Применение сывороточного альбумина в качестве противомикробного агента

Изобретение относится к фармации и микробиологии. Предложено применение сывороточного альбумина человека (ЧСА) в концентрации от 49 до 71 мг/мл в качестве антимикробного средства, разрушающего клетки микроорганизмов. Технический результат состоит в реализации назначения: показано не только подавление роста E. coli, C. albicans, S. aureus, Cr. neoformans, но также разрушение клеток с образованием дебриса в физиологических концентрациях ЧСА. Изобретение обеспечивает возможность применять ЧСА в качестве антимикробного средства и использовать его в качестве показателя противомикробной активности сыворотки крови у пациентов. 2 ил., 2 табл., 3 пр.

 

Область техники

Изобретение относится к области лабораторной диагностики, медицинской иммунологии и микробиологии и предназначено для применения альбумина в качестве антимикробного агента.

Уровень техники

Сывороточный альбумин человека (ЧСА) и животных составляет примерно 50% белков плазмы, кроме того он присутствует в тканях. Функции альбумина в организме весьма многообразны: это поддержание онкотического давления плазмы, связывание и транспорт низкомолекулярных веществ и экзогенных лигандов, участие в окислительно-восстановительных реакциях, пластическая функция, регуляция гемостаза, участие в поддержании кислотно-основного равновесия в крови, регуляция апоптоза. Известно также, что альбумин влияет на целостность сосудов, участвуя в поддержании нормальной капиллярной проницаемости, и оказывает иммуномодулирующее действие за счет связывания различных продуктов жизнедеятельности микроорганизмов.

Антимикробную активность сыворотки крови принято связывать с наличием белков системы комплемента, иммуноглобулинов и антимикробных пептидов. Белки системы комплемента действуют только в полном наборе и по каскадному механизму [Ройт А., Бростофф Д., Мейл Д., Иммунология, 2000, Москва, «Мир», С. 61]. Иммуноглобулины обладают непосредственным антимикробным действием только на те микроорганизмы, с инвазией которых человек непосредственно сталкивается. Например, есть данные о действии специфических иммуноглобулинов класса А против грибов рода Candida, полученные in vitro [Kavishwar A., Shukla Р.K. Candidacidal activity of a monoclonal antibody that binds with glycosyl moieties of proteins of Candida albicans. Medical Mycology. 2006; 44(2): 159-167]. В организме человека насчитывается свыше 20 различных классов антимикробных пептидов [Zasloff М. Antimicrobial peptides of multicellular organisms. Nature. 2002; 415(6870): 389-95]. Они действуют совокупно, причем их концентрация в сыворотке крови варьирует от 10-1 нг/мл для гепцидина [Wolff F. et al, Hepcidin-25: Measurement by LC-MS/MS in serum and urine, reference ranges and urinary fractional excretion // Clinica Chimica Acta Volume 423, P. 99-104]) и 101 нг/мл для дефензинов [Arimura Y. et al, Elevated Serum Defensins Concentrations in Patients with Lung Cancer // Anticancer research 24: 4051-4058 (2004)] до 103 нг/мл для дермцидинов [Ortega Martinez I. et al. Vitronectin and dermcidin serum levels predict the metastatic progression of AJCC I-II early stage melanoma // Int J Cancer. 2016, 139(7): 1598-1607] и лизоцима [Назаренко Г.И., Кишкун А.А. Клиническая оценка результатов лабораторных исследований, Литан, Медицина (Татарстан), М.: Медицина. - 2000. - 544 с.].

До сих пор ничего не было известно об антимикробных свойствах альбумина. Однако, по нашему мнению, альбумин как самый представленный белок плазмы - его концентрация составляет порядка 107 нг/мл - тоже взаимодействует с микроорганизмами. Обнаружение этой новой функции альбумина не только переворачивает общеизвестные представления об этом уникальном компоненте крови, но и позволяет рассчитывать на использование этих свойств в клинической практике, как в диагностических, так и в лечебных целях.

Наиболее близким аналогом заявленного изобретения является применение лизоцима в качестве противомикробного агента [Johansson B.G., Malmquist J. Quantitative immunochemical determination of lysoqyme (muramidase) in serum and urine. Scand J Clin Lab Invest. 1971 May; 27(3): 255-61; Назаренко Г.И., Кишкун А.А. Клиническая оценка результатов лабораторных исследований, Литан, Медицина (Татарстан), М.: Медицина. - 2000. - 544 с.].

Однако, лизоцим имеет ограниченный спектр функций в организме и в плазме крови человека он представлен в невысокой концентрации, в то время как альбумин является основным белком плазмы крови и выполняет целый ряд важных функций.

Задачей изобретения является применение сывороточного альбумина человека в качестве противомикробного агента.

Для решения указанной задачи мы предлагаем применение альбумина в качестве противомикробного агента, поскольку до сих пор терапевтические препараты альбумина использовались лишь как источник белка для поддержания жизнедеятельности, например, при онкологических заболеваниях и др.

К техническому результату изобретения относятся:

- возможность применять альбумин в качестве антимикробного средства.

- расширение арсенала антимикробных средств.

- возможность использовать альбумина в качестве показателя противомикробной активности сыворотки крови у пациентов.

Краткое описание поясняющих материалов.

Фиг. 1 - антимикробная активность альбуминов, где БСА - бычий, ЧСА - человеческий, ОВА - яичный альбумин, по оси ординат - количество живых клеток, выраженное в процентах от контроля.

Фиг. 2 - действие растворов человеческого сывороточного альбумина различной концентрации на микробные клетки, где I - контроль, II - концентрация альбумина 10 мг/мл, III - концентрация альбумина 50 мг/мл.

Табл. 1 - антимикробное действие растворов альбуминов в различной концентрации.

Табл. 2 - активность нативной человеческой сыворотки.

Осуществление изобретения.

Пример 1. Определение антимикробной активности альбуминов методом посевов.

К суспензии клеток дрожжей С albicans №927, разведенных в основе синтетической питательной среды до концентрации 104 КОЕ/мл, добавляли глюкозу до средней концентрации в плазме крови - 5 мМ и альбумин (БСА - бычий, ЧСА - человеческий, ОВА - яичный) в конечной концентрации 50 мг/мл, контрольная проба не содержала альбумина. Проводили инкубацию во флаконах на шейкере при 32°С в течение 2 часов, затем отсевали аликвоты суспензий на чашки с плотной глюкозо-пептон-дрожжевой средой и инкубировали 1 сутки при 32°С. По окончании инкубации проводили учет выросших колоний, что отражает количество живых клеток в аликвоте. Количество живых клеток выражали в процентах от контроля, не содержавшего альбумин. Результаты, представленные на Фиг. 1, показывают, что двухчасовая экспозиция клеток культуры С. albicans приводила к резкому снижению численности популяции дрожжей в присутствии всех альбуминов, особенно БСА.

Пример 2. Определение антимикробной активности альбуминов методами спектрофотометрии и микроскопии.

300 мкл раствора альбуминов (БСА - бычий, ЧСА - человеческий, ОВА - яичный) в конечной концентрации 50 мг/мл соединяли в пробирках типа Эппендорф с 50 мкл суспензии дрожжей - Candida albicans №927 и Cryptococcus neoformans №3465 - в концентрации 1010 КОЕ/мл либо суспензии бактерий - Escherichia coli М-17 и Staphylococcus aureus Wood 46 - в концентрации 10 КОЕ/мл, причем контрольная пробирка вместо альбумина содержала 300 мкл физраствора; пробирки инкубировали 2 часа при 32°С на шейкере, затем центрифугировали 5 мин при 16000 об/мин, супернатанты удаляли, а к осадкам добавляли по 300 мкл раствора бромкрезолового пурпурного в фосфатном буфере рН 4,6; затем пробирки инкубировали 45 мин при 32°С на шейкере; центрифугировали 5 мин при 16000 об/мин, а осадки микроскопировали при суммарном увеличении микроскопа 1750 и фотографировали цифровой камерой «Sony» (Япония), совмещая ее объектив с окуляром микроскопа, определяя живые клетки, мертвые клетки, дебрис (т.е. везикулы, образованные при разрушении клеток). К удаленным супернатантам добавляли 2,5 мл фосфатного буфера рН 4,6; оптическую плотность полученных растворов измеряли на спектрофотометре «Genesys 10S UV-Vis» (США) при длине волны 440 нм, а из трех измерений для каждой пробы вычисляли среднее значение оптической плотности:

А=(ОПконтр-ОПопыт.)*100/ОПконтр.,

где ОПконтр - это оптическая плотность смеси из контрольной пробирки; ОПопыт. - это оптическая плотность смеси из опытной пробирки.

Величина оптической плотности служит характеристикой антимикробной активности образцов, поскольку имеется прямая зависимость ее от содержания в образце живых микробных клеток. Так, чем больше живых микробных клеток - тем больше оптическая плотность измеряемого образца и, соответственно, тем ниже активность действующего на клетки вещества.

На основании полученных величин оптической плотности производили расчет активности, выражая ее в процентах по отношению к контрольному образцу.

Из данных, приведенных на фиг. 2 и в табл.1 можно заключить, что действие всех альбуминов на все изученные микроорганизмы носит дозозависимый характер. При концентрациях сывороточных альбуминов, близких к физиологическим (50 мг/мл), клетки микроорганизмов разрушались с образованием везикул дебриса, тогда как при более низких концентрациях (10 мг/мл) имело место лишь нарушение целостности клеточных мембран. Антимикробная активность альбуминов в отношении клеток дрожжей, изученная методом посевов при концентрации альбуминов 50 мг/мл, коррелирует с таковой, полученной спектрофотометрическим методом - коэффициент Пирсона r=0,999. Из табл. 1 видно, что наибольшей активностью при физиологической концентрации в отношении дрожжей и эшерихий обладал препарат БСА, а наименьшей - ОВА, тогда как в отношении стафилококков наиболее эффективным явился ЧСА.

Пример 3. Сравнение концентрации альбумина в сыворотках с их противомикробной активностью.

Произвольно взятые образцы сывороток людей (n=22) обрабатывали аналогично примеру 2, но вместо раствора альбумина использовали образцы сывороток, концентрацию альбумина в которых определяли с помощью тест-системы «Агат-Альбумин».

Коэффициенты Пирсона были равны: для человеческих сывороток r=0,599, что указывает на наличие прямой корреляционной взаимосвязи высокой силы между концентрацией альбумина и антимикробной активностью сывороток против клеток дрожжей.

Сравнение активности ЧСА в физиологической концентрации с активностью нативной человеческой сыворотки показало следующее: средняя активность сыворотки по отношению к С. albicans №927, оцененная методом спектрофотометрии, находится в пределах 88,2±1,6% (см. табл. 2), тогда как активность ЧСА в концентрации 50 мг/мл равна 72,8±0,9%; к Cr. neoformans - 79,5±7,8 против 60,7±2,8%; к Е. coli - 83,8±0,8% против 71,2±0,8%; к S. aureus - 79,5±0,4% против 80,0±1,0%.

Таким образом, обнаружено, что при обработке тест-культур нативными сыворотками, содержащими сывороточный альбумин в физиологических концентрациях, наблюдается выраженное антимикробное действие этих сывороток.

Проведенные эксперименты показали наличие антимикробной активности человеческого сывороточного альбумина в концентрациях 50 мг/мл и близких к ней. Отметим, что такая концентрация соответствует физиологическому содержанию человеческого альбумина в организме. В такой же концентрации и выше альбумин содержится и в ряде лекарственных препаратов, используемых в практической медицине. Обнаружение антимикробных свойств раствора альбумина в физиологической концентрации, соответствующей уже используемой в лечебных препаратах, позволит расширить область применения указанного раствора и усовершенствовать тактику лечения инфекционно-воспалительных заболеваний путем использования альбумин-содержащих препаратов вместо антибиотиков и антисептиков.

Кроме того, на основании полученных данных выявление у пациентов низких концентраций альбумина в сыворотке крови позволяет сделать вывод о низкой противомикробной защите организма.

Применение сывороточного альбумина человека в концентрации от 49 до 71 мг/мл в качестве антимикробного средства, разрушающего клетки микроорганизмов.



 

Похожие патенты:

Изобретение относится к соединению формулы (I) или к его фармацевтически приемлемой соли. Также раскрывается фармацевтическая композиция для лечения ВТК-опосредованного расстройства на основе указанноего соединения или его соли.

Изобретение относится к области биотехнологии, конкретно к рекомбинантным системам для экспрессии иммунногенных белков, и может быть использовано в медицине для стимуляции иммунного ответа.

Изобретение относится к фармацевтической промышленности, а именно к применению композиции в качестве противовирусного и/или противобактериального агента у индивидуумов, проходящих противоопухолевое химиотерапевтическое лечение, лечение синдрома приобретенного иммунодефицита и лечение лейкозов.

Изобретение относится к области ветеринарии, и именно к вирусологии, и может быть использовано для получения вакцины против вирусного гепатита утят типа I. Вакцина содержит инактивированный аминоэтилэтиленимином антиген вируса гепатита утят типа I штамма «ВН-3» с активностью 7,0-7,5 lg ЭЛД50/см3 в смеси с масляным адъювантом АБ-4М (В/М), взятые в соотношении 1:1-1:4, причем концентрация аминоэтилэтиленимина составляет не менее 0,1%.

Изобретение относится к соединению формулы (I) или его фармацевтически приемлемой соли. В формуле (I) W представляет собой CH2; X представляет собой C; цикл A представляет собой фенил или 5- или 6-членный гетероарил, где указанный гетероарил содержит 1, 2, 3 или 4 гетероатома, выбранных из N, O и S; m равен целому числу от 0 до 2; каждый R1 выбирают независимо из (C1-C6)алкила, необязательно замещенного одним или несколькими атомами галогена, R2O, галогена, R5C(O)N(R6), R9S(O)2, R10S(O)2N(H), -O и R14R15NS(O)2; и когда m равен по меньшей мере 2, два R1, присоединенные к соседним атомам цикла A, могут образовывать, вместе с атомами, к которым они присоединены, 5- или 6-членный гетероцикл или карбоцикл; где гетероцикл содержит 1 или 2 гетероатома, выбранных из кислорода; каждый R2, R5, R6, R9, R10 и R14 выбирают независимо из H и (C1-C6)алкила, при этом любой алкил необязательно замещен одним или несколькими атомами галогена; R15 выбирают из H, (C1-C6)алкила, R16C(O) и R17OC(O); и каждый R16 и R17 выбирают независимо из H и (C1-C6)алкила, при этом любой алкил необязательно замещен одним или несколькими атомами галогена.

Группа изобретений относится к иммунологии, а именно к ветеринарии, и может быть использована для применения вакцины против цирковируса свиней 2 типа. Вакцину, содержащую рекомбинантный экспрессируемый ORF2 белок цирковируса свиней 2 типа, применяют для профилактической обработки животного, которое имеет циркулирующие антитела, направленные против цирковируса свиней 2 типа, путем введения единственной дозы вакцины в кожу животного.

Изобретение относится к соединениям общей формулы 1a-f, где R1 - фрагменты (6,6-диметилбицикло[3.1.1]гепт-2-ен-2-ил)метила (1a, 1b), (6,6-диметилбицикло[3.1.1]гепт-2-ен-2-ил)этила (1c, 1d), (2,2,3-триметилциклопент-3-ен-1-ил)метила (1e, 1f), R2 - остаток 1- или 2-адамантана (1a-f), и 2.

Изобретение относится к медицине, а именно к гинекологии, и может быть использовано для персонализированного лечения ВПЧ-ассоциированных рецидивирующих хронических цервицитов на основе иммуногенетических критериев.

Изобретение относится к области биотехнологии, конкретно к рекомбинантным полипептидам для нацеливания на выделяющийся фосфатидилсерин. Описан полипептид для нацеливания на выделяющийся фосфатидилсерин, который включает: (a) домен гамма-карбоксиглутаминовой кислоты белка S, содержащий последовательность, представленную в SEQ ID NO: 1, или последовательность по меньшей мере на 95% гомологичную ей, и не содержащий домен протеазы или гормонсвязывающий домен; и (b) белок S домена EGF, где указанный полипептид конъюгирован с полезным грузом, выбранным из детектируемой метки, белковой последовательности, полиэтиленгликоля, целлюлозы, белка альбумина и терапевтического агента.

Изобретение относится к медицине и описывает фармацевтический комбинированный аэрозольный состав пропеллентного типа белковых олигопептидных или полипептидных соединений из группы ингибиторов протеолитических ферментов с антивирусным, противомикробным или противовоспалительным веществом, взятыми в растворе с содержанием воды не более 10% от объема состава и суммарным количеством указанных активных веществ 0,001-50 мг на 1 мл состава.

Изобретение относится к фармацевтической промышленности, а именно к применению антимикробной композиции для лечения или предупреждения инфекции, выбранной из бактериальной или грибковой.

Изобретение относится к новым биологически активным соединениям - серебряным солям 3,4-диарил-5-[4-(ацетиламиносульфонил)фенил]-4,6-дигидропирроло[3,4-с]пиразол-6-онов формулы (I, II, III), в которой R1=4-СН3О, R2=4-Cl (I), R1=4-СН3О, R2=2-NO2 (II), R1=4-Br, R2=2-NO2 (III).

Группа изобретений относится к области медицины и предназначено для профилактики и лечения грибковых и других инфекционно-воспалительных заболеваний кожи. Противогрибковое и антимикробное средство комплексного действия содержит тербинафина гидрохлорид, бензалкония хлорид, спирт, масло мятное и воду очищенную.

Изобретение относится к медицине и касается фармацевтической композиции для лечения грибковых поражений слизистых оболочек, включающей в качестве действующего вещества пептид SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFF, дополнительно содержащей гидроксипропилметилцеллюлозу, полиэтиленгликоль-400 и воду.
Изобретение относится к медицине, а именно к дерматологии, и может быть использовано для криогенного лечения онихомикоза. Проводят воздействие локальной криотерапией на патологически измененные ногтевые пластины и кожу околоногтевых основного и боковых валиков.

Изобретение относится к медицине, а именно к гинекологии, дерматовенерологии и иммунологии и может быть использовано для лечения урогенитального кандидоза. Для этого осуществляют орошение области влагалища, шейки матки и вульвы ультраозвученным 0,9% раствором хлорида натрия температурой 37°С, амплитудой акустических колебаний - 25 мкм, частотой акустических колебаний - 29 кГц, временем воздействия 5 минут.

Изобретение относится к соединениям общей формулы (I) или его фармацевтически приемлемой соли, где Z выбирается независимо и представляет собой фрагмент, структурная формула которого приведена ниже, причем звездочкой указано место присоединения; X выбирается независимо и представляет собой О или S; R1 выбирается независимо и представляет собой фрагмент бензилидена, необязательно содержащий 1-3 заместителя R', который выбирается независимо и представляют собой -C1-7-алкил, -O-C1-7-алкил, галоген, -ОН, -С5-7-циклоалкил, -пиперазинил, необязательно содержащий заместитель, выбранный из -C1-7-алкила; причем звездочкой указано место присоединения заместителя; R2 выбирается независимо и представляет собой Н, -C1-7-алкил, фенил; указанный фенил во фрагменте R2 необязательно замещен по меньшей мере двумя заместителями, представляющими собой галоген; R3 выбирается независимо и представляет собой галоген; R4 выбирается независимо и представляет собой галоген; n принимают значения от 0 до 3.

Изобретение относится к медицине, а также к фармацевтическому производству, и касается средства для лечения грибка ногтей. Средство содержит нафтифин гидрохлорид, спирт этиловый, полиэтиленгликоль-400, полиэтиленгликоль-1000, при следующем соотношении компонентов, мас.%.: нафтифин гидрохлорид - 1.4%; спирт этиловый 95% - 20.3%; полиэтиленглоколь-400 - 63%; полиэтиленгликоль-1000 - 15.3%.

Изобретение относится к медицине и может быть использовано в дерматологии для лечения онихомикозов стоп. Изобретение касается способа лечения онихомикозов стоп, включающего использование противогрибковых препаратов тербинафина, бифоназола и нафтифина гидрохлорида, дополнительную санацию очага микотической инфекции путем воздействия токами надтональной частоты на области пораженной ногтевой пластины, околоногтевых валиков и корня растущего ногтя.
Изобретение относится к фармацевтической промышленности, а именно к способу получения антигрибковой мази. Способ получения антигрибковой мази, содержащей экстракт шалфея лекарственного, по отношению к возбудителю трихофитона красного (Trichophyton rubrum), заключающийся в том, смешивают сальвин, салициловую кислоту, этиловый спирт, ланолин и вазелин, взятые в определенном соотношении.

Изобретение относится к биотехнологии, в частности к фармацевтической композиции для лечения глазных инфекций, вызванных метициллин-устойчивыми штаммами Staphylococcus aureus, включающей в качестве активного начала N-концевой СНАР-домен эндолизина бактериофага K Staphylococcus aureus.

Изобретение относится к фармации и микробиологии. Предложено применение сывороточного альбумина человека в концентрации от 49 до 71 мгмл в качестве антимикробного средства, разрушающего клетки микроорганизмов. Технический результат состоит в реализации назначения: показано не только подавление роста E. coli, C. albicans, S. aureus, Cr. neoformans, но также разрушение клеток с образованием дебриса в физиологических концентрациях ЧСА. Изобретение обеспечивает возможность применять ЧСА в качестве антимикробного средства и использовать его в качестве показателя противомикробной активности сыворотки крови у пациентов. 2 ил., 2 табл., 3 пр.

Наверх