2 -3,14 0,000637 5,44
NuGO_emt044299_at Sstr1 Рецептор соматостатина 1 -3,16 2,31E-08 16,00
1421492_at Ptgds2 Синтаза 2 простагландина D2, гемопоэтическая -3,18 7,03E-05 8,13
1449025_at Ifit3 Интерферон-индуцируемый белок с тетратрикопептидными повторами -3,34 0,007674 2,21
1455528_at NA NA -3,47 0,002046 3,94
1429273_at Bmper BMP-связывающий эндотелиальный регулятор -3,55 0,000199 6,93
1425952_a_at Gcg Глюкагон -3,68 3,98E-09 17,68
1448628_at Scg3 Секретогранин III -3,77 1,61E-08 16,39
1448201_at Sfrp2 Секретируемый frizzled-родственный белок 2 -4,18 0,000257 6,62

1418191_at Usp18 Убиквитин-специфическая пептидаза 18 -4,45 0,046848 -0,28
1449493_at Insl5 Инсулин-подобный 5 -9,54 5,98E-16 30,51
1419473_a_at Cck Холицистокинин -11,97 1,17E-11 23,32

Таблица S4C
Транскрипты, дифференциально экспрессируемые в подвздошной кишке на 14 сутки между животными, которым инокулировали R. hominis, и безмикробными животными
ID Обозначение Название FC Значение P B
1427343_at Rasd2 Семейство RASD, представитель 2 4,21 0,008352 3,02
1420673_a_at Acox2 Ацил-кофермент A оксидаза 2, разветвленная цепь 3,37 0,023445 1,29
1418174_at Dbp Белок, связывающий промотор D-участка альбумина 3,26 0,04708 0,16
1434116_at Cbx2 Гомолог 2 хромобокса (Drosophila Pc class) 3,15 0,01298 2,21
1456284_at Tmem171 Трансмембранный белок 171 2,94 0,011378 2,45
1460713_at BC048355 Последовательность кДНК BC048355 2,61 0,035037 0,67
1438689_at 4632433K11Rik Ген RIKEN cDNA 4632433K11 2,41 0,04048 0,41
1460187_at Sfrp1 Секретируемый белок 1 с frizzled-родственной последовательностью 2,37 0,021033 1,51
1420645_at Pcgf2 Кольцевой палец 2 группы Polycomb 2,31 0,003987 4,19

1455547_at Zc3h7b Белок 7B, содержащий цинковые пальцы типа CCCH 2,16 0,008352 2,98
1416258_at Tk1 Тимидинкиназа 1 2,12 0,017451 1,78
1449845_a_at Ephb4 Eph-рецептор B4 2,12 0,033002 0,77
1455120_at Hpdl Белок, подобный 4-гидроксифенилпируватдиоксигеназе 2,07 0,023445 1,30
1417399_at Gas6 Белок 6, специфический для остановки роста 2,06 0,000167 8,81
1452862_at Rreb1 Белок 1, связывающий отвечающий на Ras элемент 2,05 0,03901 0,47
1455246_at NA NA 2,02 0,032868 0,78
1434322_at Micall2 Белок 2, подобный MICAL 1,99 0,009875 2,69
1428207_at Bcl7a Белок 7A B-клеточной CLL/лимфомы 1,99 0,04708 0,11
1420845_at Mrps2 Митохондриальный рибосомальный белок S2 1,97 0,042267 0,36
1444254_at NA NA 1,96 0,025132 1,19
1448656_at Cacnb3 Кальциевый канал, потенциалзависимый, субъединица бета-3 1,96 0,032019 0,86
1434908_at AI480556 Экспрессируемая последовательность AI480556 1,95 0,029591 0,99
1424376_at Cdc42ep1 Эффекторный белок CDC42 (связывающий GTP-азу Rho) 1 1,89 0,01298 2,20
1430274_a_at Stard3nl Белок, подобный N-концу STARD3 1,88 0,008596 2,92

1416513_at Lamb2 Ламинин, бета 2 1,87 0,016398 1,89
1416536_at Mum1 Ассоциированный с меланомой антиген (мутантный) 1 1,86 0,025132 1,17
NuGO_emt084041_s_at Defcr20 Дефензин-связанный криптидин 20 1,84 0,020502 1,55
1418320_at Prss8 Протеаза, серин, 8 (простатин) 1,83 0,021033 1,49
1455163_at Guf1 Гомолог GTP-азы GUF1 (S. cerevisiae) 1,80 0,02461 1,22
1436665_a_at Ltbp4 Латентный связывающий трансформирующий фактор роста белок 4 1,80 0,036581 0,57
1420643_at Lfng Гомолог гена Lunatic fringe (Drosophila) 1,79 0,003248 4,57
1428695_at 9130227C08Rik Ген RIKEN cDNA 9130227C08Rik 1,79 0,036167 0,59
1453018_at Nvl Ядерный VCP-подобный белок 1,77 0,035037 0,65
1419101_at Sin3a Регулятор транскрипции, SIN3A (дрожжи) 1,76 0,030882 0,91
1424459_at Aytl2 Белок 2, подобный ацилтрансферазе 1,74 0,039921 0,43
1415935_at Smoc2 SPARC-родственный модульный кальций-связывающий белок 2 1,73 0,04615 0,19
1424618_at Hpd Диоксигеназа 4-гидроксифенилпировиноградной кислоты 1,73 0,03901 0,47
1426297_at Tcfe2a Фактор транскрипции E2a 1,73 0,002215 5,11
1425391_a_at Osbpl5 Белок 5, подобный оксистерин-связывающему белку 1,73 0,04615 0,19

1455719_at Tubb5 Тубулин, бета 5 1,73 0,032477 0,82
1451912_a_at Fgfrl1 Белок 1, подобный фибробластному фактору роста 1,73 0,02321 1,33
1429582_at Btbd14a Белок 14A, содержащий домен BTB (POZ) 1,72 0,003987 4,21
1454777_at Slco2b1 Переносчик растворенных веществ, семейство транспортеров органических анионов, представитель 2b1 1,70 0,01298 2,22
1424101_at Hnrpl Гетерогенный ядерный рибонуклеопротеин L 1,69 0,044481 0,25
1448691_at Ubqln4 Убиквилин 4 1,65 0,016054 1,92
1417604_at Camk1 Кальций/кальмодулин-зависимая протеинкиназа I 1,63 0,033233 0,74
1442757_at Lrch1 Белок 1, содержащий лейцин-богатые повторы и домен гомологии с кальпонином (CH) 1,63 0,007505 3,30
1460675_at Igsf8 Суперсемейство иммуноглобулинов, представитель 8 1,62 0,04708 0,13
1418671_at Capn5 Кальпаин 5 1,58 0,04708 0,15
1426897_at Rcc2 Регулятор 2 конденсации хромосом 1,57 0,035037 0,65
1417594_at Gkap1 Заякоривающий G-киназу белок 1 1,52 0,019831 1,60
1433539_at Commd3 Белок, содержащий домен 3 COMM 1,51 0,009875 2,72
1435469_at Qscn6l1 Белок 1, подобный квиесцину Q6 1,51 0,041412 0,38
1448561_at Ncf2 Цитозольный фактор 2 нейтрофилов 1,51 0,044087 0,30

1427022_at Ddx42 Полипептид 42 с боксом DEAD (Asp-Glu-Ala-Asp) 1,50 0,01872 1,67
1416030_a_at Mcm7 Белок 7 дефекта поддержания минихромосом (S. cerevisiae) 1,49 0,02321 1,34
1450023_at Gtpbp1 GTP-связывающий белок 1 1,48 0,044113 0,27
1417879_at Nenf Происходящий из нейронов нейротрофический фактор 1,48 0,03901 0,46
1424640_at Arl8a Белок 8A, подобный фактору рибозилирования ADP 1,47 0,044113 0,28
1418982_at Cebpa CCAAT/энхансер-связывающий белок (C/EBP), альфа 1,47 0,036167 0,60
1428382_at Smarcc2 SWI/SNF-регулируемый, ассоциированный с матриксом, актин-зависимый регулятор хроматина, подсемейство c, представитель 2 1,47 0,044113 0,28
1434134_at Wdr42a Домен 42A с повторами WD 1,45 0,009875 2,74
1450519_a_at Prkaca Протеинкиназа, cAMP-зависимая, каталитическая, альфа 1,44 0,008352 2,99
1451306_at Cdca7l Белок, подобный белку 7, ассоциированному с циклом деления клеток 1,44 0,035037 0,65
1426724_at Cnn3 Кальпонин 3, кислотный 1,44 0,033105 0,76
1424644_at Tbcc Тубулин-специфический шаперон c 1,42 0,032128 0,85

1417266_at Ccl6 Лиганд 6 хемокинов (C-C мотив) 1,42 0,021206 1,47
1415975_at Carhsp1 Кальций-регулируемый термостабильный белок 1 1,38 0,014132 2,10
1448277_at Pold2 Полимераза (ДНК-контролируемая), дельта 2, регуляторная субъединица 1,38 0,044481 0,24
1433736_at Hcfc1 Фактор C1 клеток-хозяев 1,35 0,035162 0,64
1435149_at Plcg1 Фосфолипаза C, гамма 1 1,35 0,036167 0,59
1417500_a_at Tgm2 Трансглутаминаза 2, полипептид C 1,33 0,022457 1,39
1428125_at 4921506J03Rik Ген RIKEN cDNA 4921506J03 1,32 0,030752 0,92
1452100_at Dullard Гомолог Dullard (Xenopus laevis) 1,32 0,030391 0,94
1448148_at Grn Гранулин 1,30 0,011783 2,33
1451984_at Hnrpul1 Гетерогенный ядерный рибонуклеопротеин U-подобный 1 1,30 0,016884 1,85
1426401_at Ppp3ca Протеинфосфатаза 3, каталитическая субъединица, альфа-изоформа 1,29 0,009875 2,72
1428380_at 0610007C21Rik Ген RIKEN cDNA 0610007C21 1,26 0,043354 0,32
1418364_a_at Ftl1 Легкая цепь 1 ферритина 1,24 0,01702 1,82
1456854_at Neurl Neuralized-подобный гомолог (Drosophila) -1,18 0,031207 0,89
1448853_at Synj2bp Белок, связывающий синаптоянин 2 -1,19 0,04708 0,15
1416281_at Wdr45l Wdr45-подобный -1,22 0,016971 1,84
1418843_at Slc30a4 Переносчик растворенных веществ, семейство 30 (переносчик цинка), представитель 4 -1,30 0,037239 0,54

1459557_at Zbtb16 Белок 16 с цинковыми пальцами и содержащий домен BTB -1,31 0,001423 5,62
1418116_at Ifrg15 Ген, отвечающий на интерферон-альфа -1,32 0,038411 0,50
1448762_at Rad17 Гомолог RAD17 (S. pombe) -1,32 0,044087 0,30
1435461_at Magi3 Мембраноассоциированная гуанилаткиназа, содержащая домен 3 WW и PDZ -1,33 0,044113 0,26
1434835_at Wapal Wings apart-подобный гомолог (Drosophila) -1,33 0,046851 0,17
1444328_at NA NA -1,34 0,010408 2,57
NuGO_emt073151_at Nlrp9b Белок 9B семейства NLR, содержащий домен пирина -1,34 0,045959 0,20
1427269_at Sfrs11 Фактор сплайсинга, аргинин/серин-богатый 11 -1,35 0,02461 1,22
1436157_at Ccar1 Регулятор 1 деления клеток и апоптоза -1,36 0,021206 1,46
NuGO_emt081039_at Eif4e1b Эукариотический фактор инициации трансляции 4E, представитель семейства 1B -1,38 0,037239 0,54
1422217_a_at Cyp1a1 Цитохром P450, семейство 1, подсемейство a, полипептид 1 -1,38 0,005253 3,71
1434654_at Cog3 Компонент 3 олигомерного комплекса Гольджи -1,38 0,03901 0,46

1421680_at NA NA -1,39 0,044113 0,28
1424296_at Gclc Глутамат-цистеинлигаза, каталитическая субъединица -1,41 0,023137 1,36
1440722_at D19Ertd386e Сегмент ДНК, Chr 19, ERATO Doi 386, экспрессируемый -1,41 0,008352 3,15
1429849_at 4632411B12Rik Ген RIKEN cDNA 4632411B12 -1,44 0,015927 1,94
1451407_at Jam4 Соединительная молекула адгезии 4 -1,44 0,015521 1,99
1424324_at Esco1 Белок образования спаек 1 гомолог 1 (S. cerevisiae) -1,47 0,010277 2,60
1441403_at 6430501K19Rik Ген RIKEN cDNA 6430501K19 -1,47 0,019952 1,59
1453160_at Thrap1 Белок 1, ассоциированный с рецептором гормонов щитовидной железы -1,48 0,034193 0,71
1432962_at 2610024D14Rik Ген RIKEN cDNA 2610024D14 -1,49 0,018436 1,70
1456896_at 6720462K09Rik Ген RIKEN cDNA 6720462K09 -1,50 0,011783 2,34
1444705_at App Белок-предшественник амилоида-бета (A4) -1,50 0,032477 0,80
1426886_at Cln5 Белок нейронного восковидного липофусциноза, нейрональный 5 -1,52 0,01702 1,81
1459059_at 2010308F09Rik Ген RIKEN cDNA 2010308F09 -1,53 0,008352 2,97
1436616_at R74740 Экспрессируемая последовательность R74740 -1,55 0,011378 2,44
1453269_at Unc5b Гомолог B Unc-5 (C. elegans) -1,55 0,018436 1,70
1424536_at Oas1e 2'-5'-олигоаденилатсинтаза 1E -1,55 0,008352 3,08

1444565_at NA NA -1,56 0,005253 3,70
1448049_at Jmjd1c Белок 1C, содержащий домен Jumonji -1,58 0,02321 1,33
1441546_at Mpp6 Мембранный белок, пальмитоилированный 6 (представитель 6 подсемейства MAGUK p55) -1,58 0,009875 2,70
1442605_at Bach2 Белок 2 гомологии BTB и CNC -1,59 0,032477 0,80
1451415_at 1810011O10Rik Ген RIKEN cDNA 1810011O10 -1,66 0,023445 1,29
1436637_at Eif4h Эукариотический фактор инициации трансляции 4H -1,66 0,011571 2,40
1453457_at Sri Сорцин -1,67 0,024152 1,25
1429680_at Tra2a Гомолог трансформера 2 альфа (Drosophila) -1,68 0,033105 0,75
1429624_at Sltm SAFB-подобный модулятор транскрипции -1,68 0,036906 0,56
1429870_at Tnik Киназа, взаимодействующая с TRAF2 и NCK -1,72 0,001356 5,94
1444065_at Cyb5d2 Белок 2, содержащий домен цитохрома b5 -1,72 0,000237 8,03
1424208_at Ptger4 Рецептор 4 простагландина E (подтип EP4) -1,74 0,029592 0,98
1452837_at Lpin2 Липин 2 -1,74 0,011783 2,33
1448185_at Herpud1 Индуцируемый гомоцистеином, индуцируемый стрессом, содержащий убиквитин-подобный домен представитель 1 эндоплазматической сети -1,75 0,002895 4,81

1432719_at 4833412K13Rik Ген RIKEN cDNA 4833412K13 -1,76 0,04708 0,13
1437868_at BC023892 Последовательность кДНК BC023892 -1,76 0,044113 0,28
1433101_at 9030419F21Rik Ген RIKEN cDNA 9030419F21 -1,77 0,008596 2,90
1451621_at 5830417C01Rik Ген RIKEN cDNA 5830417C01 -1,77 0,00495 3,81
1432423_a_at C530008M17Rik Ген RIKEN cDNA C530008M17 -1,78 0,01164 2,38
1429399_at Rnf125 Белок 125 с кольцевыми пальцами -1,84 0,033002 0,77
1453264_at Marveld3 Белок 3, содержащий домен MARVEL (мембраноассоциирующий) -1,86 4,82E-05 10,38
1454343_at Ppapdc1 Белок 1, содержащий домен типа 2 фосфатазы фосфатидной кислоты -1,88 0,003658 4,42
1435571_at A530065I17Rik Ген RIKEN cDNA A530065I17 -1,90 0,015795 1,96
1443164_at NA NA -1,91 0,010163 2,63
1437776_at Tmcc1 Трансмембранные и биспиральные домены 1 -1,91 0,028192 1,04
1442111_at D430033H22Rik Ген RIKEN cDNA D430033H22 -1,91 0,007072 3,40
1424451_at Acaa1b Ацилтрансфераза 1B ацетил-кофермента A -1,92 0,035037 0,67
1459879_at 4921513D23Rik Ген RIKEN cDNA 4921513D23 -1,92 0,008352 2,99
1428776_at Slc10a6 Переносчик растворенных веществ, семейство 10 (семейство котранспортера натрия/желчных кислот), представитель 6 -1,92 0,011378 2,45

1458079_at Usp40 Убиквитинспецифическая пептидаза 40 -1,93 0,004696 3,98
1442897_at 2610024E20Rik Ген RIKEN cDNA 2610024E20 -1,95 0,00402 4,15
1455744_at Tmem181 Трансмембранный белок 181 -1,97 0,037843 0,52
1449385_at Hsd17b6 Дегидрогеназа 6 гидроксистероидов (17-бета) -1,98 0,025132 1,18
1443068_at D130084N16Rik Ген RIKEN cDNA D130084N16 -1,98 0,04708 0,11
1419582_at Cyp2c55 Цитохром P450, семейство 2, подсемейство c, полипептид 55 -1,99 0,042267 0,35
1457801_at 9930024M15Rik Ген RIKEN cDNA 9930024M15 -2,01 0,04708 0,13
1438331_at Ypel2 Yippee-подобный 2 (Drosophila) -2,02 0,037843 0,51
1428833_at 4930406D14Rik Ген RIKEN cDNA 4930406D14 -2,04 0,015418 2,01
1419388_at Tm4sf20 Трансмембранный представитель 20 семейства 4 L six -2,05 0,010163 2,65
1455510_at Spop Белок Speckle-типа POZ -2,08 0,023445 1,29
1444178_at ENSMUSG00000052976 Спрогнозированный ген, ENSMUSG00000052976 -2,09 0,029592 0,97
1443159_at Txnrd1 Тиоредоксинредуктаза 1 -2,10 0,04708 0,11
1457161_at 9530029O12Rik Ген RIKEN cDNA 9530029O12 -2,11 0,019032 1,65
1459887_at NA NA -2,11 0,003987 4,29
1459005_at NA NA -2,13 0,007384 3,34
1439283_at NA NA -2,18 0,007823 3,24
1438338_at Mdh1 Малатдегидрогеназа 1, NAD (растворимая) -2,21 0,001446 5,54

1458452_at NA NA -2,21 0,010277 2,59
1442256_at Prkcd Протеинкиназа C, дельта -2,21 0,026633 1,11
1443969_at Irs2 Субстрат 2 рецептора инсулин -2,22 0,003987 4,22
1452462_a_at Banp Btg3-ассоциированный ядерный белок -2,30 0,021033 1,52
1454558_at 5430416B10Rik Ген RIKEN cDNA 5430416B10 -2,32 1,71E-07 15,68
1430393_at C030048B08Rik Ген RIKEN cDNA C030048B08 -2,32 0,001388 5,78
1446929_at Bach2 Домен 2 гомологии BTB и CNC -2,32 0,027369 1,07
NuGO_emt067737_at 9130230L23Rik Ген RIKEN cDNA 9130230L23 -2,34 0,04708 0,15
1441138_at Foxn2 Forkhead-бокс N2 -2,36 0,001356 6,01
1416041_at Sgk Сывороточная/регулируемая глюкокортикоидами киназа -2,40 0,04048 0,41
1454158_at Mpp7 Мембранный белок, пальмитоилированный 7 (представитель 7 подсемейства MAGUK p55) -2,40 0,011571 2,40
1459253_at Arrdc3 Содержащий домен аррестина 3 -2,46 0,044113 0,27
1444376_at Sesn1 Сестрин 1 -2,48 0,036167 0,59
1430362_at 5730409N24Rik Ген RIKEN cDNA 5730409N24 -2,49 0,032477 0,83
1442069_at D5Wsu178e Сегмент ДНК, Chr 5, Wayne State University 178, экспрессируемый -2,50 0,032477 0,80
1433203_at 6030400A10Rik Ген RIKEN cDNA 6030400A10 -2,56 0,000747 6,76
1456706_at 1700109H08Rik Ген RIKEN cDNA 1700109H08 -2,60 0,004825 3,89
1441561_at Fbxl3 Белок 3 с F-боксом и лейцин-богатыми повторами -2,60 0,034193 0,70

1437884_at Arl5b Белок 5B, подобный фактору ADP-рибозилирования -2,65 0,022457 1,40
1445843_at Chd2 ДНК-связывающий белок 2, хеликаза хромодомена -2,66 0,044481 0,24
1428306_at Ddit4 Индуцируемый повреждением ДНК транскрипт 4 -2,66 0,008352 3,09
1421009_at Rsad2 Белок 2, содержащий домен радикала S-аденозилметионина -2,69 0,04708 0,14
1440227_at BF642829 Экспрессируемая последовательность BF642829 -2,69 0,026633 1,11
1453595_at Bcl6 Белок B-клеточного лейкоза/лимфомы 6 -2,70 0,004825 3,89
1444775_at 9930033D15Rik Ген RIKEN cDNA 9930033D15 -2,71 0,003248 4,61
1439972_at Etnk1 Этаноламинкиназа 1 -2,74 0,032477 0,83
1440536_at Slc22a5 Переносчик растворенных веществ, семейство 22 (транспортер органических катионов), представитель 5 -2,90 0,021033 1,49
1438660_at Gcnt2 Глюкозаминил (N-ацетил) трансфераза 2, фермент I-ветвления -2,95 0,018436 1,70
1437759_at Pfkp Фосфофруктокиназа, тромбоцитарная -2,97 0,008352 3,11
NuGO_emt050020_at Amica1 Молекула адгезии, взаимодействует с антигеном 1 CXADR -2,97 0,000981 6,41

1446950_at Tox Ген ассоциированного с селекцией тимоцитов бокса HMG -3,00 0,008352 2,98
1447141_at AW107722 Экспрессируемая последовательность AW107722 -3,14 0,013251 2,17
1459219_at Rapgef2 Фактор 2 обмена гуаниновыми нуклеотидами (GEF) Rap -3,21 0,000747 6,75
1449496_at 2010109I03Rik Ген RIKEN cDNA 2010109I03 -3,22 0,000167 8,69
1458296_at NA NA -3,23 0,001388 5,70
1440749_at NA NA -3,38 0,001388 5,76
1440892_at BC017647 Последовательность кДНК BC017647 -3,52 0,004881 3,85
1441115_at Rnf125 Белок 125 с кольцевыми пальцами -3,90 0,000237 8,14
1421365_at Fst Фоллистатин -4,33 0,04708 0,12
1446972_at D15Wsu126e Сегмент ДНК, Chr 15, Wayne State University 126, экспрессируемый -7,09 0,003054 4,72

Таблица S4D
Транскрипты, дифференциально экспрессируемые в подвздошной кишке через 28 суток между животными, которых инокулировали R. hominis, и безмикробными животными
ID Обозначение Название M Значение P B
1458427_at Brip1 C-концевая хеликаза 1 BRCA1-взаимодействующего белка -1,72 0,002194 4,97

Гены, вовлеченные во врожденный иммунитет и барьерную функцию кишечника, в значительной степени индуцировались присутствием R. hominis в восходящей ободочной кишке. Процесс GO "врожденный иммунный ответ" (GO:0045087) был активирован и включал важные TLR-родственные гены Tlr5, Tlr1 и Vnn1. Особый интерес представляла активация Tlr5, учитывая соответ