Оптимизированные варианты анти-vegf антител



C07K2317/14 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2763916:

ДЖЕНЕНТЕК, ИНК. (US)

Изобретение относится к области биотехнологии. Предложены варианты анти-VEGF антитела, конъюгаты, слитые белки и композиции, включающие указанные антитела, а также их использование для лечения расстройств, связанных с патологическим ангиогенезом. Кроме того, изобретение относится к полинуклеотиду, кодирующему анти-VEGF антитело, включающим указанный полинуклеотид вектору экспрессии и клетке-хозяину, а также к их использованию в способе получения антитела по изобретению. Изобретение обеспечивает получение антител с повышенной аффинностью связывания с VEGF и улучшенной стабильностью. 21 н. и 123 з.п. ф-лы, 45 ил., 20 табл., 13 пр.

 

Список последовательностей

В текущем приложении содержится список последовательностей, который был представлен в электронном виде в формате ASCII и полностью включен в данное описание посредством ссылки. Указанная копия ASCII, созданная 21 сентября 2016 года, называется 50474-110WO3_Sequence_Listing_9_21_16_ST25 и имеет размер 41 764 байт.

Область ТЕХНИКИ

Изобретение относится в целом к анти-VEGF антителам, а также к композициям, которые включают анти-VEGF антитела (например, конъюгаты антител, слитые белки и полимерные составы), с полезными свойствами для исследовательских, терапевтических и диагностических целей. Изобретение также относится к способам идентификации вариантов антител с улучшенными свойствами, например, с повышенной аффинности связывания, стабильностью и/или экспрессией.

УРОВЕНЬ ТЕХНИКИ

Ангиогенез - это строго регулируемый процесс, посредством которого новые кровеносные сосуды формируются из ранее существовавших кровеносных сосудов. Хотя ангиогенез важен во время развития для обеспечения адекватного кровообращения, многие расстройства связаны с патологическим ангиогенезом, таким как окулярные расстройства (например, возрастная дегенерация желтого пятна, AMD) и клеточные пролиферативные расстройства (например, рак). Фактор роста эндотелия сосудов (VEGF) является клинически обоснованным драйвером ангиогенеза и нейтрализации VEGF, например, с использованием анти-VEGF блокирующего антитела, может использоваться для лечения расстройств, связанных с патологическим ангиогенезом.

Остается потребность в антителах, таких как анти-VEGF антитела, с улучшенной аффинностью связывания, стабильностью, фармакокинетикой и/или экспрессией, например, для использования при лечении расстройств, связанных с патологическим ангиогенезом. В частности, существует потребность в композициях антител для доставки длительного действия для лечения окулярных расстройств (например, AMD (например, влажной AMD), диабетического макулярного отека (DME), диабетической ретинопатии (DR) и окклюзии сетчатки (RVO)). Кроме того, существует неудовлетворенная потребность в улучшенных способах идентификации таких антител с улучшенными свойствами (например, улучшенной аффинностью связывания, стабильностью, фармакокинетикой и/или экспрессией).

КРАТКОЕ ОПИСАНИЕ СУЩНОСТИ ИЗОБРЕТЕНИЯ

В данном изобретении предложены анти-VEGF антитела, композиции, которые включают анти-VEGF антитела (например, конъюгаты антител, слитые белки и полимерные составы) и способы их применения, например, для лечения расстройств, связанных с патологическим ангиогенезом (например, окулярные расстройства и клеточные пролиферативные расстройства). Данное изобретение также относится к способам идентификации вариантов антител с улучшенными свойствами, например, с улучшенной аффинностью связывания, стабильностью, фармакокинетикой и/или экспрессией.

В одном аспекте изобретение включает изолированное антитело, которое специфически связывает фактор роста эндотелия сосудов (VEGF), причем антитело содержит следующие шесть гипервариабельных участков (HVR): (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GX1TPX2GGX3X4X5YX6DSVX7X8 (SEQ ID NO: 2), где X1 представляет собой Ile или His, X2 представляет собой Ala или Arg, X3 представляет собой Tyr или Lys, X4 представляет собой Thr или Glu, X5 представляет собой Arg, Tyr, Gln или Glu, X6 представляет собой Ala или Glu, X7 представляет собой Lys или Glu, а X8 представляет собой Gly или Glu; (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQX1VSTAVA (SEQ ID NO: 4), где X1 представляет собой Asp или Arg; (e) HVR-L2, содержащий аминокислотную последовательность X1ASFLYS (SEQ ID NO: 5), где X1 представляет собой Ser или Met; и (f) HVR-L3, содержащий аминокислотную последовательность X1QGYGX2PFT (SEQ ID NO: 6), где X1 представляет собой Gln, Asn или Thr и X2 представляет собой Ala, Asn, Gln или Arg. В некоторых вариантах осуществления изобретения, антитело содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYTRYADSVKG (SEQ ID NO: 7), GITPAGGYEYYADSVKG (SEQ ID NO: 21) или GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10) или QQGYGNPFT (SEQ ID NO: 23).

В некоторых вариантах осуществления вышеуказанного аспекта, антитело содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYTRYADSVKG (SEQ ID NO: 7); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых вариантах осуществления изобретения, антитело дополнительно содержит следующие каркасные участки (FR) вариабельного (VH) домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13); (b) FR-H2, содержащий аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 14); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); и (d) FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 16). В некоторых вариантах осуществления изобретения, антитело дополнительно содержит следующие FR вариабельного (VL) домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20).

В некоторых вариантах осуществления вышеуказанного аспекта, антитело содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGNPFT (SEQ ID NO: 23). В некоторых вариантах осуществления изобретения, антитело дополнительно содержит следующие FR участки VL домена: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 24); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20).

В некоторых вариантах осуществления вышеуказанного аспекта, антитело содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых вариантах осуществления изобретения, антитело дополнительно содержит следующие FR-участки VL домена: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17), DIQMTQSPESLSASVGDEVTITC (SEQ ID NO: 25) или DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18) или WYQQKPGEAPKLLIY (SEQ ID NO: 27); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19) или GVPSRFSGSGSGTDFTLTIESLQPEDAATYYC (SEQ ID NO: 28); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых вариантах осуществления изобретения, антитело дополнительно содержит следующие FR-участки VH домена: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29) или EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 51); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32).

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 95 % идентичность последовательности с аминокислотной последовательностью SEQ ID NO: 11, 40 или 42; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 95 % идентичность последовательности с аминокислотной последовательностью SEQ ID NO: 12, 41 или 46; или (c) домен VH, как в (a), и домен VL, как в (b). В некоторых вариантах осуществления изобретения, домен VH дополнительно содержит следующие FR: (a) FR-H1, содержащий аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13); (b) FR-H2, содержащий аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 14) или WVRQEPGKGLEWVA (SEQ ID NO: 39); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); и (d) FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 16). В некоторых вариантах осуществления изобретения, домен VH содержит аминокислотную последовательность SEQ ID NO: 11. В некоторых вариантах осуществления изобретения, домен VL дополнительно содержит следующие FR: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17) или DIQMTQSPSSLSASVGDRVTIDC (SEQ ID NO: 45); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19), GVPSRFSGSGSGTDFTLTISSLQPEDSATYYC (SEQ ID NO: 44) или GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 54); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20) или FGQGTKVEVK (SEQ ID NO: 55). В некоторых вариантах осуществления изобретения, домен VL содержит аминокислотную последовательность SEQ ID NO: 12.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 11 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 40 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 42 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 42 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 41.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 95 % идентичность последовательности с аминокислотной последовательностью SEQ ID NO: 33 или 51; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 95 % идентичность последовательности с аминокислотной последовательностью SEQ ID NO: 12, 34, 35, 36, 37 или 38; или (c) домен VH, как в (a), и домен VL, как в (b). В некоторых вариантах осуществления изобретения, антитело дополнительно содержит следующие FR-участки: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29) или EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 52); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В некоторых вариантах осуществления изобретения, домен VH содержит аминокислотную последовательность SEQ ID NO: 33. В некоторых вариантах осуществления изобретения, домен VH содержит аминокислотную последовательность SEQ ID NO: 51. В некоторых вариантах осуществления изобретения, антитело дополнительно содержит следующие FR-участки: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17), DIQMTQSPESLSASVGDEVTITC (SEQ ID NO: 25) или DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18) или WYQQKPGEAPKLLIY (SEQ ID NO: 27); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19), GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 24), или GVPSRFSGSGSGTDFTLTIESLQPEDAATYYC (SEQ ID NO: 28); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых вариантах осуществления изобретения, домен VL содержит аминокислотную последовательность SEQ ID NO: 34. В некоторых вариантах осуществления изобретения, домен VL содержит аминокислотную последовательность SEQ ID NO: 35. В некоторых вариантах осуществления изобретения, домен VL содержит аминокислотную последовательность SEQ ID NO: 36. В некоторых вариантах осуществления изобретения, домен VL содержит аминокислотную последовательность SEQ ID NO: 37. В некоторых вариантах осуществления изобретения, домен VL содержит аминокислотную последовательность SEQ ID NO: 12. В некоторых вариантах осуществления изобретения, домен VL содержит аминокислотную последовательность SEQ ID NO: 38.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 38.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 34.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 35.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 36.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 38.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 35.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 48 и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 50.

В другом аспекте изобретение относится к изолированному антителу, которое специфически связывает VEGF, причем антитело содержит (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 49 и (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 50.

В некоторых вариантах осуществления любого из предшествующих аспектов, антитело способно ингибировать связывание VEGF с рецептором VEGF. В некоторых вариантах осуществления изобретения, рецептор VEGF представляет собой рецептор 1 VEGF (Flt-1). В некоторых вариантах осуществления изобретения, рецептор VEGF представляет собой рецептор 2 VEGF (KDR).

В некоторых вариантах осуществления любого из предыдущих аспектов, антитело связывает VEGF человека (hVEGF) с Kd около 2 нМ или ниже. В некоторых вариантах осуществления изобретения, антитело связывает hVEGF с Kd между около 75 пМ и около 2 нМ. В некоторых вариантах осуществления изобретения, антитело связывает hVEGF с Kd между около 75 пМ и около 600 пМ. В некоторых вариантах осуществления изобретения, антитело связывает hVEGF с Kd между около 75 пМ и около 500 пМ. В некоторых вариантах осуществления изобретения, антитело связывает hVEGF с Kd около 80 пМ. В некоторых вариантах осуществления изобретения, антитело связывает hVEGF с Kd около 60 пМ.

В некоторых вариантах осуществления любого из предшествующих аспектов, антитело имеет температуру плавления (Tm) более чем около 83,5°C. В некоторых вариантах осуществления изобретения, антитело имеет Тm от около 85°С до около 91°С. В некоторых вариантах осуществления антитело имеет Тm около 89°С.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело имеет изоэлектрическую точку (pI) ниже чем 8. В некоторых вариантах осуществления изобретения, антитело имеет pI от около 5 до около 7. В некоторых вариантах осуществления изобретения, антитело имеет pI от около 5 до около 6.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело является моноклональным, человеческим, гуманизированным или химерным.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело представляет собой фрагмент антитела, который связывает VEGF. В некоторых вариантах осуществления изобретения, фрагмент антитела выбран из группы, состоящей из фрагментов Fab, Fab-C, Fab'-SH, Fv, scFv и (Fab')2. В некоторых вариантах осуществления изобретения, фрагмент антитела представляет собой Fab.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело представляет собой моноспецифическое антитело. В других вариантах осуществления любого из предшествующих аспектов антитело представляет собой мультиспецифическое антитело. В некоторых вариантах осуществления изобретения, мультиспецифическое антитело представляет собой биспецифическое антитело. В некоторых вариантах осуществления изобретения, биспецифическое антитело связывает VEGF и вторую биологическую молекулу, выбранную из группы, состоящей из интерлейкина 1β (IL-1β); интерлейкина-6 (IL-6); рецептора интерлейкина-6 (IL-6R); интерлейкина-13 (IL-13); рецептора IL-13 (IL-13R); PDGF; ангиопоэтина; ангиопоэтина 2; Tie2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактор комплемента D; TNFα; HTRA1; рецептора VEGF; рецептора ST-2; и белка, генетически связанного с риском возрастной макулярной дегенерации (AMD). В некоторых вариантах осуществления рецептор VEGF представляет собой VEGFR1, VEGFR2, VEGFR3, мембранно-связанный VEGF-рецептор (mbVEGFR) или растворимый рецептор VEGF (sVEGFR). В некоторых вариантах осуществления изобретения, белок, генетически связанный с риском AMD, выбран из группы, состоящей из компонентов пути комплемента C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; интерлейкина-8 (IL-8); CX3CR1; TLR3; TLR4; CETP; LIPC, COL10A1; и TNFRSF10A.

В другом аспекте изобретение относится к полинуклеотиду (например, изолированному полинуклеотиду), кодирующему любое из описанных в данном документе антител. В другом аспекте, изобретение относится к вектору (например, вектору экспрессии), содержащему полинуклеотид для экспрессии антитела. В другом аспекте изобретение относится к клеткам-хозяевам, содержащим предшествующие полинуклеотиды и/или векторы. В некоторых вариантах осуществления изобретения, клетка-хозяин представляет собой клетку млекопитающего. В некоторых вариантах осуществления изобретения, клетка млекопитающего представляет собой клетку 293, клетку яичника китайского хомячка (CHO), дрожжевую клетку или растительную клетку. В некоторых вариантах осуществления клетка-хозяин представляет собой прокариотическую клетку. В некоторых вариантах осуществления изобретения, прокариотическая клетка представляет собой E. coli.

В другом аспекте изобретение относится к способу получения любого из описанных в данном документе антител, причем способ включает культивирование клетки-хозяина, которая содержит любой из предшествующих векторов (например, векторы экспрессии), в культуральной среде. В некоторых вариантах осуществления изобретения, способ дополнительно включает выделение антитела из клетки-хозяина или культуральной среды. В некоторых вариантах осуществления изобретения, клетка млекопитающего представляет собой клетку 293, клетку яичника китайского хомячка (CHO), дрожжевую клетку или растительную клетку. В некоторых вариантах осуществления изобретения, клетка-хозяин представляет собой прокариотическую клетку. В некоторых вариантах осуществления изобретения, прокариотическая клетка представляет собой E. coli.

В другом аспекте изобретение относится к способу ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом, включающему введение субъекту эффективного количества любого из предшествующих антител, что ослабляет или ингибирует ангиогенез у субъекта. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство или клеточное пролиферативное расстройство. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство. В некоторых вариантах осуществления изобретения, окулярное расстройство выбирают из группы, состоящей из возрастной макулярной дегенерации (AMD), макулярной дегенерации, отека макулы, диабетического макулярного отека (DME) (включая фокальный, нецентральный DME и диффузный, связанный с центром DME), ретинопатии, диабетической ретинопатии (DR) (включая пролиферативную DR (PDR), непролиферативную DR (NPDR) и высотную DR), других связанных с ишемией ретинопатий, ретинопатии недоношенных (ROP), окклюзии вены сетчатки (RVO) (включая центральные (CRVO) и разветвленные (BRVO) формы), CNV (включая миопическую CNV), неоваскуляризации роговицы, болезни, связанной с неоваскуляризацией роговицы, неоваскуляризации сетчатки, болезни, связанной с ретинальной/хориоидальной неоваскуляризацией, патологической близорукости, болезни фон Гиппеля-Линдау, гистоплазмоза глаза, семейной экссудативной витреоретинопатии (FEVR), болезни Коутса, болезни Норри, синдрома остеопороза-псевдоглиомы (OPPG), субконъюнктивального кровоизлияния, рубеоза, неоваскулярного заболевания глаз, неоваскулярной глаукомы, пигментной дистрофии сетчатки (RP), гипертонической ретинопатии, ретинальной ангиоматозной пролиферации, макулярной телеангиэктазии, неоваскуляризации радужки, внутриглазной неоваскуляризации, дегенерации сетчатки, кистозного макулярного отёка (CME), васкулита, отёка диска зрительного нерва, ретинита, конъюнктивита (включая инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит), врожденного амавроза Лебера, увеита (включая инфекционный и неинфекционный увеит), хориоидита, глазного гистоплазмоза, блефарита, сухости глаз, травматического повреждения глаз и болезни Шегрена. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD, DME, DR или RVO. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD. В некоторых вариантах осуществления изобретения, AMD представляет собой влажную AMD. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, является клеточным пролиферативным расстройством. В некоторых вариантах осуществления изобретения, клеточное пролиферативное расстройство представляет собой рак. В некоторых вариантах осуществления изобретения, рак выбирают из группы, состоящей из рака молочной железы, рака толстой кишки, немелкоклеточного рака легкого, неходжкинской лимфомы (НХЛ), рака почки, рака предстательной железы, рака печени, рака головы и шеи, меланомы, рака яичников, мезотелиомы и множественной миеломы.

В другом аспекте, изобретение относится к способу лечения расстройства, связанного с патологическим ангиогенезом, причем способ включает введение эффективного количества любого из предшествующих антител субъекту, нуждающемуся в таком лечении. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство или клеточное пролиферативное расстройство. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство. В некоторых вариантах осуществления изобретения, окулярное расстройство выбирают из группы, состоящей из возрастной макулярной дегенерации (AMD), макулярной дегенерации, отека макулы, диабетического макулярного отека (DME) (включая фокальный, нецентральный DME и диффузный, связанный с центром DME), ретинопатии, диабетической ретинопатии (DR) (включая пролиферативную DR (PDR), непролиферативную DR (NPDR) и высотную DR), других связанных с ишемией ретинопатий, ретинопатии недоношенных (ROP), окклюзии вены сетчатки (RVO) (включая центральные (CRVO) и разветвленные (BRVO) формы), CNV (включая миопическую CNV), неоваскуляризации роговицы, болезни, связанной с неоваскуляризацией роговицы, неоваскуляризации сетчатки, болезни, связанной с ретинальной/хориоидальной неоваскуляризацией, патологической близорукости, болезни фон Гиппеля-Линдау, гистоплазмоза глаза, семейной экссудативной витреоретинопатии (FEVR), болезни Коутса, болезни Норри, синдрома остеопороза-псевдоглиомы (OPPG), субконъюнктивального кровоизлияния, рубеоза, неоваскулярного заболевания глаз, неоваскулярной глаукомы, пигментной дистрофии сетчатки (RP), гипертонической ретинопатии, ретинальной ангиоматозной пролиферации, макулярной телеангиэктазии, неоваскуляризации радужки, внутриглазной неоваскуляризации, дегенерации сетчатки, кистозного макулярного отёка (CME), васкулита, отёка диска зрительного нерва, ретинита, конъюнктивита (включая инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит), врожденного амавроза Лебера, увеита (включая инфекционный и неинфекционный увеит), хориоидита, глазного гистоплазмоза, блефарита, сухости глаз, травматического повреждения глаз и болезни Шегрена. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD, DME, DR или RVO. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD. В некоторых вариантах осуществления изобретения, AMD представляет собой влажную AMD. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, является клеточным пролиферативным расстройством. В некоторых вариантах осуществления изобретения, клеточное пролиферативное расстройство представляет собой рак. В некоторых вариантах осуществления изобретения, рак выбирают из группы, состоящей из рака молочной железы, рака толстой кишки, немелкоклеточного рака легкого, неходжкинской лимфомы (НХЛ), рака почки, рака предстательной железы, рака печени, рака головы и шеи, меланомы, рака яичников, мезотелиомы и множественной миеломы.

В другом аспекте изобретение относится к способу ингибирования проницаемости сосудов у субъекта, страдающего расстройством, связанным с нежелательной проницаемостью сосудов, причем способ включает введение субъекту эффективного количества любого из предшествующих антител, тем самым ингибируя проницаемость сосудов у субъекта.

В другом аспекте изобретение относится к способу лечения расстройства, связанного с нежелательной проницаемостью сосудов, причем способ включает введение эффективного количества любого из предшествующих антител субъекту, нуждающемуся в таком лечении.

В некоторых вариантах осуществления любого из предшествующих аспектов расстройство, связанное с нежелательной проницаемостью сосудов, выбирается из группы, состоящей из отека, связанного с опухолями головного мозга, асцита, ассоциированного со злокачественными новообразованиями, синдрома Мейга, воспаления легких, нефротического синдрома, перикардиального выпота, плеврального выпота, и проницаемости, связанной с сердечнососудистыми заболеваниями.

В некоторых вариантах осуществления любого из предшествующих аспектов, способ дополнительно включает введение субъекту эффективного количества второго агента, причем второй агент выбран из группы, состоящей из другого антитела, химиотерапевтического агента, цитотоксического агента, анти-ангиогенного агента, иммунодепрессивного агента, пролекарства, цитокина, антагониста цитокинов, цитотоксической лучевой терапии, кортикостероида, противорвотного, противораковой вакцины, анальгетика, агента, ингибирующего рост, и соединения, которое связывается со второй биологической молекулой. В некоторых вариантах осуществления изобретения, антиангиогенный агент представляет собой антагонист VEGF. В некоторых вариантах осуществления изобретения, антагонист VEGF представляет собой анти-VEGF антитело, антитело против рецептора VEGF, растворимый слитый белок рецептора VEGF, аптамер, анти-VEGF DARPin® или ингибитор тирозинкиназы VEGFR. В некоторых вариантах осуществления изобретения, анти-VEGF антитело представляет собой ранибизумаб (LUCENTIS®), RTH-258 или биспецифическое анти-VEGF антитело. В некоторых вариантах осуществления изобретения, биспецифическое анти-VEGF антитело представляет собой анти-VEGF/анти-Ang2 антитело. В некоторых вариантах осуществления изобретения, анти-VEGF/анти-Ang2 антитело представляет собой RG-7716. В некоторых вариантах осуществления изобретения, растворимый слитый белок рецептора VEGF представляет собой афилберцепт (EYLEA®). В некоторых вариантах осуществления изобретения, аптамер представляет собой пегаптаниб (MACUGEN®). В некоторых вариантах осуществления изобретения, анти-VEGF DARPin® представляет собой абиципар пегол. В некоторых вариантах осуществления изобретения, ингибитор тирозинкиназы VEGFR выбирают из группы, состоящей из 4-(4-бром-2-фторанилино)-6-метокси-7-(1-метилпиперидин-4-илметокси)хиназолина (ZD6474), 4-(4-фтор-2-метилиндол-5-илокси)-6-метокси-7-(3-пирролидин-1-илпропокси)хиназолина (AZD2171), ваталаниба (PTK787), семаксамибина (SU5416) и SUTENT® (сунитиниб). В некоторых вариантах осуществления изобретения, вторая биологическая молекула выбрана из группы, состоящей из IL-1β; IL-6; IL-6R; IL-13; IL-13R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNFα; HtrA1; рецептора VEGF; рецептора ST-2; и белка, генетически связанного с риском AMD. В некоторых вариантах осуществления изобретения, рецептор VEGF представляет собой VEGFR1, VEGFR2, VEGFR3, mbVEGFR или sVEGFR. В некоторых вариантах осуществления изобретения, белок, генетически связанный с риском AMD, выбран из группы, состоящей из компонентов пути комплемента C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC, COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, соединение, которое связывает вторую биологическую молекулу, представляет собой антитело или его антигенсвязывающий фрагмент. В некоторых вариантах осуществления антигенсвязывающий фрагмент антитела выбран из группы, состоящей из Fab, Fab-C, Fab'-SH, Fv, scFv и (Fab')2 фрагментов.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело вводят интравитреально, окулярно, внутриглазно, околосклерально, субтенонально, супрахориоидально, местно, внутривенно, внутримышечно, внутрикожно, чрескожно, внутриартериально, внутрибрюшинно, внутриочагово, интракраниально, внутрисуставно, внутрипростатически, внутриплеврально, интратрахеально, интратекально, интраназально, интравагинально, интраректально, местно, внутриопухольно, внутрибрюшинно, перитонеально, интравентрикулярно, подкожно, субконъюнктивно, интравезикулярно, через слизистую, интраперикардиально, внутрипуповинно, интраорбитально, перорально, трансдермально, путем ингаляции, путем инъекции, глазными каплями, путем имплантации, путем инфузии, путем непрерывной инфузии, локализованными перфузионными ваннами, которые действуют на клетки непосредственно, катетером, промыванием, кремами или липидными композициями. В некоторых вариантах осуществления изобретения, антитело вводят интравитреально, окулярно, интраокулярно, околосклерально, субтенонально, супрахориоидально или местно. В некоторых вариантах осуществления изобретения, антитело вводят интравитреально путем инъекции. В некоторых вариантах осуществления изобретения, антитело вводят местно с помощью глазных капель или мази. В некоторых вариантах осуществления изобретения, антитело вводится устройством доставки порт. В некоторых вариантах осуществления изобретения, субъект представляет собой человека.

В другом аспекте изобретение относится к фармацевтической композиции, содержащей любое из предшествующих антител. В некоторых вариантах осуществления изобретения, фармацевтическая композиция дополнительно содержит полимер. В некоторых вариантах осуществления изобретения, полимер представляет собой биоразлагаемый полимер. В некоторых вариантах осуществления изобретения, фармацевтическая композиция составлена в виде депо из полимерного растворителя, полимерного имплантата или полимерной мицеллы. В некоторых вариантах осуществления изобретения, полимер представляет собой сополимер полимолочной кислоты полигликолевой кислоты (PLGA). В некоторых вариантах осуществления изобретения, фармацевтическая композиция составлена в виде стержня PLGA. В некоторых вариантах осуществления изобретения, фармацевтическая композиция используется для лечения расстройства, связанного с патологическим ангиогенезом, или расстройства, связанного с нежелательной проницаемостью сосудов у млекопитающего. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство или клеточное пролиферативное расстройство. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство. В некоторых вариантах осуществления изобретения, окулярное расстройство выбирают из группы, состоящей из возрастной макулярной дегенерации (AMD), макулярной дегенерации, отека макулы, диабетического макулярного отека (DME) (включая фокальный, нецентральный DME и диффузный, связанный с центром DME), ретинопатии, диабетической ретинопатии (DR) (включая пролиферативную DR (PDR), непролиферативную DR (NPDR) и высотную DR), других связанных с ишемией ретинопатий, ретинопатии недоношенных (ROP), окклюзии вены сетчатки (RVO) (включая центральные (CRVO) и разветвленные (BRVO) формы), CNV (включая миопическую CNV), неоваскуляризации роговицы, болезни, связанной с неоваскуляризацией роговицы, неоваскуляризации сетчатки, болезни, связанной с ретинальной/хориоидальной неоваскуляризацией, патологической близорукости, болезни фон Гиппеля-Линдау, гистоплазмоза глаза, семейной экссудативной витреоретинопатии (FEVR), болезни Коутса, болезни Норри, синдрома остеопороза-псевдоглиомы (OPPG), субконъюнктивального кровоизлияния, рубеоза, неоваскулярного заболевания глаз, неоваскулярной глаукомы, пигментной дистрофии сетчатки (RP), гипертонической ретинопатии, ретинальной ангиоматозной пролиферации, макулярной телеангиэктазии, неоваскуляризации радужки, внутриглазной неоваскуляризации, дегенерации сетчатки, кистозного макулярного отёка (CME), васкулита, отёка диска зрительного нерва, ретинита, конъюнктивита (включая инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит), врожденного амавроза Лебера, увеита (включая инфекционный и неинфекционный увеит), хориоидита, глазного гистоплазмоза, блефарита, сухости глаз, травматического повреждения глаз и болезни Шегрена. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD, DME, DR или RVO. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD. В некоторых вариантах осуществления изобретения, AMD представляет собой влажную AMD. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, является клеточным пролиферативным расстройством. В некоторых вариантах осуществления изобретения, клеточное пролиферативное расстройство представляет собой рак. В некоторых вариантах осуществления изобретения, рак выбирают из группы, состоящей из рака молочной железы, рака толстого кишечника, немелкоклеточного рака легкого, неходжкинской лимфомы (НХЛ), рака почки, рака предстательной железы, рака печени, рака головы и шеи, меланомы, рака яичников, мезотелиомы и множественной миеломы. В некоторых вариантах осуществления изобретения, расстройство, связанное с нежелательной проницаемостью сосудов, выбирается из группы, состоящей из отека, связанного с опухолями головного мозга, асцита, ассоциированного со злокачественными новообразованиями, синдрома Мейга, воспаления легких, нефротического синдрома, перикардиального выпота, плеврального выпота, и проницаемости, связанной с сердечнососудистыми заболеваниями. В некоторых вариантах осуществления изобретения, фармацевтическая композиция дополнительно содержит второй агент, причем второй агент выбран из группы, состоящей из другого антитела, химиотерапевтического агента, цитотоксического агента, анти-ангиогенного агента, иммунодепрессивного агента, пролекарства, цитокина, антагониста цитокинов, цитотоксической лучевой терапии, кортикостероида, противорвотного, противораковой вакцины, анальгетика, агента, ингибирующего рост, и соединения, которое связывается со второй биологической молекулой. В некоторых вариантах осуществления изобретения, антиангиогенный агент представляет собой антагонист VEGF. В некоторых вариантах осуществления изобретения, антагонист VEGF представляет собой анти-VEGF антитело, антитело против рецептора VEGF, растворимый слитый белок рецептора VEGF, аптамер, анти-VEGF DARPin® или ингибитор тирозинкиназы VEGFR. В некоторых вариантах осуществления изобретения, анти-VEGF антитело представляет собой ранибизумаб (LUCENTIS®), RTH-258 или биспецифическое анти-VEGF антитело. В некоторых вариантах осуществления изобретения, биспецифическое анти-VEGF антитело представляет собой анти-VEGF/анти-Ang2 антитело. В некоторых вариантах осуществления изобретения, анти-VEGF/анти-Ang2 антитело представляет собой RG-7716. В некоторых вариантах осуществления изобретения, растворимый слитый белок рецептора VEGF представляет собой афилберцепт (EYLEA®). В некоторых вариантах осуществления изобретения, аптамер представляет собой пегаптаниб (MACUGEN®). В некоторых вариантах осуществления изобретения, анти-VEGF DARPin® представляет собой абиципар пегол. В некоторых вариантах осуществления изобретения, ингибитор тирозинкиназы VEGFR выбирают из группы, состоящей из 4-(4-бром-2-фторанилино)-6-метокси-7-(1-метилпиперидин-4-илметокси)хиназолина (ZD6474), 4-(4-фтор-2-метилиндол-5-илокси)-6-метокси-7-(3-пирролидин-1-илпропокси)хиназолина (AZD2171), ваталаниба (PTK787), семаксамибина (SU5416) и SUTENT® (сунитиниб). В некоторых вариантах осуществления изобретения, вторая биологическая молекула выбрана из группы, состоящей из IL-1β; IL-6; IL-6R; IL-13; IL-13R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNFα; HtrA1; рецептора VEGF; рецептора ST-2; и белка, генетически связанного с риском AMD. В некоторых вариантах осуществления изобретения, рецептор VEGF представляет собой VEGFR1, VEGFR2, VEGFR3, mbVEGFR или sVEGFR. В некоторых вариантах осуществления изобретения, белок, генетически связанный с риском AMD, выбран из группы, состоящей из компонентов пути комплемента C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC, COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, соединение, которое связывает вторую биологическую молекулу, представляет собой антитело или его антигенсвязывающий фрагмент. В некоторых вариантах осуществления антигенсвязывающий фрагмент антитела выбран из группы, состоящей из Fab, Fab-C, Fab'-SH, Fv, scFv и (Fab')2 фрагментов.

В другом аспекте изобретение включает конъюгат антитела, содержащий (i) любое из предшествующих антител и (ii) гидрофильный полимер, ковалентно связанный с антителом. В некоторых вариантах осуществления изобретения, гидрофильный полимер представляет собой полимер гиалуроновой кислоты (НА) или полимер полиэтиленгликоля (ПЭГ). В некоторых вариантах осуществления изобретения, гидрофильный полимер представляет собой HA-полимер. В некоторых вариантах осуществления изобретения, полимер HA имеет молекулярную массу около 1 миллиона дальтон (MДa) или ниже. В некоторых вариантах осуществления любого из предшествующих аспектов, полимер HA имеет молекулярную массу между около 25 кДа и около 500 кДа. В некоторых вариантах осуществления изобретения, полимер HA имеет молекулярную массу между около 100 кДа и около 250 кДа. В некоторых вариантах осуществления изобретения, полимер HA имеет молекулярную массу около 200 кДа. В некоторых вариантах осуществления изобретения, полимер HA не является поперечно сшитым. В некоторых вариантах осуществления изобретения, антитело представляет собой фрагмент антитела, который связывает VEGF. В некоторых вариантах осуществления изобретения, фрагмент антитела выбран из группы, состоящей из фрагментов Fab, Fab-C, Fab’, Fab'-SH, Fv, scFv и (Fab')2. В некоторых вариантах осуществления изобретения, фрагмент антитела представляет собой Fab, Fab-C или Fab’. В некоторых вариантах осуществления изобретения, конъюгат антитела имеет гидродинамический радиус между около 10 нм и около 60 нм. В некоторых вариантах осуществления изобретения, конъюгат антитела имеет гидродинамический радиус между около 25 нм и около 35 нм. В некоторых вариантах осуществления изобретения, гидродинамический радиус составляет около 28 нм. В некоторых вариантах осуществления изобретения, конъюгат антитела имеет окулярный период полувыведения, который увеличен относительно эталонного антитела, которое не ковалентно присоединено к гидрофильному полимеру. В некоторых вариантах осуществления изобретения, окулярный период полувыведения увеличен в по меньшей мере около 2 раза относительно эталонного антитела. В некоторых вариантах осуществления изобретения, окулярный период полувыведения увеличен в по меньшей мере около 4 раза относительно эталонного антитела. В некоторых вариантах осуществления изобретения, окулярный период полувыведения представляет собой витреальный период полувыведения. В некоторых вариантах осуществления изобретения, эталонное антитело идентично антителу конъюгата антитела.

В другом аспекте изобретение относится к конъюгату антител, содержащему (i) антитело, которое специфически связывает VEGF и (ii) полимер НА, ковалентно присоединенный к антителу, причем полимер HA имеет молекулярную массу 1 MДa или ниже. В некоторых вариантах осуществления любого из предшествующих аспектов, полимер HA имеет молекулярную массу между около 25 кДа и около 500 кДа. В некоторых вариантах осуществления изобретения, полимер HA имеет молекулярную массу между около 100 кДа и около 250 кДа. В некоторых вариантах осуществления изобретения, полимер HA имеет молекулярную массу около 200 кДа. В некоторых вариантах осуществления изобретения, полимер HA не является поперечно сшитым. В некоторых вариантах осуществления изобретения, антитело представляет собой фрагмент антитела, который связывает VEGF. В некоторых вариантах осуществления изобретения, фрагмент антитела выбран из группы, состоящей из фрагментов Fab, Fab-C, Fab’, Fab'-SH, Fv, scFv и (Fab')2. В некоторых вариантах осуществления изобретения, фрагмент антитела представляет собой Fab, Fab-C или Fab’. В некоторых вариантах осуществления изобретения, конъюгат антитела имеет гидродинамический радиус между около 10 нм и около 60 нм. В некоторых вариантах осуществления изобретения, конъюгат антитела имеет гидродинамический радиус между около 25 нм и около 35 нм. В некоторых вариантах осуществления изобретения, гидродинамический радиус составляет около 28 нм. В некоторых вариантах осуществления изобретения, конъюгат антитела имеет окулярный период полувыведения, который увеличен относительно эталонного антитела, которое не ковалентно присоединено к гидрофильному полимеру. В некоторых вариантах осуществления изобретения, окулярный период полувыведения увеличен в по меньшей мере около 2 раза относительно эталонного антитела. В некоторых вариантах осуществления изобретения, окулярный период полувыведения увеличен в по меньшей мере около 4 раза относительно эталонного антитела. В некоторых вариантах осуществления изобретения, окулярный период полувыведения представляет собой витреальный период полувыведения. В некоторых вариантах осуществления изобретения, эталонное антитело идентично антителу конъюгата антитела.

В некоторых вариантах осуществления любого из предшествующих аспектов, антитело ковалентно присоединено к полимеру с помощью обратимого пролекарственного линкера. В некоторых вариантах реализации изобретения, полимер представляет собой гидрогель. В некоторых вариантах осуществления изобретения, гидрогель представляет собой гидрогель на основе ПЭГ. В некоторых вариантах осуществления изобретения, гидрогель имеет форму микрочастицы гранулы.

В другом аспекте изобретение относится к слитому белку, содержащему любое из предшествующих антител, ковалентно связанных с HA-связывающим доменом. В некоторых вариантах осуществления изобретения, HA-связывающий домен ковалентно присоединен к тяжелой цепи или легкой цепи антитела. В некоторых вариантах осуществления изобретения, HA-связывающий домен ковалентно присоединен к С-концу тяжелой цепи или С-концу легкой цепи. В некоторых вариантах осуществления изобретения, HA-связывающий домен ковалентно присоединен к С-концу тяжелой цепи. В некоторых вариантах осуществления изобретения, HA-связывающий домен ковалентно присоединен к С-концу легкой цепи. В некоторых вариантах осуществления изобретения, слитый белок дополнительно содержит линкер, причем линкер расположен между антителом и HA-связывающим доменом. В некоторых вариантах осуществления изобретения, линкер содержит аминокислотную последовательность GGGGS (SEQ ID NO: 61). В некоторых вариантах осуществления изобретения, линкер состоит из аминокислотной последовательности GGGGS (SEQ ID NO: 61). В некоторых вариантах осуществления изобретения, антитело представляет собой фрагмент антитела, который связывает VEGF. В некоторых вариантах осуществления изобретения, фрагмент антитела выбран из группы, состоящей из фрагментов Fab, Fab-C, Fab’, Fab'-SH, Fv, scFv и (Fab')2. В некоторых вариантах осуществления изобретения, фрагмент антитела представляет собой Fab. В некоторых вариантах осуществления изобретения, HA-связывающий домен ковалентно присоединен к С-концу домена CH1 Fab. В некоторых вариантах осуществления изобретения, HA-связывающий белок ковалентно присоединен к С-концу домена CL Fab. В некоторых вариантах осуществления изобретения, HA-связывающий домен выбран из группы, состоящей из связывающего модуля, домена G1 и богатого лизином олигопептида. В некоторых вариантах осуществления изобретения, HA-связывающий домен является модулем связи. В некоторых вариантах осуществления изобретения, модуль связи выбирают из группы, состоящей из гена 6, стимулированного фактором некроза опухоли (TSG6), CD44, рецептора гиалуроновой кислоты эндотелия лимфатических сосудов 1 (LYVE-1), белка, связывающего гиалуроновую кислоту и протеогликан (HAPLN) 1, HAPLN2, HAPLN3, HAPLN4, аггрекана, бревикана, нейрокана, фосфакана, версикана, CAB61358, KIA0527, стабилина-1 и стабилина-2 модулей связи. В некоторых вариантах осуществления изобретения, модуль связи является модулем связи TSG6. В некоторых вариантах осуществления изобретения, модуль связи TSG6 является модулем связи TSG6 человека или модулем связи TSG6 кролика. В некоторых вариантах осуществления изобретения, модуль связи TSG является модулем связи TSG6 человека. В некоторых вариантах осуществления изобретения, модуль связи TSG6 человека содержит аминокислотные остатки 36-128 TSG6 человека.

В некоторых вариантах осуществления любого из предыдущих аспектов, слитый белок дополнительно содержит по меньшей мере один дополнительный HA-связывающий домен. В некоторых вариантах осуществления изобретения, по меньшей мере один дополнительный HA-связывающий домен ковалентно присоединен к тяжелой цепи или легкой цепи антитела. В некоторых вариантах осуществления изобретения, по меньшей мере один дополнительный HA-связывающий белок соединен с антителом с помощью линкера. В некоторых вариантах осуществления изобретения, линкер содержит аминокислотную последовательность GGGGS (SEQ ID NO: 61). В некоторых вариантах осуществления изобретения, линкер состоит из аминокислотной последовательности GGGGS (SEQ ID NO: 61). В некоторых вариантах осуществления изобретения, первый HA-связывающий домен ковалентно присоединен к тяжелой цепи, а второй связывающий HA домен ковалентно присоединен к легкой цепи. В некоторых вариантах осуществления изобретения, первый HA-связывающий домен соединен с C-концом тяжелой цепи, а второй HA-связывающий домен соединен с C-концом легкой цепи. В некоторых вариантах осуществления изобретения, по меньшей мере один дополнительный HA-связывающий белок выбирают из группы, состоящей из модуля связи, домена G1 и богатого лизином олигопептида. В некоторых вариантах осуществления изобретения, по меньшей мере один дополнительный HA-связывающий белок представляет собой модуль связи. В некоторых вариантах осуществления изобретения, модуль связи является модулем связи TSG6. В некоторых вариантах осуществления изобретения, модуль связи TSG6 является модулем связи TSG6 человека или модулем связи TSG6 кролика. В некоторых вариантах осуществления изобретения, модуль связи TSG6 является модулем связи TSG6 человека. В некоторых вариантах осуществления изобретения, модуль связи TSG6 человека содержит аминокислотные остатки 36-128 TSG6 человека.

В некоторых вариантах осуществления любого из предшествующих аспектов, слитый белок специфически связывается с VEGF и HA. В некоторых вариантах осуществления изобретения, слитый белок связывает HA с Kd около 2 мкМ или ниже. В некоторых вариантах осуществления изобретения, слитый белок связывает HA с Kd между около 1 нМ и около 500 нМ. В некоторых вариантах осуществления изобретения, слитый белок связывает HA с Kd между около 1 нМ и около 50 нМ. В некоторых вариантах осуществления изобретения, слитый белок связывает HA с Kd около 10 нМ.

В некоторых вариантах осуществления любого из предыдущих аспектов, слитый белок имеет окулярный период полувыведения, который увеличен по сравнению с эталонным антителом, которое не ковалентно присоединено к HA-связывающему домену. В некоторых вариантах осуществления изобретения, окулярный период полувыведения увеличен в по меньшей мере около 2 раза относительно эталонного антитела. В некоторых вариантах осуществления изобретения, окулярный период полувыведения увеличен в по меньшей мере около 4 раза относительно эталонного антитела. В некоторых вариантах осуществления изобретения, окулярный период полувыведения представляет собой витреальный период полувыведения. В некоторых вариантах осуществления изобретения, эталонное антитело идентично антителу слитого белка.

В другом аспекте изобретение относится к способу ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом, включающему введение субъекту эффективного количества любого из предшествующих конъюгатов антитела, что ослабляет или ингибирует ангиогенез у субъекта.

В другом аспекте изобретение относится к способу лечения расстройства, связанного с патологическим ангиогенезом, причем способ включает введение эффективного количества любого из предшествующих конъюгатов антитела субъекту, нуждающемуся в таком лечении.

В другом аспекте изобретение относится к способу ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом, включающему введение субъекту эффективного количества любого из предшествующих слитых белков, что ослабляет или ингибирует ангиогенез у субъекта.

В другом аспекте изобретение относится к способу лечения расстройства, связанного с патологическим ангиогенезом, причем способ включает введение эффективного количества любого из предшествующих слитых белков субъекту, нуждающемуся в таком лечении.

В некоторых вариантах осуществления любого из предшествующих аспектов, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство. В некоторых вариантах осуществления изобретения, окулярное расстройство выбирают из группы, состоящей из AMD, макулярной дегенерации, отека макулы, DME (включая фокальный, нецентральный DME и диффузный, связанный с центром DME), ретинопатии, DR (включая PDR, NPDR и высотную DR), других связанных с ишемией ретинопатий, ROP, RVO (включая CRVO и BRVO формы), CNV (включая миопическую CNV), неоваскуляризации роговицы, болезни, связанной с неоваскуляризацией роговицы, неоваскуляризации сетчатки, болезни, связанной с ретинальной/хориоидальной неоваскуляризацией, патологической близорукости, болезни фон Гиппеля-Линдау, гистоплазмоза глаза, FEVR, болезни Коутса, болезни Норри, OPPG, субконъюнктивального кровоизлияния, рубеоза, неоваскулярного заболевания глаз, неоваскулярной глаукомы, RP, гипертонической ретинопатии, ретинальной ангиоматозной пролиферации, макулярной телеангиэктазии, неоваскуляризации радужки, внутриглазной неоваскуляризации, дегенерации сетчатки, CME, васкулита, отёка диска зрительного нерва, ретинита, конъюнктивита (включая инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит), врожденного амавроза Лебера, увеита (включая инфекционный и неинфекционный увеит), хориоидита, глазного гистоплазмоза, блефарита, сухости глаз, травматического повреждения глаз и болезни Шегрена. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD, DME, DR или RVO. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD. В некоторых вариантах осуществления изобретения, AMD представляет собой влажную AMD.

В некоторых вариантах осуществления любого из предшествующих аспектов, способ дополнительно включает введение субъекту эффективного количества второго агента, причем второй агент выбран из группы, состоящей из другого антитела, анти-ангиогенного агента, цитокина, антагониста цитокинов, кортикостероида, анальгетика и соединения, которое связывается со второй биологической молекулой. В некоторых вариантах осуществления изобретения, антиангиогенный агент представляет собой антагонист VEGF. В некоторых вариантах осуществления изобретения, антагонист VEGF представляет собой анти-VEGF антитело, антитело против рецептора VEGF, растворимый слитый белок рецептора VEGF, аптамер, анти-VEGF DARPin® или ингибитор тирозинкиназы VEGFR. В некоторых вариантах осуществления изобретения, анти-VEGF антитело представляет собой ранибизумаб (LUCENTIS®), RTH-258 или биспецифическое анти-VEGF антитело. В некоторых вариантах осуществления изобретения, биспецифическое анти-VEGF антитело представляет собой анти-VEGF/анти-Ang2 антитело. В некоторых вариантах осуществления изобретения, анти-VEGF/анти-Ang2 антитело представляет собой RG-7716. В некоторых вариантах осуществления изобретения, растворимый слитый белок рецептора VEGF представляет собой афилберцепт (EYLEA®). В некоторых вариантах осуществления изобретения, аптамер представляет собой пегаптаниб (MACUGEN®). В некоторых вариантах осуществления изобретения, анти-VEGF DARPin® представляет собой абиципар пегол. В некоторых вариантах осуществления изобретения, ингибитор тирозинкиназы VEGFR выбирают из группы, состоящей из 4-(4-бром-2-фторанилино)-6-метокси-7-(1-метилпиперидин-4-илметокси)хиназолина (ZD6474), 4-(4-фтор-2-метилиндол-5-илокси)-6-метокси-7- (3-пирролидин-1-илпропокси)хиназолина (AZD2171), ваталаниба (PTK787), семаксамибина (SU5416) и SUTENT® (сунитиниб). В некоторых вариантах осуществления изобретения, вторая биологическая молекула выбрана из группы, состоящей из IL-1β; IL-6; IL-6R; IL-13; IL-13R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNFα; HtrA1; рецептора VEGF; рецептора ST-2; и белка, генетически связанного с риском AMD. В некоторых вариантах осуществления изобретения, рецептор VEGF представляет собой VEGFR1, VEGFR2, VEGFR3, mbVEGFR или sVEGFR. В некоторых вариантах осуществления изобретения, белок, генетически связанный с риском AMD, выбран из группы, состоящей из компонентов пути комплемента C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC, COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, соединение, которое связывает вторую биологическую молекулу, представляет собой антитело или его антигенсвязывающий фрагмент. В некоторых вариантах осуществления антигенсвязывающий фрагмент антитела выбран из группы, состоящей из Fab, Fab-C, Fab'-SH, Fv, scFv и (Fab')2 фрагментов.

В некоторых вариантах осуществления любого из предшествующих аспектов конъюгат антитела вводят интравитреально, окулярно, внутриглазно, околосклерально, субтенонально, супрахориоидально, местно, внутривенно, внутримышечно, внутрикожно, чрескожно, внутриартериально, внутрибрюшинно, внутриочагово, интракраниально, внутрисуставно, внутрипростатически, внутриплеврально, интратрахеально, интратекально, интраназально, интравагинально, интраректально, местно, внутриопухольно, внутрибрюшинно, перитонеально, интравентрикулярно, подкожно, субконъюнктивно, интравезикулярно, через слизистую, интраперикардиально, внутрипуповинно, интраорбитально, перорально, трансдермально, путем ингаляции, путем инъекции, глазными каплями, путем имплантации, путем инфузии, путем непрерывной инфузии, локализованными перфузионными ваннами которые действуют на клетки непосредственно, катетером, промыванием, кремами или липидными композициями. В некоторых вариантах осуществления изобретения, конъюгат антитела вводят интравитреально, окулярно, интраокулярно, околосклерально, субтенонально, супрахориоидально или местно. В некоторых вариантах осуществления изобретения, конъюгат антитела вводят интравитреально путем инъекции. В некоторых вариантах осуществления изобретения, конъюгат антитела вводят местно с помощью глазных капель или мази. В некоторых вариантах осуществления изобретения, конъюгат антитела вводится устройством доставки порт.

В некоторых вариантах осуществления любого из предшествующих аспектов слитый белок вводят интравитреально, окулярно, внутриглазно, околосклерально, субтенонально, супрахориоидально, местно, внутривенно, внутримышечно, внутрикожно, чрескожно, внутриартериально, внутрибрюшинно, внутриочагово, интракраниально, внутрисуставно, внутрипростатически, внутриплеврально, интратрахеально, интратекально, интраназально, интравагинально, интраректально, местно, внутриопухольно, внутрибрюшинно, перитонеально, интравентрикулярно, подкожно, субконъюнктивно, интравезикулярно, через слизистую, интраперикардиально, внутрипуповинно, интраорбитально, перорально, трансдермально, путем ингаляции, путем инъекции, глазными каплями, путем имплантации, путем инфузии, путем непрерывной инфузии, локализованными перфузионными ваннами которые действуют на клетки непосредственно, катетером, промыванием, кремами или липидными композициями. В некоторых вариантах осуществления изобретения, слитый белок вводят интравитреально, окулярно, интраокулярно, околосклерально, субтенонально, супрахориоидально или местно. В некоторых вариантах осуществления изобретения, слитый белок вводят интравитреально путем инъекции. В некоторых вариантах осуществления изобретения, слитый белок вводят местно с помощью глазных капель или мази. В некоторых вариантах осуществления изобретения, слитый белок вводится устройством доставки порт. В некоторых вариантах осуществления изобретения, субъект представляет собой человека.

В другом аспекте изобретение относится к фармацевтической композиции, содержащей любой из предшествующих конъюгатов антитела.

В другом аспекте изобретение относится к фармацевтической композиции, содержащей любой из предшествующих слитых белков.

В некоторых вариантах осуществления любого из предшествующих аспектов, фармацевтическая композиция используется для лечения расстройства, связанного с патологическим ангиогенезом у млекопитающего. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство. В некоторых вариантах осуществления изобретения, окулярное расстройство выбирают из группы, состоящей из AMD, макулярной дегенерации, отека макулы, DME (включая фокальный, нецентральный DME и диффузный, связанный с центром DME), ретинопатии, DR (включая PDR, NPDR и высотную DR), других связанных с ишемией ретинопатий, ROP, RVO (включая CRVO и BRVO формы), CNV (включая миопическую CNV), неоваскуляризации роговицы, болезни, связанной с неоваскуляризацией роговицы, неоваскуляризации сетчатки, болезни, связанной с ретинальной/хориоидальной неоваскуляризацией, патологической близорукости, болезни фон Гиппеля-Линдау, гистоплазмоза глаза, FEVR, болезни Коутса, болезни Норри, OPPG, субконъюнктивального кровоизлияния, рубеоза, неоваскулярного заболевания глаз, неоваскулярной глаукомы, RP, гипертонической ретинопатии, ретинальной ангиоматозной пролиферации, макулярной телеангиэктазии, неоваскуляризации радужки, внутриглазной неоваскуляризации, дегенерации сетчатки, CME, васкулита, отёка диска зрительного нерва, ретинита, конъюнктивита (включая инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит), врожденного амавроза Лебера, увеита (включая инфекционный и неинфекционный увеит), хориоидита, глазного гистоплазмоза, блефарита, сухости глаз, травматического повреждения глаз и болезни Шегрена. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD, DME, DR или RVO. В некоторых вариантах осуществления изобретения, окулярное расстройство представляет собой AMD. В некоторых вариантах осуществления изобретения, AMD представляет собой влажную AMD.

В некоторых вариантах осуществления любого из предшествующих аспектов фармацевтическая композиция дополнительно содержит второй агент, причем второй агент выбран из группы, состоящей из другого антитела, анти-ангиогенного агента, цитокина, антагониста цитокинов, кортикостероида, анальгетика и соединения, которое связывается со второй биологической молекулой. В некоторых вариантах осуществления изобретения, антиангиогенный агент представляет собой антагонист VEGF. В некоторых вариантах осуществления изобретения, антагонист VEGF представляет собой анти-VEGF антитело, антитело против рецептора VEGF, растворимый слитый белок рецептора VEGF, аптамер, анти-VEGF DARPin® или ингибитор тирозинкиназы VEGFR. В некоторых вариантах осуществления изобретения, анти-VEGF антитело представляет собой ранибизумаб (LUCENTIS®), RTH-258 или биспецифическое анти-VEGF антитело. В некоторых вариантах осуществления изобретения, биспецифическое анти-VEGF антитело представляет собой анти-VEGF/анти-Ang2 антитело. В некоторых вариантах осуществления изобретения, анти-VEGF/анти-Ang2 антитело представляет собой RG-7716. В некоторых вариантах осуществления изобретения, растворимый слитый белок рецептора VEGF представляет собой афилберцепт (EYLEA®). В некоторых вариантах осуществления изобретения, аптамер представляет собой пегаптаниб (MACUGEN®). В некоторых вариантах осуществления изобретения, анти-VEGF DARPin® представляет собой абиципар пегол. В некоторых вариантах осуществления изобретения, ингибитор тирозинкиназы VEGFR выбирают из группы, состоящей из 4-(4-бром-2-фторанилино)-6-метокси-7-(1-метилпиперидин-4-илметокси)хиназолина (ZD6474), 4-(4-фтор-2-метилиндол-5-илокси)-6-метокси-7-(3-пирролидин-1-илпропокси)хиназолина (AZD2171), ваталаниба (PTK787), семаксамибина (SU5416) и SUTENT® (сунитиниб). В некоторых вариантах осуществления изобретения, вторая биологическая молекула выбрана из группы, состоящей из IL-1β; IL-6; IL-6R; IL-13; IL-13R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNFα; HtrA1; рецептора VEGF; рецептор ST-2; и белка, генетически связанного с риском AMD. В некоторых вариантах осуществления изобретения, рецептор VEGF представляет собой VEGFR1, VEGFR2, VEGFR3, mbVEGFR или sVEGFR. В некоторых вариантах осуществления изобретения, белок, генетически связанный с риском AMD, выбран из группы, состоящей из компонентов пути комплемента C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC, COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, соединение, которое связывает вторую биологическую молекулу, представляет собой антитело или его антигенсвязывающий фрагмент. В некоторых вариантах осуществления антигенсвязывающий фрагмент антитела выбран из группы, состоящей из Fab, Fab-C, Fab'-SH, Fv, scFv и (Fab')2 фрагментов.

В другом аспекте изобретение относится к способу идентификации изменения аминокислотного остатка, который обеспечивает усиление связывания антитела с молекулой-мишенью, причем способ включает: (а) обеспечение библиотеки дисплея, содержащей нуклеиновые кислоты, кодирующие варианты антитела-кандидата, причем каждый вариант антитела-кандидата содержит изменение аминокислотного остатка в VH или VL по сравнению с эталонным антителом, и в котором изменения аминокислотного остатка в каждом положении VH или VL присутствуют в библиотеке дисплея; (b) сортировку библиотеки дисплея на основе связывания вариантов антитела-кандидата с молекулой-мишенью с образованием сортированной библиотеки, причем сортированная библиотека содержит варианты антитела-кандидата с улучшенным связыванием с молекулой-мишенью по сравнению с эталонным антителом; и (c) сравнение частоты, с которой каждое изменение аминокислотного остатка присутствует в библиотеке дисплея и в сортированной библиотеке, определенной с помощью массового параллельного секвенирования, тем самым определение того, обогащено ли каждое изменение аминокислотного остатка в сортированной библиотеке по сравнению с библиотекой дисплея, в которой изменение аминокислотного остатка идентифицируется как способствующее усиленному связыванию с молекулой-мишенью, если оно обогащено в сортированной библиотеке по сравнению с библиотекой дисплея.

В другом аспекте изобретение относится к способу идентификации изменения аминокислотного остатка, который обеспечивает повышенную стабильность антитела, причем способ включает: (а) обеспечение библиотеки дисплея, содержащей нуклеиновые кислоты, кодирующие варианты антитела-кандидата, причем каждый вариант антитела-кандидата содержит изменение аминокислотного остатка в VH или VL по сравнению с эталонным антителом, и в котором изменения аминокислотного остатка в каждом положении VH или VL присутствуют в библиотеке дисплея; (b) сортировку библиотеки дисплея на основе связывания вариантов антитела-кандидата с молекулой-мишенью с образованием сортированной библиотеки, причем сортированная библиотека содержит варианты антитела-кандидата с улучшенной стабильностью по сравнению с эталонным антителом; и (c) сравнение частоты, с которой каждое изменение аминокислотного остатка присутствует в библиотеке дисплея и в сортированной библиотеке, определенной с помощью массового параллельного секвенирования, тем самым определение того, обогащено ли каждое изменение аминокислотного остатка в сортированной библиотеке по сравнению с библиотекой дисплея, в которой изменение аминокислотного остатка идентифицируется как придающее повышенную стабильность антителу, если оно обогащено в сортированной библиотеке по сравнению с библиотекой дисплея.

В некоторых вариантах осуществления любого из предшествующих аспектов, способ дополнительно включает в себя определение частоты, с которой каждое изменение аминокислот присутствует в библиотеке дисплея и сортированной библиотеке путем массового параллельного секвенирования на следующем этапе (b).

В некоторых вариантах осуществления любого из предыдущих аспектов, изменение аминокислотного остатка обогащено по меньшей мере в 2 раза в сортированной библиотеке по сравнению с библиотекой дисплея.

В некоторых вариантах осуществления любого из предыдущих аспектов библиотека дисплея выбирается из группы, состоящей из библиотеки фагового дисплея, библиотеки дисплея бактерий, библиотеки дисплея дрожжей, библиотеки дисплея млекопитающих, библиотеки дисплея рибосом и библиотеки дисплея мРНК. В некоторых вариантах осуществления изобретения, библиотека дисплея представляет собой библиотеку фагового дисплея.

В некоторых вариантах осуществления любого из предшествующих аспектов, изменение аминокислотного остатка кодируется набором вырожденных кодонов. В некоторых вариантах осуществления изобретения, набор вырожденных кодонов представляет собой набор NNK или NNS кодона, где N представляет собой A, C, G или T; K представляет собой G или T; и S представляет собой C или G. В некоторых вариантах осуществления изобретения, набор вырожденных кодонов представляет собой набор кодонов NNK.

В некоторых вариантах осуществления любого из предшествующих аспектов, сортировка на этапе (b) включает контактирование библиотеки дисплея с иммобилизованной молекулой-мишенью или эпитопом.

В некоторых вариантах осуществления любого из предшествующих аспектов, сортировка на этапе (b) включает контактирование библиотеки дисплея с растворимой молекулой-мишенью или эпитопом.

В некоторых вариантах осуществления любого из предыдущих аспектов, библиотека дисплея содержит по меньшей мере 1×106 вариантов антитела-кандидата. В некоторых вариантах осуществления изобретения, библиотека дисплея содержит по меньшей мере 1×108 вариантов антител. В некоторых вариантах осуществления изобретения, библиотека дисплея содержит по меньшей мере 1×109 вариантов антител.

В некоторых вариантах осуществления любого из предшествующих аспектов, массовое параллельное секвенирование включает в себя глубокое секвенирование, ультра-глубокое секвенирование и/или секвенирование следующего поколения.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело представляет собой моноклональное антитело.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело представляет собой антитело IgG.

В некоторых вариантах осуществления любого из предшествующих аспектов антитело представляет собой фрагмент антитела. В некоторых вариантах осуществления изобретения, фрагмент антитела выбирают из группы, состоящей из Fab, scFv, Fv, Fab', Fab'-SH, F(ab')2 и диатела. В некоторых вариантах осуществления изобретения, фрагмент антитела представляет собой Fab.

В некоторых вариантах осуществления любого из предшествующих аспектов, способ дополнительно включает в себя получение антитела, которое содержит изменение аминокислотного остатка, идентифицированное стадиями способа.

В некоторых аспектах любое из предшествующих антител может быть использовано при изготовлении лекарственного средства для ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В некоторых аспектах любое из предшествующих антител может быть использовано при изготовлении лекарственного средства для лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В некоторых аспектах любое из предшествующих антител может быть использовано при изготовлении лекарственного средства для ингибирования проницаемости сосудов у субъекта, страдающего расстройством, связанным с нежелательной проницаемостью сосудов.

В некоторых аспектах любое из предшествующих антител может быть использовано в способе снижения или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В некоторых аспектах любое из предшествующих антител может быть использовано в способе лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В некоторых аспектах любое из предшествующих антител может быть использовано в способе ингибирования проницаемости сосудов у субъекта, страдающего расстройством, связанным с нежелательной проницаемостью сосудов.

В другом аспекте изобретение относится к композиции, содержащей любое из предшествующих антител для использования в способе ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В другом аспекте изобретение относится к композиции, содержащей любое из предшествующих антител для использования в способе лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В другом аспекте изобретение относится к композиции, содержащей любое из предшествующих антител для использования в способе ингибирования проницаемости сосудов у субъекта, страдающего расстройством, связанным с нежелательной проницаемостью сосудов.

В некоторых аспектах любой из предшествующих конъюгатов антител может быть использован при изготовлении лекарственного средства для ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В некоторых аспектах любой из предшествующих конъюгатов антитела может быть использован при изготовлении лекарственного средства для лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В некоторых аспектах любой из предшествующих конъюгатов антитела может быть использован в способе снижения или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В некоторых аспектах любой из предшествующих конъюгатов антитела может быть использован в способе лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В другом аспекте изобретение относится к композиции, содержащей любой из предшествующих конъюгатов антитела для использования в способе ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В другом аспекте изобретение относится к композиции, содержащей любой из предшествующих конъюгатов антитела для использования в способе лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В некоторых аспектах любой из предшествующих слитых белков может быть использован при изготовлении лекарственного средства для ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В некоторых аспектах любой из предшествующих слитых белков может быть использован при изготовлении лекарственного средства для лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В некоторых аспектах любой из предшествующих слитых белков может быть использован в способе снижения или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В некоторых аспектах любой из предшествующих слитых белков может быть использован в способе лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

В другом аспекте изобретение относится к композиции, содержащей любой из предшествующих слитых белков для использования в способе ослабления или ингибирования ангиогенеза у субъекта, имеющего расстройство, связанное с патологическим ангиогенезом.

В другом аспекте изобретение относится к композиции, содержащей любой из предшествующих слитых белков для использования в способе лечения расстройства, связанного с патологическим ангиогенезом у субъекта, нуждающегося в таком лечении.

Следует понимать, что любой из вариантов осуществления изобретения, описанных выше, в отношении способов лечения (например, в отношении свойств антител, дополнительных терапевтических агентов, расстройств, связанных с патологическим ангиогенезом (например, окулярных расстройств, таких как AMD, DME, DR или RVO), путей введения (например, интравитреальная инъекция) и тому подобное) могут быть использованы в контексте лекарственных средств, применений и композиций, описанных выше.

Краткое описание графических материалов

На Фиг. 1A-1F изображены собой карты интенсивности, показывающие log2 коэффициента обогащения (также называемого log2 коэффициента обогащения) для всех мутаций в пэннингах, полученных из прохождения NNK VH (Фиг. 1A-1C) и VL (Фиг. 1D-1F) библиотек против анти-gD метки антитела (анти-gD), белка L или белка A. Последовательность аминокислот G6.31 дикого типа VH (Фиг. 1A-1C) или VL (Фиг. 1D-1F), начиная с положения 2, показана ниже каждой тепловой карты. На Фиг. 1А изображены результаты, полученные при пэннинге прохождения NHK библиотеки VH против анти-gD. На Фиг. 1В изображены результаты, полученные при пэннинге прохождения NNK VH библиотеки против белка L. На Фиг. 1C изображены результаты, полученные при пэннинге прохождения NNK библиотеки VH против белка A. На Фиг. 1D изображены результаты, полученные при пэннинге прохождения NNK библиотеки VL против анти-gD. На Фиг. 1Е изображены результаты, полученные при пэннинге прохождения NNK библиотеки VL против белка L. На Фиг. 1F изображены результаты, полученные при пэннинге прохождения NNK библиотеки VL против белка A.

На Фиг. 2A-2B изображена серия графиков и таблиц, показывающих корреляцию между log2 коэффициентов обогащения от пэннинга VH (Фиг. 2A) и VL (Фиг. 2B) против анти-gD-метки антитела («gD»), белка A («белокA») и белка L («белокL»). В таблицах показан коэффициент корреляции Пирсона (r2; «Кор») для сравнения между (i) gD и белокA; (ii) gD и белокL; и (iii) белокA и белокL. Корреляция для коэффициентов обогащения мутаций в позициях, классифицированных как принадлежащие к гидрофобному ядру («ядро»), расширенному гидрофобному ядру («расширенное ядро»), поверхности VH/VL («поверхность») или положениям, которые образуют важные водородные связи, солевые мосты или иным образом представляют интерес («другое»). Эти цифры показывают, что использование анти-gD антитела, белка A или белка L для обнаружения сворачивания Fab-молекулы у фага дает аналогичные результаты. Единственными мутациями, которые значительно отличались по своим коэффициентам обогащения в разных пэннингах, являются те, которые расположены непосредственно в сайтах связывания белка A или белка L. Эти остатки маркируются как «белок A», «белок L1» и «белок L2» (существуют два сайта связывания для белка L), соответственно. Сайты связывания для белка L описаны в Graille et al. Structure 9 (8): 679-687, 2001, которая включена в данное описание посредством ссылки во всей ее полноте. Связывающие сайты для белка G описаны в Graille et al. Proc. Natl. Acad. Sci. USA 97(10): 5399-5404, 2000, которая включена в данное описание посредством ссылки во всей ее полноте.

На Фиг. 3A-3B изображены графики, показывающие log2 коэффициента обогащения для всех мутаций в заданном положении в VH (Фиг. 3A) и VL (Фиг. 3B). Позиции затенены в зависимости от того, находятся ли они в гидрофобном ядре (темно-серый), в расширенном гидрофобном ядре (серый) или в интерфейсе VH/VL (светло-серый). Позиции, которые сохраняются и не переносят мутации (log2 коэффициента обогащения Z-баллы <-0,5), обозначены.

На Фиг. 3C-3D изображена визуализация кристаллической структуры антиген-свободного G6 Fab (код банка данных белка (PDB): 2FJF), показывающая местоположение сохраненных позиций в структуре VH (Фиг. 3C) и VL (Фиг. 3D), соответственно. Схема затенения такая же, как на Фиг. 3A-3B. Кроме того, указываются сохраненные позиции, которые образуют важные водородные связи, солевые мостики или имеют важное значение.

На Фиг. 4A-4B изображены карты интенсивности, показывающие log2 коэффициента обогащения всех отдельных аминокислотных замещений, полученных путем пэннинга прохождения NHK библиотеки VH (Фиг. 4A) и VL (Фиг. 4B) против VEGF.

На Фиг. 5A-5B изображены графики, показывающие, что log2 коэффициентов обогащения, полученные путем пэннинга VEGF библиотек VH (Фиг. 5A) и VL (Фиг. 5B), имеют бимодальное распределение. Мутации, которые были истощены за пределом обнаружения, были установлены на максимальное наблюдаемое истощение для конкретного эксперимента. Мутации окрашены в соответствии с их местоположением в HVR, в консервативной рамке, как определено с помощью пэннинга gD, или остальной части рамки.

На Фиг. 5C-5D изображены графики, показывающие сравнение между log2 коэффициента обогащения от пэннинга VEGF выбранных мутаций с изменением Kd относительно родительского антитела G6.31 (Фиг. 5C) или изменения температуры плавления (Tm) относительно G6.31 (Фиг. 5D). Использована та же схема затенения, что и на Фиг. 5A-5B.

На Фиг. 5E-5F изображена визуализация кристаллической структуры VEGF-связанной формы VH (Фиг. 5E) и VL (Фиг. 5F) G6 Fab (код PDB 2FJG), показывающая расположение выбранных мутаций в виде сфер. Поверхность VEGF показана как представление поверхности. Использована та же схема затенения, что и на Фиг. 5A-5B. На этикетке показано изменение в Tm (°C) и кратное изменение в аффинности связывания (Kd) по сравнению с G6.31.

На Фиг. 6А изображены наложенные визуализации молекул, присутствующих в кристаллической структуре антиген-свободного G6 Fab (PDB 2FJF), показывающие различные углы изгиба Fab, демонстрируемые молекулами.

На Фиг. 6B-6C изображена визуализация, показывающая подробный вид поверхности VL-VH и конформации боковой цепи LC-83F и LC-106I в молекулах с небольшим углом изгиба Fab (Фиг. 6B, темно-серый) и с молекулами с большим углом изгиба Fab (Фиг. 6C, светло-серый), соответственно. Для ясности удалены β-нить E, спираль α-1 и петля, соединяющая оба элемента.

На Фиг. 7А изображен график (правая вставка), показывающий угол chi1 (χ1) положения LC-F83 из 319 структур антител человека из PDB. Визуализация (левая вставка) показывает положение LC-F83 в конформациях «в» и «наружу».

На Фиг. 7В изображен график (правая вставка), показывающий угол изгиба остова конформации для пси (Ψ) угла в положении 105 и фи (Ф) угла в положении 106. Структуры затенены в соответствии с их углом chi1, как показано на Фиг. 7A. Визуализация (левая вставка) показывает положения 103-108 легкой цепи (LC) в конформациях «в» и «наружу».

На Фиг. 7C изображен серия графиков, показывающих угол изгиба (справа вверху) и площадь контакта VL/CL (внизу справа) для структур антител с LC-F83 в «в»-конформации и «наружу»-конформации. Результаты сравниваются с углом изгиба Fab и размером поверхности VL/CL 319 человеческих Fab-структур из PDB, несущих LC-F83 и 22 человеческих структур, несущих LC-83A. На левой вставке показаны наложенные визуализации молекулы G6, имеющие большой угол изгиба и небольшой угол изгиба. Площадь контакта VL/CL обозначается кружком.

На Фиг. 8А изображен график, показывающий угол chi1 для LC-F83 для кристаллической структуры G6 Fab с большим углом изгиба (цепи G6 VU, G6-VU) и кристаллической структуры с малым углом изгиба (цепи G6 BA, G6-BA).

На Фиг. 8B изображен график, показывающий результаты имитации молекулярной динамики для указанных молекул. Угол изгиба строится как функция времени.

На Фиг. 8C изображен график, показывающий результаты имитации молекулярной динамики, изображающей угол изгиба Fab как функции от угла кручения VH/VL («HL-угол»). График рассеяния/контурный график показывает угол кручения VH/VL и угол изгиба, который VU.F83 (темно-серый) и VU.F83A (светло-серый) принимают во время имитации молекулярной динамики. Две разные популяции видны для двух молекул.

На Фиг. 9А изображен график, показывающий распределение угла изгиба Fab для молекул BA-F83 (LC-F83 в «наружу»-конформации), BA-F83A, VU-F93 (LC-F83 в «в»-конформации) и VU-F83A, полученный за последние 75 нс из 100 нс имитации молекулярной динамики. Все образцы значительно отличались (p <0,001), за исключением BA-F83 и BA-F83A, как определено анализом дисперсии (ANOVA)/прямым тестом Тьюки достоверного различия (HSD).

На Фиг. 9В изображен график, показывающий кручение VH/VL для пяти молекул G6не связанный с LC-F83 в «наружу» конформации (черный) и пяти молекул с G6не связанный с LC-F83 в «в» конформации (темно-серый) как угол кручения VH/VL VEGF-связанных G6 структур («AG связь», светло-серый).

На Фиг. 9C изображен график, показывающий распределение углов кручения VH/VL тех же молекул, что и на Фиг. 9A, во время той же 100 нс имитации молекулярной динамики. Все образцы существенно отличались (p <0,001), за исключением BA-F83A и VU-F83A, как определено дисперсионным анализом ANOVA/тестом Тьюки HSD.

На Фиг. 9D изображена визуализация кристаллической структуры несвязанного G6, показывающая области, имеющие различные схемы обмена водород-дейтерия между G6.31 и G6.31LC-F83A. Участки, окрашенные темно-серым, имели более медленный обмен в G6.31LC-F83A по сравнению с G6.31, тогда как участки, окрашенные серым, имели более быстрый обмен в G6.31LC-F83A по сравнению с G6.31. Позиции мутации F83A и петли DE обозначены линиями.

На Фиг. 10А изображен график, показывающий распределение соматических мутаций для указанных положений VL последовательностей антител, происходящих из зародышевых линий IGKV1. Мутационное распределение на верхней вставке было получено с использованием общедоступных последовательностей человеческих антител из Genbank, базы данных протеинов (PDB), базы данных Кабат, базы данных Абсис и базы данных IMGT («Public dataset»). Мутационное распределение на нижней вставке было получено с использованием секвенирования одной молекулы кДНК в реальном времени (SMRT), полученной из более чем 1000 отдельных лимфоидных тканей человека. Высокие скорости мутаций на N-конце общедоступных последовательностей, вероятно, происходят из-за клонирования артефактов.

На Фиг. 10B изображен график, показывающий наиболее распространенные мутации в положении LC-83 для последовательностей IGKV1.39 из Общего набора данных, описанного на Фиг. 10A и Примера 8 (Sanger) или набора данных SMRT (PacBio). IGKV1.39 несет фенилаланин в положении LC-83. Точки окрашиваются в соответствии с размером аминокислоты. Крупные аминокислоты окрашены в желтый цвет, а маленькие аминокислоты окрашены в темно-красный цвет.

На Фиг. 10C изображен график, показывающий наиболее распространенные мутации в позиции LC-106 для всех последовательностей IGKJ, обнаруженных в Общем наборе данных (Sanger) или в наборе данных SMRT (PacBio). Точки затенены в соответствии с размером аминокислоты. Крупные аминокислоты окрашены в светло-серый цвет, а маленькие аминокислоты окрашены в темно-серый цвет.

На Фиг. 10D изображена серия графиков, показывающих сродство (Kd) выбранных вариантов мутантов G6.31, как измерено с помощью поверхностного плазмонного резонанса BIACORE® (левая вставка) и температуры плавления Tm для выбранных вариантов мутантов G6.31, как определено дифференциальной сканирующей флюориметрией (DSF) (правая вставка). Круги на левой вставке представляют среднее из трех повторов с соответствующим стандартным отклонением, показанным полосками ошибок. Круги на правой вставке представляют среднее из трех повторов и соответствующее стандартное отклонение, показанное полосками ошибок.

На Фиг. 11А изображен график, показывающий фармакокинетику жидкости и стекловидного тела для каждого из G6.31 AAEE, G6.31 ДТ и G6.31 AARR после интравитреального введения (IVT) соответствующего Fab в глаза кролика, как описано в примере 11.

На Фиг. 11В изображен график, показывающий коэффициент распада в сыворотке каждого из G6.31 AAEE, G6.31 ДТ и G6.31 AARR после интравитреального введения соответствующего Fab в глаза кролика, как описано в примере 11.

На Фиг. 12 изображена таблица, показывающая анализ фрагментации капиллярным электрофорезом - додецилсульфатом натрия (CE-SDS) для указанных клонов антител. Фрагментация представляет собой процент низкомолекулярных объектов (% НМВ) через 4 недели, 12 недель и 24 недели при 37°C в PBS. Фрагментация последовательно снижается во всех вариантах N94A по сравнению с G6.31 дикого типа. Объекты с высокой молекулярной массой (% ВМВ) указывают на примеси или агрегаты. Основной размер пика в этом анализе напрямую не коррелирует со степенью фрагментации, но зависит от размера и объема фрагмента красителя. Анти-VEGF Fab ранибизумаба служил в качестве контроля.

На Фиг. 13 изображен график, показывающий график ингибирования миграции HUVEC, индуцированной VEGF, вариантом G6.31 LC-N94A по сравнению с исходным G6.31 при различных концентрациях Fab, как описано в примере 12.

На Фиг. 14 изображен график, показывающий гель-фильтрационную хроматографию (SEC) и анализ многоуглового рассеяния света с коэффициентом преломления (RI) (MALS) (SEC-RI-MALS) для HA40K-rabFab, HA200K-rabFab и HA600K-rabFab с перекрытием средневесовой молярной массы (Mв).

На Фиг. 15 изображен график, показывающий, что гиалуроновая кислота (НА), конъюгированная с rabFab, сохраняет ферментативную восприимчивость к перевариванию гиалуронидазой-2 (HYAL2), как оценивается анализом SEC-MALS с HYAL-2-инкубированной HA и HA100K-rabFab. Для образцов HA-rabFab правая ось Mв выражается как Mв компонента HA только конъюгата.

На Фиг. 16 изображен график, показывающий выведение ранибизумаба, rabFab и HA100K-rabFab («линейный HA-rabFab») из стекловидного тела кролика после интравитреальной инъекции. HA100K-rabFab показал период полувыведения приблизительно 11,9 дней, по сравнению с приблизительно 2,5 днями для rabFab.

На Фиг. 17 изображен график, показывающий, что время витреального пребывания линейно коррелирует с гидродинамическим радиусом (Rh, обозначенным как «RH» на графике) в стекловидном теле кролика. Для предсказания периодов полураспада для HA100K-G6.31 AARR (неокрашенный круг), HA200K-G6.31 AARR (неокрашенный квадрат) и HA300K-G6.31 (неокрашенный треугольник) можно использовать исторические данные (окрашенные кружки) для rabFab, rabPab-20кДa PEG, rabFab-40кДa ПЭГ и HA100K-rabFab на основе измеренных значений Rh.

Подробное описание СУЩНОСТИ изобретения

I. ОПРЕДЕЛЕНИЯ

Используемый в данном документе термин «около» относится к обычному диапазону ошибок для соответствующего значения, хорошо известного специалисту в данной области техники. Ссылка на «около» значения или параметра в данном документе включает (и описывает) варианты осуществления изобретения, которые направлены на это значение или параметр per se.

«Акцепторный каркас человека» для целей данного документа представляет собой каркас, содержащий аминокислотную последовательность каркаса вариабельного домена легкой цепи (VL) или каркаса вариабельного домена тяжелой цепи (VH), полученных из каркаса иммуноглобулина человека или каркаса консенсуса человека, как определено ниже. Акцепторный каркас человека, "полученный из" каркаса иммуноглобулина человека или консенсусной последовательности каркаса человека, может содержать совпадающую с ними аминокислотную последовательность или может содержать изменения аминокислотной последовательности. В некоторых вариантах осуществления изобретения, количество изменений аминокислоты составляет 10 или менее, 9 или менее, 8 или менее, 7 или менее, 6 или менее, 5 или менее, 4 или менее, 3 или менее или 2 или менее. В некоторых вариантах осуществления изобретения, каркас VL-акцептора человека идентичен в последовательности каркаса VL иммуноглобулина человека или последовательности консенсусного каркаса человека.

«Аффинность» относится к силе суммарного количества нековалентных взаимодействий между одним сайтом связывания молекулы (например, антителом) и ее партнером связывания (например, антигеном). Если не указано иное, как используется в данном документе, «аффинность связывания» относится к аффинности собственного связывания, которая отражает взаимодействие 1:1 между членами пары связывания (например, антителом и антигеном). Аффинность молекулы X для ее партнера Y обычно может быть представлена константой диссоциации (Kd). Аффинность может быть измерена обычными методами, известными в данной области, включая описанные в данном документе. Конкретные иллюстративные и иллюстративные варианты осуществления изобретения для измерения аффинности связывания описаны ниже.

Антитело с «созревшей аффинностью» относится к антителу с одним или более изменениями в одном или более гипервариабельных участках (HVR) и/или каркасных участках (FR) по сравнению с исходным антителом, которое не обладает такими изменениями, причем такие изменения приводят к улучшение сродства антитела к антигену.

Термин «фактор роста эндотелия сосудов» или «VEGF» относится к белку A фактор роста эндотелия сосудов, как показано в SEQ ID NO: 47 (см. также Swiss Prot Accession № P15692, Gene ID (NCBI): 7422). Термин «VEGF» охватывает белок, имеющий аминокислотную последовательность SEQ ID NO: 47, а также его гомологи и изоформы. Термин «VEGF» также соответствует известным изоформам, например изоформам сращивания, VEGF, например VEGF111, VEGF121, VEGF145, VEGF165, VEGF189 и VEGF206, вместе с их природными аллельными и обработанными формами, включая 110-аминокислотный фактора роста эндотелиальных клеток человека, полученный расщеплением плазмином VEGF165, как описано в Ferrara Mol. Biol. Cell. 21:687 (2010), Leung et al., Science, 246:1306 (1989), и Houck et al., Mol. Endocrin., 5:1806 (1991). Термин «VEGF» также относится к VEGF от нечеловеческих видов, таких как мышь, крыса или примат. Иногда VEGF от определенного вида обозначают с помощью таких терминов, как hVEGF для VEGF человека, mVEGF для VEGF мыши и тому подобное. Термин «VEGF» также используется для обозначения усеченных форм полипептида, содержащих аминокислоты от 8 до 109 или от 1 до 109 из 165-аминокислотного фактора роста эндотелиальных клеток человека. Ссылка на любые такие формы VEGF может быть идентифицирована в настоящей заявке, например, с помощью «VEGF109», «VEGF (8-109)», «VEGF (1-109)» или «VEGF165». Положения аминокислот для «усеченного» нативного VEGF нумеруются, как указано в нативной последовательности VEGF. Например, положение аминокислоты 17 (метионин) в усеченной нативной VEGF является также положением 17 (метионин) в нативном VEGF. Усеченный нативный VEGF обладает аффинностью связывания к рецепторам KDR и Flt-1, сравнимым с нативным VEGF. Используемый в данном документе термин «вариант VEGF» относится к полипептиду VEGF, который включает одну или более аминокислотных мутаций в нативной последовательности VEGF. Необязательно, одна или более аминокислотных мутаций включают аминокислотную замену(ы). Для целей сокращенного обозначения вариантов VEGF, описанных в данном документе, отмечается, что числа относятся к положению аминокислотного остатка аминокислотной последовательности предполагаемого нативного VEGF (представлено в Leung et al., supra и Houck et al., выше). Если не указано иное, термин «VEGF», используемый в данном документе, обозначает VEGF-A.

Термины «анти-VEGF антитело», «антитело, которое связывается с VEGF», и «антитело, которое специфически связывается с VEGF», относятся к антителу, которое способно связывать VEGF с достаточной аффинностью, так что антитело полезно в качестве диагностического и/или терапевтического агента при нацеливании на VEGF.В одном варианте осуществления изобретения, степень связывания анти-VEGF антитела с несвязанным не-VEGF белком составляет менее чем около 10 % от связывания антитела с VEGF, как измерено, например, радиоиммуноанализом (RIA). В некоторых вариантах осуществления изобретения, антитело, которое связывается с VEGF, имеет константу диссоциации (Kd) ≤ 1 мкМ, ≤ 100 нМ, ≤ 10 нМ, ≤ 1 нМ, ≤ 0,1 нМ, ≤ 0,01 нМ или ≤ 0,001 нМ (например, 10-8 М или менее, например, от 10-8 М до 10-13 М, например от 10-9 М до 10-13 М). В некоторых вариантах осуществления изобретения, анти-VEGF антитело связывается с эпитопом VEGF, который сохраняется среди VEGF у разных видов.

Термин «антитело» в данном документе используется в самом широком смысле и охватывает различные структуры антител, включая, но не ограничиваясь ими, моноклональные антитела, поликлональные антитела, мультиспецифические антитела (например, биспецифические антитела) и фрагменты антител, при условии, что они обладают желаемой антиген-связывающей активностью.

«Фрагмент антитела» относится к молекуле, отличной от интактного антитела, которая содержит часть интактного антитела, которая связывает антиген с которым связывается интактное антитело. Примеры фрагментов антител включают, но не ограничиваются ими, Fv, Fab, Fab', Fab-C, Fab'-SH, F(ab')2; димеры; линейные антитела; молекулы одноцепочечных антител (например, scFv); и мультиспецифические антитела, образованные из фрагментов антител. В некоторых случаях примеры фрагментов антител включают, но не ограничиваются ими, Fv, Fab, Fab', Fab'-SH, F(ab')2; димеры; линейные антитела; молекулы одноцепочечных антител (например, scFv); и мультиспецифические антитела, образованные из фрагментов антител.

Папаиновое переваривание антител дает два идентичных антигенсвязывающих фрагмента, называемых фрагментами «Fab», и остаточный фрагмент «Fc», обозначение, отражающее способность легко кристаллизоваться. Фрагмент Fab состоит из целой легкой (L) цепи вместе с доменом вариабельного участка тяжелой (H) цепи (VH) и первого константного домена одной тяжелой цепи (CH1). Обработка антитела пепсином дает один большой фрагмент F(ab')2, который приблизительно соответствует двум связанным с дисульфидом Fab-фрагментам, имеющим двухвалентную антигенсвязывающую активность и по-прежнему способным к сшиванию антигена. Fab’ фрагменты отличаются от Fab-фрагментов наличием нескольких дополнительных остатков на карбоксильном конце домена CH1, включая один или более цистеинов из участка шарнира антитела. Fab-C молекулы представляют собой Fab молекулы, которые экспрессируются таким образом, что последовательность усекается на первом цистеине шарнира, давая Fab со свободным цистеином непосредственно после экспрессии (см., например, Shatz et al., Mol. Pharmaceutics 2016; PubMed identifier (PMID) 27244474). Например, молекула Fab-C может иметь свободный цистеин в положении Cys227 тяжелой цепи. В других случаях молекула Fab-C может иметь свободный цистеин в положении Cys229 тяжелой цепи. Fab'-SH является обозначением в данном документе для Fab', в котором остаток(и) цистеина константных доменов несут свободную тиольную группу. Фрагменты F(ab')2 антитела первоначально были получены в виде пар Fab'-фрагментов, которые имеют цистеины шарнира между ними. Известны также другие химические соединения фрагментов антител.

Используемый в данном документе термин «Fc-участок» используется для определения С-концевого участка тяжелой цепи иммуноглобулина, которая содержит по меньшей мере часть константного участка. Термин включает в себя природные последовательности Fc-участков и варианта Fc-участков. В одном варианте осуществления изобретения, Fc-участок тяжелой цепи IgG человека простирается от Cys226 или от Pro230 до карбоксильных концов тяжелой цепи. Однако С-концевой лизин (Lys447) Fc-участка может присутствовать или отсутствовать. Если не указано иное, нумерация аминокислотных остатков в Fc-участке или константном участке соответствует системе нумерации ЕС, также называемой индексом ЕС, как описано в Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991).

«Fv» состоит из димера одного домена вариабельного участка тяжелой и одной легкой цепи в плотной, нековалентной ассоциации. Из сворачивания этих двух доменов происходят шесть гипервариабельных петель (по 3 петли из каждой H и L-цепи), которые вносят аминокислотные остатки для связывания антигена и придают антигенсвязывающую специфичность антителу. Однако даже один вариабельный домен (или половина Fv, содержащая только три HVR, специфичных для антигена), обладает способностью распознавать и связывать антиген, хотя часто с более низким сродством, чем весь сайт связывания.

«Одноцепочечный Fv», также сокращаемый как «sFv» или «scFv», является фрагментами антител, которые содержат домены VH и VL-антител, соединенные в одну полипептидную цепь. Предпочтительно, полипептид sFv дополнительно содержит полипептидный линкер между доменами VH и VL, который позволяет sFv формировать желаемую структуру для связывания антигена. Для обзора о sFv см. Pluckthun в The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).

Термин «диатела» относится к небольшим фрагментам антител, полученным путем конструирования sFv-фрагментов (см. предыдущий параграф) с помощью коротких линкеров (около 5-10 остатков) между доменами VH и VL, так что получаются межцепочечно, но не внутрицепочечно спаривающиеся V домены, что приводит к получению двухвалентного фрагмента, то есть фрагмента, имеющего два антигенсвязывающих участка. Биспецифические диатела являются гетеродимерами двух «кроссоверных» sFv-фрагментов, в которых VH и VL-домены двух антител присутствуют в разных полипептидных цепях. Диатела описаны более полно, например, в ЕР 404097; WO 93/11161; и Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).

«Блокирующее» антитело или антитело «антагонист» представляет собой антитело, которое ингибирует или уменьшает биологическую активность связанного с ним антигена. Некоторые блокирующие антитела или антагонистические антитела по существу или полностью ингибируют биологическую активность антигена.

«Антитело, которое связывается с одним и тем же эпитопом» в качестве эталонного антитела относится к антителу, которое блокирует связывание эталонного антитела с его антигеном в конкурентном анализе на 50 % или более, и наоборот, контрольное антитело блокирует связывание антитела с его антигеном в конкурентном анализе на 50 % и более. Иллюстративный конкурентный анализ приведен в настоящем документе.

Термин “химерное” антитело относится к антителу, в котором фрагмент тяжелой и/или легкой цепи происходит из конкретного источника или вида, в то время как остальная часть тяжелой и/или легкой цепи происходит из другого источника или вида.

“Класс” антитела относится к типу константного домена или константной области, содержащейся в его тяжелой цепи. Существует пять основных классов антител: IgA, IgD, IgE, IgG и IgM, и некоторые из них могут быть далее разделены на подклассы (изотипы), например IgG1, IgG2, IgG3, IgG4, IgA1 и IgA2. Константные домены тяжелой цепи, которые соответствуют различным классам иммуноглобулинов, называются α, δ, ε, γ, и μ, соответственно.

«Эффекторные функции» относятся к той биологической активности, которая относится к Fc-участку антитела, которые варьируются в зависимости от изотипа антитела. Примеры эффекторных функций антитела включают: C1q-связывающая и комплемент-зависимая цитотоксичность (CDC); связывание Fc-рецептора; антитело-зависимая клеточно-опосредованная цитотоксичность (ADCC); фагоцитоз; понижающая регуляция рецепторов клеточной поверхности (например, рецептор В-клеток); и активации В-клеток.

«Каркас» или «каркасный участок» или «FR» относится к остаткам вариабельного участка, отличным от остатков гипервариабельного участка (HVR). FR вариабельного участка обычно состоит из четырех доменов FR: FR1, FR2, FR3 и FR4.

Термины «полноразмерное антитело», «интактное антитело» и «целое антитело» используются в данном документе взаимозаменяемо для обозначения антитела, имеющего структуру, по существу аналогичную структуре нативного антитела, или имеющие тяжелые цепи, которые содержат Fc-участок, как определено в данном документе.

«Человеческое антитело» представляет собой антитело человека, которое обладает аминокислотной последовательностью, которая соответствует аминокислотной последовательности антитела, продуцируемого человеком или клеткой человека, или полученной из нечеловеческого источника, который использует репертуары антител человека или другие человеческие кодирующие антитела последовательности. Это определение человеческого антитела конкретно исключает гуманизированное антитело, содержащее нечеловеческие антиген-связывающие остатки.

«Каркас консенсуса человека» представляет собой структуру, которая представляет собой наиболее часто встречающиеся аминокислотные остатки в выборке последовательностей каркаса VL или VH человеческого иммуноглобулина. Как правило, выбор последовательности VL или VH человеческого иммуноглобулина происходит из подгруппы последовательностей вариабельных доменов. Как правило, подгруппа последовательностей является подгруппой, как в Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vol. 1-3. В одном варианте осуществления изобретения, для VL подгруппа является подгруппой каппа I, как в Kabat et al., см. выше. В одном варианте осуществления изобретения, для VH подгруппа является подгруппой III, как в Kabat et al., см. выше.

«Гуманизированные» формы нечеловеческих (например, грызунов) антител представляют собой химерные антитела, которые содержат минимальную последовательность, полученную из нечеловеческого антитела. По большей части гуманизированными антителами являются человеческие иммуноглобулины (антитело-реципиент), в которых остатки из гипервариабельного участка реципиента заменяются остатками из гипервариабельного участка нечеловеческих видов (донорные антитела), таких как мыши, крыса, кролик или нечеловеческий примат, имеющих желаемую специфичность антител, аффинность и способность. В некоторых случаях остатки FR человеческого иммуноглобулина заменяются соответствующими нечеловеческими остатками. Кроме того, гуманизированные антитела могут содержать остатки, которые не обнаружены в антителе-реципиенте или в донорском антителе. Эти модификации сделаны для дальнейшего улучшения характеристик антител. В общем, гуманизированное антитело будет содержать по существу все из по меньшей мере одного и, как правило, двух вариабельных домена, в которых все или практически все гипервариабельные петли соответствуют нечеловеческому иммуноглобулину, и все или практически все FR являются теми последовательностями человеческого иммуноглобулина. Гуманизированное антитело необязательно также будет содержать по меньшей мере часть константного участка (Fc) иммуноглобулина, как правило, иммуноглобулина человека. Более подробно см. Jones et al., Nature 321: 522-525 (1986); Riechmann et al., Nature 332: 323-329 (1988); и Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).

Термин «вариабельный» относится к тому факту, что некоторые сегменты вариабельных доменов сильно различаются по последовательностям среди антител. Вариабельный или «V» домен опосредует связывание антигена и определяет специфичность конкретного антитела для его конкретного антигена. Однако вариабельность распределяется неравномерно по всему диапазону вариабельных доменов. Вместо этого V-участки состоят из относительно инвариантных отрезков, называемых каркасными участками (FR) из 15-30 аминокислот, разделенных более короткими участками экстремальной вариабельности под названием «гипервариабельные участки», каждая длиной 9-12 аминокислот. Термин «гипервариабельный участок» или «HVR» при использовании в данном документе относится к аминокислотным остаткам антитела, которые ответственны за антиген-связывание. Гипервариабельный участок обычно содержит аминокислотные остатки, например, примерно около остатков 24-34 (L1), 50-56 (L2) и 89-97 (L3) в VL, и примерно около остатков 26-35 (H1), 49-65 (H2) и 95-102 (H3) в VH (в одном варианте осуществления изобретения, H1 примерно около остатков 31-35); Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)), и/или эти остатки из «гипервариабельной петли» (например, остатки 26-32 (L1), 50-52 (L2) и 91-96 (L3) в VL и 26-32 (H1), 53-55 (H2) и 96-101 (H3) в VH; Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987). Вариабельные домены нативных тяжелых и легких цепей каждый содержит четыре FR, в основном применяя конфигурацию бета-листа, связанную тремя гипервариабельными участками, которые образуют петли, соединяющие и в некоторых случаях составляющие часть структуры бета-листа. Гипервариабельные участки в каждой цепи удерживаются вместе в непосредственной близости от FR и, с гипервариабельными участками из другой цепи способствуют образованию антиген-связывающего сайта антител (см. Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Соответственно, последовательности HVR и FR обычно появляются в следующей последовательности в VH (или VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4. Константные домены непосредственно не связаны со связыванием антитела с антигеном, но проявляют различные эффекторные функции, такие как участие антитела в зависимой от антитела клеточной цитотоксичности (ADCC).

Термин «нумерация остатков вариабельного домена, как в Кабат» или «нумерация аминокислотного положения, как в Кабате», и их вариации относится к системе нумерации, используемой для вариабельных доменов тяжелой цепи или вариабельных доменов легкой цепи для компиляции антител в Kabat et al., см. выше. Используя эту систему нумерации, фактическая линейная аминокислотная последовательность может содержать меньше или дополнительные аминокислоты, соответствующие сокращению или вставке в FR или HVR вариабельного домена. Например, вариабельный домен тяжелой цепи может включать одну аминокислотную вставку (остаток 52а по Кабат) после остатка 52 из Н2 и вставленные остатки (например, остатки 82а, 82b и 82с и т. д. согласно Кабат) после остатка 82 тяжелой цепи FR. Нумерация остатков по Кабат может быть определена для данного антитела путем выравнивания в участках гомологии последовательности антитела со «стандартной» нумерацией последовательности по Кабат.

Система нумерации Кабат обычно используется при обращении к остатку в вариабельном участке (приблизительно остатки 1-107 легкой цепи и остатки 1-113 тяжелой цепи) (например, Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). «Система нумерации ЕС» или «индекс ЕС» обычно используется при обращении к остатку в константном участке тяжелой цепи иммуноглобулина (например, индекс ЕС, указанный в Kabat et al., выше). «Индекс ЕС как в Кабате» относится к нумерации остатков человеческого IgG1-антитела ЕС. Если не указано иное в данном документе, ссылки на номера остатков в вариабельном домене антител означают нумерацию остатка по системе нумерации Кабата. Если не указано иное в данном документе, ссылки на номера остатков в константном домене антител означают нумерацию остатка по системе нумерации ЕС (например, см. предварительную заявку Соединенных Штатов № 60/640323, фигуры для нумерации ЕС).

Если не указано иное, остатки HVR и другие остатки в вариабельном домене (например, остатки FR) пронумерованы в данном документе в соответствии с Kabat et al., см. выше.

«Иммуноконъюгат» представляет собой антитело, конъюгированное с одной или более гетерологичными молекулами(ой), включая, но не ограничиваясь ими, цитотоксический агент.

Термин «изолированное антитело» при использовании для описания различных антител, описанных в данном документе, означает антитело, которое было идентифицировано и выделено и/или выделено из клетки или клеточной культуры, из которой она была экспрессирована. Загрязняющими компонентами его природной среды являются материалы, которые обычно препятствуют диагностическому или терапевтическому применению полипептида и могут включать ферменты, гормоны и другие белковые или небелковые растворенные вещества. В некоторых вариантах осуществления изобретения, антитело очищают до более чем 95 % или 99 % чистоты, как определено, например, электрофоретически (например, SDS-PAGE, изоэлектрическая фокусировка (IEF), капиллярный электрофорез) или хроматографически (например, ионный обмен или ВЭЖХ с обращенной фазой). Для обзора методов оценки чистоты антител см., например, Flatman et al., J. Chromatogr. B 848:79-87 (2007). В предпочтительных вариантах осуществления изобретения, антитело будет очищено (1) до степени, достаточной для получения по меньшей мере 15 остатков N-концевой или внутренней аминокислотной последовательности с использованием секвенатора с вращающимся стаканом или (2) до гомогенности с помощью SDS-PAGE в невосстанавливающих или восстановливающих условиях, используя окраску Кумасси синим или, предпочтительно, серебром. Изолированное антитело включает антитела in situ в рекомбинантных клетках, поскольку по меньшей мере один компонент полипептидной природной среды не будет присутствовать. Однако обычно изолированный полипептид получают с помощью по меньшей мере одной стадии очистки.

Используемый в данном документе термин «моноклональное антитело» относится к антителу, полученному из популяции по существу гомогенных антител, то есть отдельные антитела, содержащиеся в популяции, идентичны и/или связывают один и тот же эпитоп, за исключением возможных вариантов антител, например, содержащих природные возникающие мутации или возникающие при получении препарата моноклонального антитела, причем такие варианты обычно присутствуют в незначительных количествах. В отличие от препаратов поликлонального антитела, которые обычно включают различные антитела, направленные против различных детерминант (эпитопов), каждое моноклональное антитело препарата моноклонального антитела направлено против одного детерминанта на антигене. Таким образом, модификатор "моноклональное" указывает на то, что антитело получают из практически однородной популяции антител; его не следует интерпретировать как требование относительно продукции антитела с помощью какого-либо конкретного способа. Например, моноклональные антитела, которые будут использоваться в соответствии с настоящим изобретением, могут быть получены различными способами, включая, но не ограничиваясь ими, гибридомный способ, способы рекомбинантной ДНК, способы фагового дисплея и способы, использующие трансгенных животных, содержащих все или часть локусов иммуноглобулина человека, такие способы и другие иллюстративные способы получения моноклональных антител, описанных в данном документе.

Термин «мультиспецифическое антитело» используется в самом широком смысле и конкретно охватывает антитело, содержащее вариабельный домен тяжелой цепи (VH) и вариабельный домен легкой цепи (VL), где единица VH-VL обладает полиэпитопической специфичностью (то есть способна связываться с двумя различными эпитопами на одной биологической молекуле или на каждом эпитопе на другой биологической молекуле). Такие мультиспецифические антитела включают, но не ограничиваются ими, полноразмерные антитела, антитела, имеющие два или более домена VL и VH, фрагменты антител, такие как Fab, Fab'. FAB-С. Fv, dsFv, scFv, диатела, биспецифические диатела и триатела, фрагменты антител, которые были связаны ковалентно или нековалентно. «Полиэпитопическая специфичность» относится к способности специфически связываться с двумя или более различными эпитопами на одной и той же или другой цели(ях). «Двойственная специфичность» или «биспецифичность» относится к способности специфически связываться с двумя различными эпитопами на одной и той же или другой цели(ях). Однако, в отличие от биспецифических антител, двойные специфические антитела имеют два антиген-связывающих плеча, которые идентичны в аминокислотной последовательности, и каждое Fab-плечо способно распознавать два антигена. Двойная специфичность позволяет антителам взаимодействовать с высокой аффинностью с двумя различными антигенами, как с одним Fab или молекулой IgG. Согласно одному варианту осуществления изобретения, мультиспецифическое антитело в форме IgG1 связывается с каждым эпитопом с аффинностью от 5 мкМ до 0,001 пМ, от 3 мкМ до 0,001 пМ, от 1 мкМ до 0,001 пМ, от 0,5 мкМ до 0,001 пМ или от 0,1 мкМ до 0,001 пМ. «Моноспецифичность» относится к способности связывать только один эпитоп.

«Нативные антитела» относятся к естественным молекулам иммуноглобулина с различными структурами. Например, нативные IgG-антитела обычно представляют собой гетеротетрамерные гликопротеины с молекулярной массой около 150000 дальтон, состоящие из двух идентичных легких цепей и двух идентичных тяжелых цепей, связанных дисульфидными связями. Каждая тяжелая цепь от N-конца к C-концу содержит вариабельный участок(VH), также называемый тяжелым вариабельным доменом или вариабельным доменом тяжелой цепи, а затем три константных домена (CH1, CH2 и CH3). Аналогично, каждая легкая цепь от N-конца к C-концу содержит вариабельный участок (VL), также называемый легким вариабельным доменом или вариабельным доменом легкой цепи, а затем константный легкий домен (CL). Легкая цепь антитела может быть назначена одному из двух типов, называемому каппа (κ) и лямбда (λ), на основе аминокислотной последовательности его константного домена.

Что касается связывания антитела с молекулой-мишенью, термин «специфическое связывание» или «специфически связывается с» или «специфичен для» конкретного полипептида или эпитопа на конкретной полипептидной мишени означает связывание, которое заметно отличается от неспецифического взаимодействия. Специфическое связывание может быть измерено, например, путем определения связывания молекулы по сравнению со связыванием контрольной молекулы. Например, специфическое связывание может быть определено путем конкуренции с контрольной молекулой, которая похожа на мишень, например, избыток немеченой мишени. В этом случае специфическое связывание указывается, если связывание меченой мишени с зондом конкурентно ингибируется избыточной немеченой мишенью. Термин «специфическое связывание» или «специфически связывается с» или «специфичен для» конкретного полипептида или эпитопа на конкретной полипептидной мишени, как используется в данном документе, может быть представлен, например, с помощью молекулы, имеющей Kd для мишени 10-4 М или ниже, альтернативно 10-5 М или ниже, альтернативно 10-6 М или ниже, альтернативно 10-7 М или ниже, альтернативно 10-8 М или ниже, альтернативно 10-9 М или ниже, альтернативно 10-10 М или ниже, альтернативно 10-11 М или ниже, альтернативно 10-12 М или ниже или Kd в диапазоне от 10-4 М до 10-6 М или от 10-6 М до 10-10 М или 10-7 М до 10-9 М. Как будет понятно специалисту в данной области, аффинность и значения Kd обратно пропорциональны. Высокая аффинность к антигену измеряется низким значением Kd. В одном варианте осуществления изобретения, термин «специфическое связывание» относится к связыванию, где молекула связывается с конкретным полипептидом или эпитопом на конкретном полипептиде без существенного связывания с любым другим полипептидным или полипептидным эпитопом.

«Нуклеиновая кислота, кодирующая анти-VEGF антитело», относится к одной или более молекулам нуклеиновой кислоты, кодирующим тяжелые и легкие цепи антитела (или их фрагменты), включая такую молекулу(ы) нуклеиновой кислоты в одном векторе или отдельном векторе, и такую молекулу(ы) нуклеиновой кислоты, присутствующую в одном или более местах в клетке-хозяине.

Используемый в данном документе, термин «вектор» относится к молекуле нуклеиновой кислоты, способной распространять другую нуклеиновую кислоту, с которой она связана. Указанный термин включает вектор, находящийся в виде самореплицирующейся нуклеиновой кислоты, а также вектор, способный внедряться в геном клетки-хозяина, в которую его вводят. Некоторые векторы способны управлять экспрессией нуклеиновых кислот, с которыми они функционально связаны. Такие векторы упоминаются в данном документе как «векторы экспрессии».

Термины «клетка-хозяин», «линия клеток-хозяев» и «культура клеток-хозяев» используются взаимозаменяемо и относятся к клеткам, в которые была введена экзогенная нуклеиновая кислота, включая потомство таких клеток. Клетки-хозяева включают “трансформанты” и “трансформированные клетки”, которые включают первично трансформированные клетки и полученное от них потомство, независимо от количества пассажей. Потомство может не быть полностью идентичным исходной клетке по содержанию нуклеиновых кислот, и может содержать мутации. Мутантные потомства, которые обладают той же функцией или биологической активностью, что и скринированные или выбранные в первоначально трансформированной клетке, включены в данный документ.

«Идентификация аминокислотной последовательности в процентах (%)» относительно эталонной полипептидной последовательности определяется как процент аминокислотных остатков в последовательности-кандидате, которые идентичны аминокислотным остаткам в эталонной полипептидной последовательности после выравнивания последовательностей и введения пробелов, если необходимо, для достижения максимального процента идентичности последовательности , и без учета каких-либо консервативных замен как части идентичности последовательности. Выравнивание для целей определения процента идентичности аминокислотной последовательности может быть достигнуто различными способами, которые входят в компетенцию специалиста в данной области, например, с использованием общедоступного компьютерного программного обеспечения, такого как BLAST, BLAST-2, ALIGN или Megalign (DNASTAR). Специалисты в данной области техники могут определить соответствующие параметры выравнивания последовательностей, включая алгоритмы, необходимые для достижения максимального выравнивания по всей длине сравниваемых последовательностей. В то же время все используемые для целей настоящего документа процентные значения идентичности аминокислотных последовательностей получены с применением компьютерной программы для сравнения последовательностей ALIGN-2. Компьютерная программа для сравнения последовательностей ALIGN-2 разработана компанией Genentech, Inc., а исходный код представлен в документации пользователя в Бюро по охране авторских прав США, Вашингтон, округ Колумбия, 20559, где он зарегистрирован в соответствии с номером регистрации авторского права США TXU510087. Программа ALIGN-2 находится в свободном доступе в Genentech, Inc., Саут-Сан-Франциско, Калифорния, или может быть скомпилирована из исходного кода. Программу ALIGN-2 следует компилировать для применения в операционной системе UNIX, включая цифровую версию UNIX V4. 0D. Все параметры сравнения последовательностей устанавливаются программой ALIGN-2 и остаются неизменными.

В ситуациях, когда ALIGN-2 используется для сравнения аминокислотных последовательностей, % идентичности последовательности аминокислот данной аминокислотной последовательности A с или против данной аминокислотной последовательностью B (которая может альтернативно быть выражена как данная аминокислота последовательность А, которая имеет или содержит определенный % идентичности аминокислотной последовательности с или против данной аминокислотной последовательности В), рассчитывается следующим образом: 100 раз на фракцию Х/Y, где Х - количество аминокислотных остатков, посчитанных как идентичные совпадения с помощью программы выравнивания последовательности ALIGN-2 в этой программе выравнивания A и B, и где Y - общее количество аминокислотных остатков в B. Будет понятно, что если длина аминокислотной последовательности A не равна длине аминокислотной последовательности В, % идентичности аминокислотной последовательности А к В не будет соответствовать % идентичности аминокислотной последовательности В с А. Если не указано иное, все значения % идентичности аминокислотной последовательности, используемые в данном документе, получают, как описано в непосредственно предшествующем абзаце, используя компьютерную программу ALIGN-2.

Используемый в данном документе термин «введение» означает способ введения дозы соединения (например, анти-VEGF антитела по изобретению, конъюгата антитела по изобретению, слитого белка по изобретению, полимерной композиции по изобретению, или нуклеиновой кислоты, кодирующей анти-VEGF антитело по изобретению) или композиции (например, фармацевтическую композицию, например фармацевтическую композицию, включающую анти-VEGF антитело по изобретению, конъюгат антитела по изобретению, слитый белок по изобретению или полимерную композицию по изобретению) субъекту. Композиции, используемые в описанных в данном документе способах, могут быть введены, например, интравитреально (например, путем интравитеральной инъекции), глазными каплями, внутримышечно, внутривенно, интрадермально, чрескожно, внутриартериально, внутрибрюшинно, внутриочагово, внутричерепно, внутрисуставно, внутрипростатно, внутриплеврально, внутритрахеально, интратекально, интраназально, интравагинально, внутриректально, местно, внутриопухольно, перитонеально, подкожно, субконъюнктивно, интравезикулярно, слизисто, интраперикардиально, внутрипуповинно, внутриглазно, интраорбитально, орально, местно, трансдермально, путем ингаляции, путем инъекции, путем имплантации, путем инфузии, путем непрерывной инфузии, непосредственно локализованными перфузионными ваннами клеток-мишеней, катетером, лаважем, кремами или липидными композициями. Композиции, используемые в описанных в данных документах способах, также могут вводиться системно или локально. Способ введения может варьироваться в зависимости от различных факторов (например, вводимого соединения или композиции и тяжести состояния, заболевания или расстройства, подвергаемого лечению).

«Ангиогенез» относится к процессу, посредством которого новые кровеносные сосуды формируются из ранее существовавших кровеносных сосудов. Ангиогенез отличается от васкулогенеза, который является образованием de novo эндотелиальных клеток из предшественников клеток мезодермы. Расстройства, связанные с патологическим ангиогенезом, могут быть подвергнуты лечению композициями и способами по изобретению. Эти расстройства включают как неопластические нарушения, так и клеточные пролиферативные расстройства. Клеточные пролиферативные расстройства включают, но не ограничиваются перечисленными ниже. Не-неопластические расстройства включают, но не ограничиваются ими, окулярные состояния (не ограничивающие окулярные состояния включают, например, ретинопатию, включая пролиферативную диабетическую ретинопатию, хориоидальную неоваскуляризацию (CNV), дегенерацию желтого пятна связанную с возрастом (AMD), диабетическую и другие связанные с ишемией ретинопатии, диабетический макулярный отек (DME), патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, окклюзию вены сетчатки (включая центральные (CRVO) и разветвленные (BRVO) формы), неоваскуляризацию роговицы, неоваскуляризацию сетчатки, ретинопатию недоношенных (ROP), семейную экссудативную витреоретинопатию (FEVR), болезнь Коутса, болезнь Норри, синдром остеопороза и псевдоглиомы (OPPG), субконъюнктивальное кровоизлияние, рубеоз, неоваскулярное заболевание глаз, неоваскулярную глаукома и гипертоническую ретинопатию), аутоиммунные заболевания (например, ревматоидный артрит (РА), псориаз, анкилозирующий спондилит и воспалительное заболевание кишечника (например, болезнь Крона и язвенный колит)), нежелательную или аберрантную гипертрофию, артрит, псориатический артрит, псориатические бляшки, саркоидоз, атеросклероз, атеросклеротические бляшки, артериальный артериосклероз, сосудистый рестеноз, артериовенозные мальформации (AVM), менингиому, гемангиому, ангиофиброму, гиперплазию щитовидной железы (включая болезнь Грейва), трансплантацию роговицы и другой ткани, воспаление легких, острую травму легкого/ОРДС, сепсис, первичную легочную гипертензию, злокачественные выделения из легких, отек головного мозга (например, связанный с острым инсультом/закрытой травмой головы/травмой), синовиальное воспаление, формирование паннуса в РА, оссифицирующий миозит, образование гипертропных костей, остеоартрит (ОА), рефрактерный асцит, поликистозную болезнь яичников, эндометриоз, 3-й интервал флюидных заболеваний (панкреатит, синдром межфасциального пространства, ожоги, заболевание кишечника), хроническую астму, миому матки, преждевременные роды, хроническое воспаление, такое как IBD (болезнь Крона и язвенный колит), воспалительные заболевания почек (включая гломерулонефрит, особенно месангиопролиферативный гломерулонефрит, гемолитический уремический синдром, диабетическая нефропатия и гипертонический нефросклероз), заболевания, возникающие после трансплантации, отторжение аллотрансплантата почек, воспалительные заболевания, нефротический синдром, нежелательный или аберрантный рост массы ткани (не раковой), гемофильные суставы, гипертрофические рубцы, ингибирование роста волос, синдром Ослера-Вебера, ретролентальную фиброплазию пиогенной гранулемы, склеродермию, трахому, сосудистые спайки, синовит, дерматит, преэклампсия, асцит, выпот перикарда (например, связанный с перикардитом) и плевральный выпот. Дополнительные окулярные расстройства описаны ниже.

Другие расстройства, которые могут быть связаны с патологическим ангиогенезом, включают в себя несращение переломов (переломы, которые не заживают), пиогенную гранулому, трахому, гемофилическую артропатию, сосудистые спайки и гипертрофические рубцы, отторжение трансплантата, фиброваскулярную ткань, акне розацеа, синдром приобретенного иммунного дефицита, окклюзию артерии, атопический кератит, бактериальные язвы, болезнь Бехета, каротидную обструктивную болезнь, хроническое воспаление, хроническую отслойку сетчатки, хронический увеит, хронический витрит, изнашивание контактных линз, отторжение трансплантата роговицы, неоваскуляризацию роговичного трансплантата, болезнь Елеса, эпидемический кератоконъюнктивит, грибковые язвы, инфекции Herpes simplex, инфекции Herpes zoster, синдромы гипервязкости, саркому Капоши, лейкемию, дегенерацию липидов, болезнь Лайма, маргинальный кератолиз, язву Морен, инфекции Mycobacteria, отличные от проказы, миопию, ямку диска зрительного нерва, остеоартрит, болезнь Педжета, парспланит, пемфигоид, фликтенулезный конъюктивит, полиартериит, постлазерные осложнения, инфекции простейших, эластическую псевдоксантому, птеригий и синдром сухого глаза, радиальную кератотомию, ретролентальную фиброплазию, саркоидоз, склерит, серповидноклеточную анемию, синдром Шегрена, болезнь Старгарта, болезни Стивена-Джонсона, верхний лимбальный кератоконъюктивит, сифилис, системную волчанку, краевую дегенерацию Терриена, токсоплазмоз, травму, окклюзию вен, дефицит витамина А и саркоидоз Вегенера, нежелательный ангиогенез, связанный с диабетом, паразитарное заболевания, аномальное заживление ран, гипертрофию после операции, повреждение или травму, ингибирование роста волос, ингибирование овуляции и образования желтого тела, ингибирование имплантации и ингибирование развития эмбрионов в матке.

Используемый в данном документе термин «окулярное расстройство» включает любое окулярное расстройство (также упоминаемое в данном документе взаимозаменяемо как «окулярное состояние»), связанное с патологическим ангиогенезом. Окулярное расстройство может характеризоваться измененной или нерегулируемой пролиферацией и/или инвазией новых кровеносных сосудов в структуры глазных тканей, таких как сетчатка или роговица. Неограничивающие окулярные расстройства включают, например, AMD (например, влажная AMD, сухая AMD, промежуточная AMD, прогрессирующая AMD и географическая атрофия (GA)), дегенерацию желтого пятна, отек макулы, DME (например, фокальный, нецентральный DME и диффузный, связанный с центром DME), ретинопатию, диабетическую ретинопатию (DR) (например, пролиферативную DR (PDR), непролиферативную DR (NPDR) и высотную DR), другие связанные с ишемией ретинопатии, ROP, окклюзию вены сетчатки (RVO) (например, центральную (CRVO) и разветвленную (BRVO) формы), CNV (например, миопическую CNV), неоваскуляризацию роговицы, заболевания, связанные с неоваскуляризацией роговицы, неоваскуляризацию сетчатки, заболевания, связанные с ретинальной/хориоидальной неоваскуляризацией, патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, FEVR, болезнь Коутса, болезнь Норри, OPPG, субконъюнктивальное кровоизлияние, рубеоз, неоваскулярное заболевание глаз, неоваскулярную глаукому, пигментный ретинит (RP), гипертоническую ретинопатию, ангиоматозную пролиферацию сетчатки, макулярную телеангиэктазию, неоваскуляризацию зрачка, внутриглазную неоваскуляризацию, дегенерацию сетчатки, цистоидный макулярный отек (CME), васкулит, папилломедому, ретинит, конъюнктивит (например, инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит, амавроз Лебера (также известный как врожденный амавроз Лебера или LCA), увеит (включая инфекционный и неинфекционный увеит), хориоидит (например, многофокальный хориоидит), гистоплазмоз глаза, блефарит, сухость глаз, травматическое повреждение глаз, болезнь Шёгрена и другие офтальмологические заболевания, отличающиеся тем, что заболевание или расстройство связаны с неоваскуляризацией глаз, пропотеванием жидкости через сосуды и/или отеком сетчатки. Дополнительные иллюстративные окулярные расстройства включают заболевания, связанные с рубеозом (неоваскуляризация угла) и заболевания, вызванные аномальной пролиферацией сосудисто-волокнистой или фиброзной ткани, включая все формы пролиферативной витреоретинопатии.

Иллюстративные заболевания, связанные с неоваскуляризацией роговицы, включают в себя, но не ограничиваются ими, эпидемический кератоконъюнктивит, дефицит витамина А, изнашивание контактных линз, атопический кератит, верхний лимбальный кератоконъюктивит, птеригий и синдром сухого глаза, синдром Шегрена, акне розацеа, фликтенулезный конъюнктивит, сифилис, инфекции Mycobacteria, липидную дегенерацию, химические ожоги, бактериальные язвы, грибковые язвы, инфекции Herpes simplex, инфекции Herpes zoster, инфекции простейших, саркома Капоши, язва Морена, маргинальная дегенерация Терриена, маргинальный кератолиз, ревматоидный артрит, системную красную волчанку, полиартериит, травму, саркоидоз Вегенера, склерит, синдрома Стивенса-Джонсона, перифигоидную радиальную кератотомию и отторжения трансплантата роговицы.

Иллюстративные заболевания, связанные с ретинальной/хориоидальной неоваскуляризацией, включают, но не ограничиваются ими, диабетическую ретинопатию, дегенерацию желтого пятна, серповидноклеточную анемию, саркоидоз, сифилис, эластическую псевдоксантому, болезнь Педжета, окклюзию вен, окклюзию артерии, каротидную обструктивную болезнь, хронический увеит/витрит, микобактериальные инфекции, болезнь Лайма, системную красную волчанку, ретинопатию недоношенных, пигментную дистрофию сетчатки, отек сетчатки (включая отек макулы), болезнь Елеса, болезнь Бехчета, инфекции, вызывающие ретинит или хориоидит (например, мультифокальные сосудистые нарушения), синдром предполагаемого гистоплазмоза глаз, болезнь Беста (вителловидная дегенерация желтого пятна), близорукость, ямки диска зрительного нерва, болезнь Старгарта, парспланитит, отслойку сетчатки (например, хроническую отслойку сетчатки), синдромы гипервязкости, токсоплазмоз, травму и осложнения после лазера.

«Расстройства, связанные с нежелательной сосудистой проницаемостью», как используется в данном документе, включают, например, отек, связанный с опухолями головного мозга, асцит, связанный со злокачественными новообразованиями, синдром Мейгса, воспаление легких, нефротический синдром, перикардиальный выпот, плевральный выпот, проницаемость, связанную с сердечно-сосудистыми заболеваниями, такими как состояние после инфарктов миокарда и инсультов и тому подобное.

Следует понимать, что описанные выше классификации не являются взаимоисключающими, и расстройство может подпадать под несколько категорий.

Термины «клеточное пролиферативное расстройство» и «пролиферативное расстройство» относятся к расстройствам, которые связаны с некоторой степенью аномальной клеточной пролиферации. В одном варианте осуществления изобретения, клеточное пролиферативное расстройство представляет собой рак.

Термины «рак», «раковый», «клеточное пролиферативное расстройство», «пролиферативное расстройство» и «опухоль» не являются взаимоисключающими, как указано в данном документе.

«Опухоль», как используется в данном документе, относится ко всему росту и распространению опухолевых клеток, будь то злокачественные или доброкачественные, и все предраковые и раковые клетки и ткани.

«Ангиогенным фактором или агентом» является фактор роста, который стимулирует развитие кровеносных сосудов, например, способствует ангиогенезу, росту эндотелиальных клеток, стабилизации кровеносных сосудов и/или васкулогенезу и т.д. Например, ангиогенные факторы включают, но не ограничиваются ими, например, VEGF и членов семейства VEGF, PlGF, семейство PDGF, семейство факторов роста фибробластов (FGF), лиганды TIE (ангиопоэтин), эфрин, Del-1, фибробласты факторов роста: кислый (aFGF) и основной (bFGF), фоллистатин, гранулоцитарный колониестимулирующий фактор (G-CSF), фактор роста гепатоцитов (HGF)/фактор рассеяния (SF), интерлейкин-8 (IL-8), лептин, мидкин, плацентарный фактор роста, фактор роста эндотелиальных клеток, полученный из тромбоцитов (PD-ECGF), фактор роста, полученный из тромбоцитов, особенно PDGF-BB или PDGFR-бета, плейотрофин (PTN), програнулин, пролиферин, трансформирующий фактор роста-альфа (TGF-альфа), трансформирующий фактор роста-бета (TGF-бета), фактор некроза опухоли-альфа (TNF-альфа), фактор роста эндотелия сосудов (VEGF)/фактор сосудистой проницаемости (VPF) и т. д. Они также включают факторы, которые ускоряют заживление ран, такие как гормон роста, инсулиноподобный фактор роста-I (IGF-I), VIGF, эпидермальный фактор роста (EGF), CTGF и члены его семейства, а также TGF-альфа и TGF-бета. См., например, Klagsbrun and D’Amore, Annu. Rev. Physiol., 53:217-39 (1991); Streit and Detmar, Oncogene, 22:3172-3179 (2003); Ferrara & Alitalo, Nature Medicine 5(12):1359-1364 (1999); Tonini et al., Oncogene, 22:6549-6556 (2003) (например, в таблице 1 перечислены известные ангиогенные факторы); и Sato, Int. J. Clin. Oncol., 8:200-206 (2003).

«Агент против ангиогенеза» или «ингибитор ангиогенеза» относится к веществу с небольшим молекулярным весом, полинуклеотиду, полипептиду, изолированному белку, рекомбинантному белку, антителу или конъюгатам или его слитым белкам, который ингибирует ангиогенез, васкулогенез, или нежелательную сосудистую проницаемость, прямо или косвенно. Следует понимать, что агент против ангиогенеза включает те агенты, которые связывают и блокируют ангиогенную активность ангиогенного фактора или его рецептора. Например, агент против ангиогенеза представляет собой антитело или другой антагонист к ангиогенному агенту, как определено выше, например антагонисты VEGF (например, антитела к VEGF-A или к рецептору VEGF-A (например, KDR-рецептору или Flt-1 рецептору)), антагонисты PDGF (например, анти-PDGFR ингибиторы, такие как GLEEVEC ™ (иматиниба мезилат)). Агенты против ангиогенеза также включают нативные ингибиторы ангиогенеза, например ангиостатин, эндостатин и т. д. См., например, Klagsbrun and D’Amore, Annu. Rev. Physiol., 53:217-39 (1991); Streit and Detmar, Oncogene, 22:3172-3179 (2003) (e.g., Table 3 listing anti-angiogenic therapy in malignant melanoma); Ferrara & Alitalo, Nature Medicine 5(12):1359-1364 (1999); Tonini et al., Oncogene, 22:6549-6556 (2003) (например, в таблице 2 перечислены известные антиангиогенные факторы); и Sato Int. J. Clin. Oncol., 8: 200-206 (2003) (например, в таблице 1 перечислены антиангиогенные агенты, используемые в клинических испытаниях).

Используемый в данном документе термин «антагонист VEGF» относится к молекуле, способной связываться с VEGF, уменьшая уровни экспрессии VEGF или нейтрализуя, блокируя, ингибируя, аннулируя, уменьшая или препятствуя биологической активности VEGF, включая, но не ограничиваясь ими, VEGF-связывание с одним или более рецепторами VEGF, VEGF сигналинг и опосредованный VEGF ангиогенез и выживание или пролиферацию эндотелиальных клеток. Например, молекула, способная нейтрализовать, блокировать, ингибировать, аннулировать, восстанавливать или препятствовать биологической активности VEGF, может оказывать свое действие путем связывания с одним или более рецепторами VEGF (VEGFR) (например, VEGFR1, VEGFR2, VEGFR3, связанным с мембраной VEGF рецептора (mbVEGFR) или растворимого рецептора VEGF (sVEGFR)). В качестве антагонистов VEGF, полезных в способах по изобретению, выступают полипептиды, которые специфически связываются с VEGF, антитела против VEGF и их антигенсвязывающие фрагменты, молекулы рецептора и производные, которые специфически связываются с VEGF, таким образом предотвращая его связывание с одним или более рецепторами, слитые белки (например, VEGF-Trap (регенерон)) и VEGF121-гелонин (перегрин). Антагонисты VEGF также включают варианты антагонистов полипептидов VEGF, олигомеры антисмысловых нуклеотидных групп, комплементарные по меньшей мере фрагменту молекулы нуклеиновой кислоты, кодирующей полипептид VEGF; малые РНК, комплементарные по меньшей мере фрагменту молекулы нуклеиновой кислоты, кодирующей полипептид VEGF; рибозимы, которые нацелены на VEGF; пептидные антитела к VEGF; и VEGF-аптамеры. Антагонисты VEGF также включают полипептиды, которые связываются с VEGFR, антителами против VEGFR и их антигенсвязывающими фрагментами, и производными, которые связываются с VEGFR, тем самым блокируя, ингибируя, аннулируя, уменьшая или препятствуя биологической активности VEGF (например, VEGF сигналингу) или слиянию белков. Антагонисты VEGF также включают непептидные малые молекулы, которые связываются с VEGF или VEGFR и способны блокировать, ингибировать, аннулировать, уменьшать или мешать биологической активности VEGF. Таким образом, термин «активность VEGF» конкретно включает в себя VEGF-опосредованную биологическую активность VEGF. В некоторых вариантах осуществления изобретения, антагонист VEGF снижает или ингибирует на по меньшей мере 10 %, 20 %, 30 %, 40 %, 50 %, 60 %, 70 %, 80 %, 90 % или более, уровень экспрессии или биологическую активность VEGF. В некоторых вариантах осуществления изобретения, VEGF, ингибированный специфическим VEGF антагонистом, представляет собой VEGF (8-109), VEGF (1-109) или VEGF165.

Используемые в данном документе антагонисты VEGF могут включать, но не ограничиваются ими, антитела против VEGFR2 и связанные с ними молекулы (например, рамуцирумаб, танибирумаб, афлиберцепт), антитела против VEGFR1 и связанные с ними молекулы (например, икрукумаб, афлиберцепт (VEGF Trap-Eye; EYLEA®) и зив-афлиберцепт (VEGF Trap; ZALTRAP®)), биспецифические антитела VEGF (например, MP-0250, вануцизумаб (VEGF-ANG2) и биспецифические антитела, описанные в US 2001/0236388), биспецифические антитела, включая комбинации двух анти-VEGF, анти-VEGFR1 и анти-VEGFR2 плечи, антитела против VEGF (например, бевацизумаб, севацизумаб и ранибизумаб) и антагонисты VEGF с непептидной малой молекулой (например, пазопаниб, акситиниб, вандетаниб, стиварга, кабозантиниб, ленватиниб, нинтеданиб, орантиниб, телатиниб, довитиниг, цедираниб, мотесаниб, сульфатиниб, апатиниб, форетиниб, фамитиниб и тивозаниб). Дополнительные антагонисты VEGF описаны ниже.

«Эффективное количество» агента, например, фармацевтической композиции, относится к количеству, эффективному в дозировках и в течение периодов времени, необходимых для достижения желаемого терапевтического или профилактического результата.

«Индивидуум» или «субъект» представляет собой млекопитающие. Млекопитающие включают, но не ограничиваются ими, домашних животных (например, коров, овец, кошек, собак и лошадей), приматов (например, людей и нечеловеческих приматов, таких как обезьяны), кроликов и грызунов (например, мышей и крыс). В некоторых вариантах осуществления изобретения, индивидуум или субъект представляют собой человека. «Субъект» может быть «пациентом».

Термины «рак» и «раковые» относятся к физиологическому состоянию у млекопитающих или описывают их физиологическое состояние, которое обычно характеризуется нерегулируемым ростом клеток. Примеры рака включают, но не ограничиваются ими, карциному, лимфому, бластому, саркому и лейкемию. Более конкретные примеры таких раков включают плоскоклеточный рак, мелкоклеточный рак легкого, немелкоклеточный рак легкого, рак желудочно-кишечного тракта, рак поджелудочной железы, глиобластому, рак шейки матки, рак яичников, рак печени, рак мочевого пузыря, гепатому, рак молочной железы, рак толстой кишки, колоректальный рак, рак эндометрия, рак слюнных желез, рак почек, рак почки, рак предстательной железы, рак вульвы, рак щитовидной железы, гепатокарциному и различные типы рака головы и шеи. «Млекопитающее» для целей лечения относится к любому животному, классифицированному как млекопитающее, включая людей, домашних и сельскохозяйственных животных, нечеловеческих приматов и животных зоопарков, спортивных или домашних животных, таких как собаки, лошади, кошки, коровы и т.д.

«Расстройство» - это любое состояние, которое может быть улучшено при лечении антителом. Например, млекопитающие, которые страдают или нуждаются в профилактике от аномального ангиогенеза (чрезмерный, неадекватный или неконтролируемый ангиогенез) или сосудистой проницаемости. Это включает хронические и острые расстройства или заболевания, включая те патологические состояния, которые предрасполагают млекопитающих к рассматриваемому расстройству. Неограничивающие примеры расстройств, подлежащих лечению, включают в себя расстройства, связанные с патологическим ангиогенезом (например, окулярные расстройства и клеточные пролиферативные расстройства) и расстройства, связанные с нежелательной проницаемостью сосудов.

Термин «противонеопластическая композиция» относится к композиции, пригодной для лечения рака, содержащей по меньшей мере один активный терапевтический агент, например «противораковый агент». Примеры терапевтических агентов (противораковых агентов) включают, но ограничиваются ими, например, химиотерапевтические агенты, агенты ингибитора роста, цитотоксические агенты, агенты, используемые в лучевой терапии, агенты против ангиогенеза, апоптозные агенты, противотуберкулиновые агенты и другие агенты для лечения рака, такие как антитела против HER-2, анти-CD20-антитела, антагонист рецептора эпидермального фактора роста (EGFR) (например, ингибитор тирозинкиназы), ингибитор HER1/EGFR (например, эрлотиниб (TARCEVA™), ингибиторы фактора роста полученные из тромбоцитов (например, GLEEVEC™ (иматиниб мезилат)), ингибитор ЦОГ-2 (например, целекоксиб), интерфероны, цитокины, антагонисты (например, нейтрализующие антитела), которые связываются с одной или более из следующих целей ErbB2, ErbB3, ErbB4, PDGFR-бета, BlyS, APRIL, BCMA или VEGF, TRAIL/Apo2 и другие биологически активные и органические химические вещества и тому подобное. Их комбинации также включены в изобретение.

Используемый в данном документе термин «цитотоксический агент» относится к веществу, которое ингибирует или предотвращает клеточную функцию и/или вызывает гибель или разрушение клеток. Цитотоксические агенты включают, но не ограничиваются ими, радиоактивные изотопы (например, At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu); химиотерапевтические агенты или лекарственные средства (например, метотрексат, адриамицин, алкалоиды барвинка (винкристин, винбластин, этопозид), доксорубицин, мелфалан, митомицин С, хлорамбуцил, даунорубицин или другие интеркалирующие агенты); ингибирующие рост агенты; ферменты и их фрагменты, такие как нуклеолитические ферменты; антибиотики; токсины, такие как малые молекулярные токсины или ферментативно активные токсины бактериального, грибкового, растительного или животного происхождения, включая фрагменты и/или их варианты; и различные противоопухолевые или противораковые агенты, описанные ниже.

«Химиотерапевтический агент» представляет собой химическое соединение, полезное для лечения рака. Примеры химиотерапевтических агентов включают химические соединения, полезные для лечения рака. Примеры химиотерапевтических агентов включают алкилирующие агенты, такие как тиотепа и циклофосфамид CYTOXAN®; алкилсульфонаты, такие как бусульфан, импросульфан и пипосульфан; азиридины, такие как бензодопа, карбохинон, метуредопа и уредопа; этиленимины и метиламеламины, включая альтретамин, триэтиленмеламин, триэтиленфосфорамид, триэтилентиофосфорамид и триметилоломеламин; ацетогенины (особенно буллатацин и буллатацинон); камптотецин (включая синтетический аналог топотекана); бриостатин; каллистатин; CC-1065 (включая синтетические аналоги адозелезина, карцелезина и бизелезина); криптофицины (в частности, криптофицин 1 и криптофицин 8); доластатин; дуокармицин (включая синтетические аналоги, KW-2189 и CB1-TM1); элейтеробин; панкратистатин; саркодиктин; спонгистатин; азотистые иприты, такие как хлорамбуцил, хлорнафазин, холофосфамид, эстрамустин, ифосфамид, мехлорэтамин, гидрохлорид мехлорэтамин оксида, мелфалан, новембичин, фенестерин, преднимустин, трофосфамид, урациловый иприт; нитрозомочевины, такие как кармустин, хлорозотоцин, фотемустин, ломустин, нимустин и ранимнустин; антибиотики, такие как антибиотики эндиин (например, калихеамицин, особенно калихеамицин гамма1I и калихеамицин омегаI1 (см., например, Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); динемицин, включая динемицин А; бисфосфонаты, такие как хлодронат; эсперамицин; а также хромофоры неокарзиностатина и связанные хромофоры хромопротеинов ендииновых антибиотиков), аклациномизины, актиномицин, автрамицин, азасерин, блеомицины, кактиномицин, карабицин, карминомицин, карзинофилин, хромомицины, дактиномицин, даунорубицин, деторубицин, 6-диазо-5-оксо-L-норлейцин, ADRIAMYCIN® доксорубицин (включая морфолино-доксорубицин, цианоморфолино-доксорубицин, 2-пирролино-доксорубицин и дезоксидокорубицин), эпирубицин, эзорубицин, идарубицин, марцелломицин, митомицины, такие как митомицин C, микофенольная кислота, ногаламицин, оливомицины, пепломицин, потфиромицин, пуромицин, келамицин, родорубицин, стрептонигрин, стрептозоцин, туберцидин, убенимекс, циностатин, зорубицин; антиметаболиты, такие как метотрексат и 5-фторурацил (5-FU); аналоги фолиевой кислоты, такие как деноптерин, метотрексат, птероптерин, триметрексат; пуриновые аналоги, такие как флударабин, 6-меркаптопурин, тиамиприн, тиогуанин; пиримидиновые аналоги, такие как анцитабин, азацитидин, 6-азауридин, кармофур, цитарабин, дидезоксиуридин, доксифлуридин, эноцитабин, флоксуридин; андрогены, такие как калустерон, пропионат дромоностанола, эпитиостанол, мепитиостан, тестолактон; антиадреналы, такие как аминоглютетимид, митотан, трилостан; заменитель фолиевой кислоты, такой как фролиновая кислота; ацеглатон; альдофосфамидгликозид; аминолевулиновую кислоту; енилурацил; амсакрин; бестрабуцил; бизантрен; эдатраксат; дефофамин; демеколцин; диазиквон; элфорнитин; эллиптиний ацетат; эпотилон; этоглюцид; нитрат галлия; гидроксимочевина; лентинан; лонидаинин; майтансиноиды, такие как майтансин и ансамитоцины; митогуазон; митоксантрон; мопиданмол; нитраэрин; пентостатин; фенамет; пирарубицин; лозоксантрон; подофиллиновая кислота; 2-этилгидразид; прокарбазин; полисахаридный комплекс PSK® (JHS Natural Products, Юджин, Орегон); разоксан; ризоксин; сизофиран; спирогерманий; тенуазоновая кислота; триазиквон; 2,2',2” -трихлоротриетиламин; трихотецены (особенно токсин Т-2, верракурин А, роридин А и ангидин); уретан; виндезин; дакарбазин; манномустин; митобронитол; митолактол; пипоброман; гацитозин; арабинозид («Ара-С»); циклофосфамид; тиотеп; таксоноиды, например, TAXOL® пакситаксел (Bristol-Myers Squibb Oncology, Принстон, Нью-Джерси), ABRAXANE™ без кремофора, альбумин-сконструированная композиция наночастиц из паклитаксела (American Pharmaceutical Partners, Щаумберг, Иллинойс) и доксетаксель TAXOTERE® (Rhône-Poulenc Rorer, Энтони, Франция); хлоранбуцил; GEMZAR® гемцитабин; 6-тиогуанин; меркаптопурин; метотрексат; платиновые аналоги, такие как цисплатин и карбоплатин; винбластин; платины; этопозид (VP-16); ифосфамид; митоксантрон; винкристин; NAVELBINE® винорелбин; новантрон; тенипозид; эдатрексат; дауномицин; аминоптерин; кселода; ибандронат; иринотекан (Camptosar, CPT-11) (включая режим лечения иринотеканом с 5-FU и лейковорином); ингибитор топоизомеразы RFS 2000; дифторметилорнитин (DMFO); ретиноиды, такие как ретиноевая кислота; капецитабин; комбретастатин; лейковорин (LV); оксалиплатин, включая режим лечения оксалиплатином (FOLFOX); ингибиторы PKC-альфа, Raf, H-Ras, EGFR (например, эрлотиниб (TARCEVA™)) и VEGF-A, которые уменьшают пролиферацию клеток и фармацевтически приемлемые соли, кислоты или производные любого из вышеуказанных.

Также в это определение включены антигормональные агенты, которые действуют, чтобы регулировать или ингибировать гормональное действие на опухоли, такие как антиэстрогены и селективные модуляторы рецепторов эстрогенов (SERM), включая, например, тамоксифен (включая тамоксифен NOLVADEX®), ралоксифен, дролоксифен , 4-гидрокситамоксифен, триоксифен, кеоксифен, LY117018, онапристон и FАRESTON® торемифен; ингибиторы ароматазы, которые ингибируют ферментативную ароматазу, которая регулирует выработку эстрогенов в надпочечниках, такие как, например, 4(5)-имидазолы, аминоглютетимид, мегестрола ацетат MEGASE®, экземелан AROMASIN®, форместан, фадрозол, RIVISOR® ворозол, FEMARA® летрозол и анастигол ARIMIDEX®; и антиандрогены, такие как флутамид, нилутамид, бикалютамид, лейпролид и госерелин; а также трокацитабин (аналог 1,3-диоксолан нуклеозидного цитозина); антисмысловые олигонуклеотиды, особенно те, которые ингибируют экспрессию генов в сигнальных путях, вовлеченных в адренерную пролиферацию клеток, такие как, например, PKC-альфа, Raf и H-Ras; рибозимы, такие как ингибитор экспрессии VEGF (например, рибозим ANGIOZYME®) и ингибитор экспрессии HER2; вакцины, такие как вакцины генной терапии, например, вакцина ALLOVECTIN®, вакцина LEUVECTIN® и вакцина VAXID®; PROLEUKIN® rIL-2; LURTOTECAN® ингибитор топоизомеразы 1; ABARELIX® rmRH; Винорелбин и эсперамицины (см. пат. США № 4675187) и фармацевтически приемлемые соли, кислоты или производные любого из вышеуказанных.

Используемый в данном документе термин «пролекарство» относится к предшественнику или производной форме фармацевтически активного вещества, которое менее цитотоксично к опухолевым клеткам по сравнению с исходным лекарственным средством и может быть ферментативно активировано или превращено в более активную родительскую форму. См., например, Wilman, “Prodrugs in Cancer Chemotherapy” Biochemical Society Transactions, 14, pp. 375-382, 615th Meeting Belfast (1986) and Stella et al., “Prodrugs: A Chemical Approach to Targeted Drug Delivery,” Directed Drug Delivery, Borchardt et al., (ed.), pp. 247-267, Humana Press (1985). Пролекарства по настоящему изобретению включают, но не ограничиваются ими, пролекарства, содержащие фосфат, пролекарства, содержащие тиофосфат, пролекарства, содержащие сульфат, пролекарства, содержащие пептид, пролекарства, модифицированные D-аминокислотой, гликозилированные пролекарства, пролекарства, содержащие β-лактам, необязательно замещенные пролекарства, содержащие феноксиацетамид, или необязательно замещенные пролекарства, содержащие фенилацетамид, 5-фторцитозин и другие 5-фторуридиновые пролекарства, которые могут быть превращены в более активное цитотоксическое свободное лекарственное средство. Примеры цитотоксических лекарств, которые могут быть дериватизированы в пролекарственную форму для использования в этом изобретении, включают, но не ограничиваются ими, химиотерапевтические агенты, описанные выше.

Термин «листок-вкладыш» используется для обозначения инструкций, обычно включаемых в коммерческие пакеты терапевтических продуктов, которые содержат информацию о показаниях, использовании, дозировке, введении, комбинированной терапии, противопоказаниях и/или предупреждениях относительно использования таких терапевтических продуктов.

«Фармацевтически приемлемый носитель» относится к ингредиенту в фармацевтической композиции, отличной от активного ингредиента, которая нетоксична для субъекта. Фармацевтически приемлемый носитель включает, но не ограничивается ими, буфер, эксципиент, стабилизатор или консервант.

Термин «фармацевтический состав» относится к препарату, который находится в такой форме, чтобы обеспечить биологическую активность активного ингредиента (например, антитела против VEGF, конъюгата антитела, слитого белка или полимерной композиции), содержащегося в нем, для эффективности, и который не содержит дополнительных компонентов, которые неприемлемо токсичны для субъекта, которому будет вводиться препарат.

Используемый в данном документе, термин «лечение» (и его грамматические вариации, такие как «лечить» или «лечение») относится к клиническому вмешательству в попытке изменить естественный ход лечения индивидуума, и может быть выполнено либо для профилактики, либо во время хода клинической патологии. Желательные эффекты лечения включают, но не ограничиваются ими, предотвращение возникновения или рецидива заболевания, облегчение симптомов, уменьшение любых прямых или косвенных патологических последствий заболевания, предотвращение метастазов, снижение скорости прогрессирования заболевания, улучшение или ослабление состояние болезни, ремиссия или улучшение прогноза. В некоторых вариантах осуществления изобретения, антитела по изобретению или другие композиции, которые включают антитело по изобретению (например, конъюгат антитела, слитый белок или полимерную композицию), используются для замедления развития заболевания или замедления прогрессирования заболевания.

«Изолированная» молекула нуклеиновой кислоты представляет собой молекулу нуклеиновой кислоты, которая идентифицирована и отделена от по меньшей мере одной молекулы нуклеиновой кислоты-загрязнителя, с которой она обычно ассоциируется в естественном источнике нуклеиновой кислоты. Изолированная молекула нуклеиновой кислоты отличается от формы или конфигурации, в которой она встречается в природе. Таким образом, изолированные молекулы нуклеиновых кислот отличаются от молекулы нуклеиновой кислоты, какой она существует в природных клетках. Однако изолированная молекула нуклеиновой кислоты включает молекулу нуклеиновой кислоты, содержащуюся в клетках, которые обычно экспрессируют антитело, где, например, молекула нуклеиновой кислоты находится в хромосомном положении, отличном от положения в естественных клетках.

Выражение «контролирующие последовательности» относится к последовательностям ДНК, необходимым для экспрессии функционально связанной кодирующей последовательности в конкретном организме-хозяине. Контрольные последовательности, которые подходят для прокариотов, например, включают промотор, необязательно последовательность оператора и сайт связывания рибосом. Известно, что в эукариотических клетках применяются промоторы, сигналы полиаденилирования и энхансеры.

Нуклеиновая кислота является "функционально связанной", если она вступает в функциональное взаимоотношение с другой последовательностью нуклеиновой кислоты. К примеру, ДНК предпоследовательности или секреторного лидера является функционально связанной с ДНК полипептида, если она экспрессируется как предбелок, принимающий участие в секреции этого полипептида; промотор или энхансер функционально связан с кодирующей последовательностью, если он влияет на транскрипцию этой последовательности, или участок связывания рибосом функционально связан с кодирующей последовательностью, если он расположен так, чтобы оптимизировать процесс трансляции. В целом, "функционально связанный" означает, что последовательности ДНК, будучи связанными, являются непрерывными и, в случае наличия секреторного лидера, непрерывными и в фазе считывания. Тем не менее, энхансеры не должны быть непрерывными. Связывание сопровождается лигированием по подходящим участкам рестрикции. Если таких сайтов не существует, синтетические олигонуклеотидные адаптеры или линкеры используются в соответствии с обычной практикой.

Как используется в данном документе, выражения «клетка», «клеточная линия» и «культура клеток» используются взаимозаменяемо, и все такие обозначения включают потомство. Таким образом, слова «трансформанты» и «трансформированные клетки» включают в себя первичную клетку индивида и культуры, полученные из нее, без учета количества передач. Также понятно, что все потомство не может быть точно идентичным по содержанию ДНК из-за преднамеренных или непреднамеренных мутаций. Мутантные потомства, которые обладают той же функцией или биологической активностью, что и скринированные в первоначально трансформированной клетке. Там, где предназначены разные обозначения, это будет ясно из контекста.

Используемый в данном документе термин «библиотека» относится ко множеству антител или последовательностей фрагментов антитела (например, антител против VEGF по изобретению) или нуклеиновых кислот, которые кодируют эти последовательности, причем последовательности отличаются друг от друга в комбинации вариантов аминокислот, которые вводят в эти последовательности в соответствии со способами по изобретению.

«Мутация» представляет собой делецию, вставку или замещение нуклеотида(ов) относительно эталонной нуклеотидной последовательности, такой как последовательность дикого типа.

Используемый в данном документе термин «набор кодонов» относится к набору различных нуклеотидных триплетных последовательностей, используемых для кодирования желаемых вариантов аминокислот. Набор олигонуклеотидов может быть синтезирован, например, путем твердофазного синтеза, включая последовательности, которые представляют все возможные комбинации нуклеотидных триплетов, предоставляемых набором кодонов, и которые будут кодировать желаемую группу аминокислот. Стандартная форма обозначения кодонов относится к коду IUB, известному в данной области техники и описанному в данном документе. Обычно набор кодонов обозначен курсивом в помощью 3х заглавных букв, например, NNK, NNS, XYZ, DVK и т.п. Синтез олигонуклеотидов с выбранным нуклеотидным «вырождением» в определенных положениях хорошо известен в этом области техники, например, подход TRIM (Knappek et al., J. Mol. Biol. 296:57-86 (1999)); Garrard et al., Gene 128:103(1993)). Такие наборы олигонуклеотидов, имеющих определенные наборы кодонов, могут быть синтезированы с использованием коммерческих синтезаторов нуклеиновых кислот (доступны, например, от Applied Biosystems, Фостер Сити, Калифорния), или могут быть получены коммерчески (например, из Life Technologies, Роквилль, Мэриленд). Следовательно, набор олигонуклеотидов, синтезированных с конкретным набором кодонов, обычно включает в себя множество олигонуклеотидов с различными последовательностями, различия, установленные набором кодонов в общей последовательности. Олигонуклеотиды, используемые в соответствии с изобретением, имеют последовательности, которые допускают гибридизацию с шаблоном нуклеиновой кислоты с вариабельным участком, а также могут, но необязательно, включать сайты рестрикционных ферментов, пригодные, например, для целей клонирования.

«Фаговый дисплей» представляет собой способ, при котором вариантные полипептиды отображаются в виде слитых белков по меньшей мере на части белковой оболочки на поверхности фага, например, нитевидный фаг, частицы. Утилита фагового дисплея заключается в том, что большие библиотеки рандомизированных вариантов белка могут быстро и эффективно сортироваться для тех последовательностей, которые связываются с целевым антигеном с высоким сродством. Отображение библиотек пептидов и белков на фаге было использовано для скрининга миллионов полипептидов для тех, которые имеют специфические связывающие свойства. Поливалентные способы фагового дисплея использовались для отображения малых случайных пептидов и малых белков через слияния либо с геном III, либо с геном VIII нитевидного фага. Wells and Lowman, Curr. Opin. Struct. Biol., 3: 355-362 (1992) и ссылки, цитируемые в нем. В моновалентном фаговом дисплее библиотека белка или пептида слита с геном III или его частью и экспрессируется на низких уровнях в присутствии белка гена III дикого типа, так что частицы фага отображают одну копию или ни один из слитых белков. Эффекты авидности снижаются по сравнению с поливалентным фагом, поэтому сортировка основана на аффинности собственного лиганда, и используются векторы фагемидов, которые упрощают манипуляции с ДНК. Lowman and Wells, Methods: A companion to Methods in Enzymology, 3:205-0216 (1991).

«Фагемид» представляет собой плазмидный вектор, имеющий бактериальное происхождение репликации, например, Co1E1, и копию межгенного участка бактериофага. Фагемид можно использовать на любом известном бактериофаге, включая филаментный бактериофаг и лямбдоидный бактериофаг. Плазмида также обычно будет содержать селективный маркер устойчивости к антибиотикам. Сегменты ДНК, клонированные в эти векторы, могут распространяться в виде плазмид. Когда клетки, укрывающие эти векторы, обеспечиваются всеми генами, необходимыми для производства фаговых частиц, способ репликации плазмиды изменяется на репликацию по типу "катящегося кольца", чтобы генерировать копии одной цепи плазмидной ДНК и оболочки фаговых частиц. Фагемид может образовывать инфекционные или неинфекционные частицы фага. Этот термин включает в себя фагемиды, которые содержат ген белка оболочки фага или его фрагмент, связанный с гетерологичным геном полипептида в качестве гена слияния, так что гетерологичный полипептид отображается на поверхности фаговой частицы.

Термин «вектор фага» означает двухцепочечную репликативную форму бактериофага, содержащего гетерологичный ген и способный к репликации. Вектор фага имеет фаговое происхождение репликации, обеспечивающее репликацию фага и образование фаговых частиц. Фагом предпочтительно является нитевидный бактериофаг, такой как фаг M13, f1, fd, Pf3 или его производное, или лямбдовидный фаг, такой как лямбда, 21, phi80, phi81, 82, 424, 434 и т. д., или его производное.

«Вариант» или «мутант» исходного или эталонного полипептида (например, эталонного антитела или его вариабельного домена(ов)/HVR) представляет собой полипептид, который (1) имеет аминокислотную последовательность, отличную от аминокислотной последовательности исходного или эталонного полипептида и (2) был получен из исходного или эталонного полипептида посредством естественного или искусственного (созданного человеком) мутагенеза. Такие варианты включают, например, делеции из, и/или вставки в, и/или замены остатков в аминокислотной последовательности представляющего интерес полипептида, обозначенные в данном документе как «изменения аминокислотных остатков». Таким образом, вариант HVR относится к HVR, содержащему вариантную последовательность относительно исходной или эталонной полипептидной последовательности (такой как исходное антитело или антигенсвязывающий фрагмент). В этом контексте изменение аминокислотного остатка относится к аминокислоте, отличной от аминокислоты в соответствующем положении в исходной или эталонной полипептидной последовательности (такой как эталонное антитело или его фрагмент). Любая комбинация делеции, вставки и замены может быть выполнена для получения окончательного варианта или конструкции мутантов при условии, что конечная конструкция обладает желаемыми функциональными характеристиками. Аминокислотные изменения также могут изменять посттрансляционные процессы полипептида, такие как изменение количества или положения сайтов гликозилирования.

Последовательность «дикого типа (ДТ)» или «эталонная» последовательность или последовательность «дикого типа» или «эталонного» белка/полипептида, такого как HVR или вариабельный домен эталонного антитела, может быть контрольной последовательностью из которой вариантные полипептиды получают путем введения мутаций. В общем, последовательность «дикого типа» для данного белка представляет собой последовательность, которая наиболее распространена в природе. Аналогично, последовательность гена «дикого типа» представляет собой последовательность этого гена, которая наиболее часто встречается в природе. Мутации могут быть введены в ген «дикого типа» (и, следовательно, белок, который он кодирует), либо посредством естественных процессов, либо посредством искусственных способов. Продукты таких процессов являются «вариантными» или «мутантными» формами исходного белка или гена «дикого типа».

«Эталонное антитело», как используется в данном документе, относится к антителу или фрагменту, чья антигенсвязывающая последовательность служит в качестве шаблонов последовательности, на которой выполняется диверсификация в соответствии с описанными в данном документе критериями. Антигенсвязывающая последовательность обычно включает вариабельный участок антитела, предпочтительно по меньшей мере один HVR, предпочтительно включающий каркасные области.

Под «массовым параллельным секвенированием» или «массивным параллельным секвенированием», также известным в данной области техники как «секвенирование следующего поколения» или «секвенирование второго поколения», подразумевается любой подход с высокой степенью пропускной способности нуклеиновой кислоты. Эти подходы обычно включают параллельное секвенирование большого числа (например, тысяч, миллионов или миллиардов) пространственно разделенных, клонированных амплифицированных ДНК-шаблонов или одиночных молекул ДНК. См., например, Metzker, Nature Reviews Genetics 11: 31-36, 2010.

«Обогащенный», как используется в данном документе, означает, что сущность (например, изменение аминокислотного остатка) присутствует в более высокой частоте в сортированной библиотеке по сравнению с соответствующей эталонной библиотекой (например, несортированной библиотекой или библиотекой, которая была отсортирована для другого или неприменимого антигена). Напротив, «истощенный» означает, что сущность (например, изменение аминокислотного остатка) присутствует в более низкой частоте в сортированной библиотеке по сравнению с соответствующей эталонной библиотекой (например, несортированной библиотекой или библиотекой, которая была отсортирована для другого или неприменимого антигена). Термин «нейтральный» при использовании в отношении способов идентификации вариантов аминокислотных остатков означает, что сущность не обогащена и не истощена, другими словами, она присутствует примерно на той же частоте в сортированной библиотеке по сравнению с соответствующей эталонной библиотекой (например, несортированной библиотекой или библиотекой, которая была отсортирована для другого или неприменимого антигена).

Под «изоэлектрической точкой (pI)» понимают рН, при котором молекула (например, белок, такой как антитело) не несет никакого электрического заряда, также известный в данной области как «pH (I)» или «IEP». »

Используемый в данном документе термин «конъюгат антитела» представляет собой антитело, ковалентно присоединенное к одному или более полимерам. Любой подходящий полимер может быть конъюгирован с антителом, например гидрофильным полимером (например, гиалуроновой кислотой (НА) или полиэтиленгликолем (ПЭГ)) или гидрофобным полимером (например, поли(молочно-ко-гликолевая кислота) (PLGA) ).

Используемый в данном документе термин «полимер» означает молекулу, которая включает повторяющиеся структурные единицы (то есть мономеры), связанные химическими связями линейным, круговым, разветвленным, сшитым или дендримерным способом или их комбинацией. Полимер может быть синтетическим или природным или их комбинацией. Следует понимать, что термин «полимер» охватывает сополимеры, которые представляют собой полимеры, которые включают два или более разных мономера. Полимер также может быть гомополимером, который представляет собой полимер, который включает только мономер одного типа.

Термины «гиалуроновая кислота», «гиалуранон» и «НА», которые используются в данном документе взаимозаменяемо, относятся к полимерному гликозаминогликану (GAG), который содержит повторяющиеся дисахаридные звенья N-ацетилглюкозамина и глюкуроновой кислоты. HA представляет собой анионный, несульфатированный GAG, который можно найти, например, во внеклеточном матриксе (например, в стекловидном теле глаза), соединительной ткани, эпителиальной и нервной ткани.

Используемый в данном документе термин «полиэтиленгликоль» или «ПЭГ» относится к полиэфирному соединению, которое также известно как полиэтиленоксид (ПЭО) или полиоксиэтилен (ПОЭ) в зависимости от его молекулярной массы. ПЭГ может иметь структуру H-(O-CH2-CH2)n-OH, где n - любое подходящее целое число. ПЭГ может представлять собой разветвленный ПЭГ, звездчатый ПЭГ или гребенчатый ПЭГ. ПЭГ может быть, например, тетрамером ПЭГ, гексамером ПЭГ или октамером ПЭГ.

Используемый в данном документе термин «слитый белок» относится к белку, в котором первый пептид, белок или полипептид, например антитело (например, антитело против VEGF (например, любое антитело против VEGF, описанное в данном документе, например, G6.31 AARR)) напрямую или опосредованно связывается со вторым пептидом, белком или полипептидом, например, с окулярным связывающим доменом (например, с HA-связывающим доменом). В одном примере первый пептид, белок или полипептид (например, антитело) может быть связан со вторым пептидом, белком или полипептидом (например, окулярным связывающим доменом (например, HA-связывающим доменом)) с помощью линкера. В контексте слитых белков термины «связывать» и «связанные» и их грамматические вариации взаимозаменяемы с термином «ковалентно присоединенные» и относятся к прямому или косвенному ковалентному связыванию (например, пептидной связи) между двумя частями слитого белка. В общем, слитые белки по изобретению представляют собой слитые белки антител. Антитело может представлять собой фрагмент антитела, например Fab, Fab' или Fab-C. В некоторых случаях фрагмент антитела представляет собой Fab.

Термин «окулярный связывающий домен» относится к пептиду, белку, полипептиду или их фрагменту, который связывается с биологическим веществом, находящимся в глазу (например, роговицей, стекловидным телом, сетчатым, сетчатым эпителием сетчатки или сосудистой оболочкой). В качестве одного примера, в некоторых случаях, биологическое вещество, обнаруженное в глазу, представляет собой внеклеточный матричный компонент, например, углевод (например, заряженный углевод (например, гликозаминогликан)), гликопротеин (например, фибриллин и оптицин) или белок (например, коллаген (например, коллаген I-XXVII, в частности коллаген II, коллаген IX, коллаген V, коллаген VI, коллаген XI и гетеротипические коллагеновые фибриллы) или другие компоненты внеклеточного матрикса, описанные, например, в Le Goff et al., Eye 22: 1214-1222, 2008. В некоторых случаях компонент внеклеточного матрикса представляет собой гликозаминогликан, например HA или протеогликан (например, хондроитинсульфат или сульфат гепарина). В одном примере окулярный связывающий домен является связывающим доменом гиалуроновой кислоты.

Используемый в данном документе термин «связывающий домен гиалуроновой кислоты» или «связывающий домен НА» относится к пептиду, белку, полипептиду или его фрагменту, который связывает HA. HA-связывающий домен может быть получен из HA-связывающего белка (также упоминаемого в данной области техники как «гиаладерин»), включая, например, ген 6 стимулированного фактора некроза опухолей (TSG6), эндотелиальный гиалуронановый рецептор лимфатического сосуда 1 (LYVE -1), гиалуронановый и протеогликановый связывающий белок (HAPLN) 1, HAPLN2, HAPLN3, HAPLN4, аггрекан, бревикан, нейрокан, фосфакан, версикан, CAB61358, KIA0527, стабилин-1, стабилин-2, RHAMM, бактериальную HA-синтазу и коллаген VI. Другие HA-связывающие белки известны в данной области. Типичные HA-связывающие домены включают в себя связывающие модули, домены G1 и олигопептиды, богатые лизином.

«Модуль связи» (также упоминаемый в данной области как «домен связи») является структурным доменом, содержащим приблизительно 100 аминокислот (см., например, Yang et al., EMBO J., 13 (2): 286-296; Mahoney et al., J. Biol. Chem. 276(25): 22764-22771, 2001; и Blundell et al. J. Biol. Chem. 278 (49): 49261-49270, 2003), который связывает HA. Типичные, не ограничивающие модули связывания включают те, из TSG6, CD44, LYVE-1, HAPLN1, HAPLN2, HAPLN3, HAPLN4, аггрекана, бревикана, нейрокана, фосфакана, версикана, CAB61358, KIA0527, стабилина-1 и стабилина-2 модулей связывания, или их варианты. В качестве одного из примеров, модуль связывания HA-связывающего белка TSG6 может включать аминокислотные остатки 36-128 TSG6 человека (UniProt № доступа P98066). Вариант модуля связи связывает HA и может иметь, например, идентичность по меньшей мере 80 % аминокислотной последовательности (например, 80 %, 85 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 %, 99 % или более высокой идентичности) к модулю связи дикого типа или эталона, и может включать в себя вариации последовательности, такие как вставки, делеции и замены (например, консервативные аминокислотные замены) относительно модуля связывания дикого типа или эталона аминокислотной последовательности.

В контексте слитых белков, «линкер» может быть пептидом или полипептидом, который связывает (например, ковалентно связывает) первый фрагмент (например, антитело (например, антитело против VEGF (например, любое антитело против VEGF, описанное в данном документе, например, G6.31 AARR))) со вторым фрагментом (например, окулярным связывающим доменом (например, HA-связывающим доменом)). Линкер может включать аминокислотную последовательность любой подходящей длины, например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 или более аминокислотных остатков. В некоторых случаях линкер включает около 3, около 4, около 5, около 6, около 7 или около 8 остатков. В некоторых случаях линкер включает аминокислотную последовательность GGGGS (SEQ ID NO: 61).

Используемый в данном документе термин «гидрогель» относится к гидрофильной или амфифильной полимерной сети, состоящей из гомополимеров или сополимеров, которая нерастворима в связи с наличием ковалентных химических сшивок. Сшивки могут обеспечивать структуру сети и физическую целостность. Гидрогели могут демонстрировать термодинамическую совместимость с водой, что позволяет им набухать в водных средах.

Используемый в данном документе термин «обратимый пролекарственный линкер» означает фрагмент, который присоединен одним концом к биологически активному фрагменту (например, лекарственному средству, такому как антитело против VEGF) через обратимую связь и прикреплен другим концом через постоянную связь с носителем (например, гидрогелем), тем самым связывая биологически активный фрагмент с носителем. Такие обратимые пролекарственные линкеры являются неферментативно гидролизуемыми, т.е. расщепляемыми в физиологических условиях (например, водным буфером при рН 7,4, 37 °С) с периодом полураспада от, например, одного часа до двенадцати месяцев. Обратимые связи включают, например, акотилы, ацетали, амиды, ангидриды карбоновых кислот, сложные эфиры, имины, гидразоны, амиды малеиновой кислоты, ортоэфиры, фосфамиды, фосфоэфиры, сложные эфиры фосфосилила, силиловые эфиры, сульфоновые эфиры, ароматические карбаматы и их комбинации. Напротив, постоянные связи являются неферментативно гидролитически разлагаемыми в физиологических условиях (водный буфер при рН 7,4, 37°С) с периодом полураспада более двенадцати месяцев. Типичные обратимые пролекарственные линкеры описаны, например, в публикации международной патентной заявки № WO 2014/056923, которая полностью включена в настоящее описание посредством ссылки.

Используемый в данном документе термин «клиренс» относится к объему вещества (например, антителу против VEGF, конъюгату антитела, слитому белку (например, слитому белку Fab) или полимерному составу), удаляемому из компартмента (например, глаза (например, стекловидного тела)) в единицу времени.

Термин «период полувыведения» относится ко времени, требуемому для разделения концентрации вещества (например, антитело против VEGF, конъюгата антитела, слитого белка (например, слитого белка Fab) или полимерной композиции), на половину, in vivo (например, в глазу (например, стекловидном теле)) или in vitro.

II. КОМПОЗИЦИИ И СПОСОБЫ

Изобретение относится к новым антителам, которые связываются с VEGF, и к способам получения и их использования, например, для диагностических и терапевтических целей.Изобретение также относится к композициям, которые включают антитела против VEGF (включая любое антитело против VEGF, описанное в данном документе), включая конъюгаты антител, слитые белки и полимерные составы, а также способы их получения и их использования, например, для диагностики и терапевтического использования. Изобретение также относится к способам идентификации вариантов антител с улучшенными свойствами, например, с повышенной аффинности связывания, стабильностью и/или экспрессией.

A. Иллюстративные антитела против VEGF

В одном аспекте, изобретение основано, в частности, на антителах, которые специфически связываются с VEGF. Антитела по изобретению полезны, например, для ослабления ангиогенеза и для лечения или замедления прогрессирования расстройства, связанного с патологическим ангиогенезом (например, окулярными расстройствами или клеточными пролиферативными нарушениями). Антитела по изобретению также полезны, например, для ингибирования проницаемости сосудов и лечения расстройств, связанных с нежелательной проницаемостью сосудов.

В некоторых случаях антитело против VEGF может включать по меньшей мере один, два, три, четыре, пять или шесть HVR, выбранных из: (a) HVR-H1, содержащего аминокислотную последовательность DYWIH (SEQ ID NO: 1) ; (b) HVR-H2, содержащего аминокислотную последовательность GX1TPX2GGX3X4X5YX6DSVX7X8 (SEQ ID NO: 2), где X1 представляет собой Ile или His, X2 представляет собой Ala или Arg, X3 представляет собой Tyr или Lys, X4 представляет собой Thr или Glu, X5 представляет собой Arg, Tyr, Gln или Glu, X6 представляет собой Ala или Glu, X7 представляет собой Lys или Glu, а X8 представляет собой Gly или Glu; (c) HVR-H3, содержащего аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащего аминокислотную последовательность RASQX1VSTAVA (SEQ ID NO: 4), где X1 представляет собой Asp или Arg; (e) HVR-L2, содержащего аминокислотную последовательность X1ASFLYS (SEQ ID NO: 5), где X1 представляет собой Ser или Met; и (f) HVR-L3, содержащего аминокислотную последовательность X1QGYGX2PFT (SEQ ID NO: 6), где X1 представляет собой Gln, Asn или Thr и X2 представляет собой Ala, Asn, Gln или Arg или комбинацию одного или более из вышеуказанных HVR и одного или более его вариантов, имеющих по меньшей мере около 80 % идентичности последовательности (например, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности) по любой из SEQ ID NO: 1-6.

Например, антитело против VEGF может включать по меньшей мере один, два, три, четыре, пять или шесть HVR, выбранных из: (a) HVR-H1, содержащего аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащего аминокислотную последовательность GITPAGGYTRYADSVKG (SEQ ID NO: 7), GITPAGGYEYYADSVKG (SEQ ID NO: 21) или GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащего аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащего аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащего аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащего аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10) или QQGYGNPFT (SEQ ID NO: 23), или комбинацию одного или более из вышеуказанных HVR и одного или более его вариантов, имеющих по меньшей мере около 80 % идентичности последовательности (например, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности) по любому из SEQ ID NO: 1, 3, 7-10 или 21-23.

Например, в некоторых случаях антитело против VEGF может включать по меньшей мере один, два, три, четыре, пять или шесть HVR, выбранных из: (a) HVR-H1, содержащего аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащего аминокислотную последовательность GITPAGGYTRYADSVKG (SEQ ID NO: 7); (c) HVR-H3, содержащего аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащего аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащего аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащего аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10), или комбинацию одного или более из вышеуказанных HVR и одного или более его вариантов, имеющих по меньшей мере около 80 % идентичности последовательности (например, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности) к любому из SEQ ID NO: 1, 3 или 7-10. В конкретном примере в некоторых случаях антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYTRYADSVKG (SEQ ID NO: 7); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих каркасных участков вариабельного домена тяжелой цепи (FR): (a) FR-H1, содержащий аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13); (b) FR-H2, содержащий аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 14); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); и (d) FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 16).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих FR вариабельного домена легкой цепи: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20).

Например, в некоторых случаях антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYTRYADSVKG (SEQ ID NO: 7); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13); (b) FR-H2, содержащий аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 14); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); и (d) FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 16). В других случаях анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 11 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

Например, в некоторых случаях антитело против VEGF может включать по меньшей мере один, два, три, четыре, пять или шесть HVR, выбранных из: (a) HVR-H1, содержащего аминокислотную последовательность DYWIH (SEQ ID NO : 1); (b) HVR-H2, содержащего аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащего аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащего аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащего аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащего аминокислотную последовательность QQGYGNPFT (SEQ ID NO: 23), или комбинацию одного или более из вышеуказанных HVR и одного или более его вариантов, имеющих по меньшей мере около 80 % идентичности последовательности (например, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности) к любому из SEQ ID NO: 1, 3, 8, 9, 22 или 23. В конкретном примере в некоторых случаях антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGNPFT (SEQ ID NO: 23).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих каркасных участков вариабельного домена тяжелой цепи (FR): (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29) или EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 51); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих FR вариабельного домена легкой цепи: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 24); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20).

Например, в некоторых случаях антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGNPFT (SEQ ID NO: 23). В некоторых случаях анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 24); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 38.

В некоторых случаях антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGNPFT (SEQ ID NO: 23). В некоторых случаях анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 51); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 24); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 38.

Например, в некоторых случаях антитело против VEGF может включать по меньшей мере один, два, три, четыре, пять или шесть HVR, выбранных из: (a) HVR-H1, содержащего аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащего аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащего аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащего аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащего аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащего аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10), или комбинацию одного или более из вышеуказанных HVR и одного или более его вариантов, имеющих по меньшей мере около 80 % идентичности последовательности (например, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности) к любому из SEQ ID NO: 1, 3, 8-10 или 22. В конкретном примере, в некоторых случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих каркасных участков вариабельного домена тяжелой цепи (FR): (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29) или EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 51); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих FR вариабельного домена легкой цепи: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17), DIQMTQSPESLSASVGDEVTITC (SEQ ID NO: 25) или DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18) или WYQQKPGEAPKLLIY (SEQ ID NO: 27); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19) или GVPSRFSGSGSGTDFTLTIESLQPEDAATYYC (SEQ ID NO: 28); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20).

Например, в некоторых случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPESLSASVGDEVTITC (SEQ ID NO: 25); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях, антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 34.

Например, в других случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена легкой цепи: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGEAPKLLIY (SEQ ID NO: 27); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTIESLQPEDAATYYC (SEQ ID NO: 28); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях, антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 35.

Например, в других случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 51); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена легкой цепи: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGEAPKLLIY (SEQ ID NO: 27); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTIESLQPEDAATYYC (SEQ ID NO: 28); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях, антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 35.

Например, в других случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPESLSASVGDEVTITC (SEQ ID NO: 25); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGEAPKLLIY (SEQ ID NO: 27); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 36.

Например, в еще других случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37.

В других случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 51); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях, антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37.

Например, в других случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях, антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В других случаях, антитело против VEGF содержит следующие шесть HVR: (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYEYYADSVEG (SEQ ID NO: 22); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях, анти-VEGF антитело включает в себя следующие четыре FR вариабельного домена тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 51); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32). В других случаях, анти-VEGF антитело включает следующие четыре FR вариабельного домена легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях, антитело против VEGF включает (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В некоторых случаях, анти-VEGF антитело содержит (а) вариабельный домен тяжелой цепи (VH), содержащий аминокислотную последовательность, имеющую по меньшей мере 90 % идентичности последовательности (например, по меньшей мере 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности последовательности) или любой из последовательности SEQ ID NO: 11, 40 или 42; (b) вариабельный домен легкой цепи (VL), содержащий аминокислотную последовательность, имеющую по меньшей мере 90 % последовательность (например, по меньшей мере 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности последовательности) или любой из последовательности SEQ ID NO: 12, 41 или 46; или (c) домен VH, как в (a), и домен VL, как в (b). Например, в некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 11 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 40 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 42 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 42 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 41. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 11 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 46.

В некоторых случаях, любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих каркасных участков вариабельного домена тяжелой цепи (FR): (a) FR-H1, содержащий аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13); (b) FR-H2, содержащий аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 14) или WVRQEPGKGLEWVA (SEQ ID NO: 39); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); и (d) FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 16).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих FR вариабельного домена легкой цепи: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17) или DIQMTQSPSSLSASVGDRVTIDC (SEQ ID NO: 45); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19), GVPSRFSGSGSGTDFTLTISSLQPEDSATYYC (SEQ ID NO: 44) или GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 54); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20) или FGQGTKVEVK (SEQ ID NO: 55).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 11 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGNPFTFGQGTKVEIK (SEQ ID NO: 59).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGNPFTFGQGTKVEIK (SEQ ID NO: 59).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 40 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGNPFTFGQGTKVEIK (SEQ ID NO: 59).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 42 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGNPFTFGQGTKVEIK (SEQ ID NO: 59).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGNPFTFGQGTKVEIK (SEQ ID NO: 59).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 11 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGAPFTFGQGTKVEIK (SEQ ID NO: 60).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYQQGYGAPFTFGQGTKVEIK (SEQ ID NO: 60).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 40 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGAPFTFGQGTKVEIK (SEQ ID NO: 60).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 42 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGAPFTFGQGTKVEIK (SEQ ID NO: 60).

В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и домен VL, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSGSGTDFTLTISSLQPEDVATYYQQGYGAPFTFGQGTKVEIK (SEQ ID NO: 60). Например, в некоторых случаях антитело против VEGF содержит (a) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90 % идентичности последовательности (например, по меньшей мере 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности последовательности) или последовательности SEQ ID NO: 11; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90 % идентичности последовательность (например, по меньшей мере 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичность последовательности) или последовательность SEQ ID NO: 11; или (c) домен VH, как в (a), и домен VL, как в (b). В некоторых случаях антитело против VEGF может включать (a) HVR-H1, содержащий аминокислотную последовательность DYWIH (SEQ ID NO: 1); (b) HVR-H2, содержащий аминокислотную последовательность GITPAGGYTRYADSVKG (SEQ ID NO: 7); (c) HVR-H3, содержащий аминокислотную последовательность FVFFLPYAMDY (SEQ ID NO: 3); (d) HVR-L1, содержащий аминокислотную последовательность RASQDVSTAVA (SEQ ID NO: 8); (e) HVR-L2, содержащий аминокислотную последовательность SASFLYS (SEQ ID NO: 9); и (f) HVR-L3, содержащий аминокислотную последовательность QQGYGAPFT (SEQ ID NO: 10). В некоторых случаях антитело против VEGF включает следующие каркасные участки тяжелой цепи: (a) FR-H1, содержащий аминокислотную последовательность EVQLVESGGGLVQPGGSLRLSCAASGFTIS (SEQ ID NO: 13); (b) FR-H2, содержащий аминокислотную последовательность WVRQAPGKGLEWVA (SEQ ID NO: 14); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSKNTAYLQMRSLRAEDTAVYYCAR (SEQ ID NO: 15); и (d) FR-H4, содержащий аминокислотную последовательность WGQGTLVTVSS (SEQ ID NO: 16). В некоторых случаях анти-VEGF антитело включает следующие каркасные участки легкой цепи: (а) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20). В некоторых случаях антитело против VEGF включает связывающий домен, содержащий (a) домен VH, содержащий аминокислотную последовательность SEQ ID NO: 11 и (b) домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12. В некоторых случаях иллюстративный анти-VEGF представляет собой N94A.F83A.N82aR.Y58R.

В некоторых случаях антитело против VEGF содержит (a) домен VH, содержащий аминокислотную последовательность, имеющую по меньшей мере 90 % идентичности последовательности (например, по меньшей мере 91 %, 92 %, 93 %, 94 %, 95 % , 96 %, 97 %, 98 % или 99 % идентичности последовательности) или последовательности SEQ ID NO: 33 или 51; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 90 % последовательность (например, по меньшей мере 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичность последовательности) или последовательность любого из SEQ ID NO: 12, 34, 35, 36, 37 или 38; или (c) домен VH, как в (a), и домен VL, как в (b). Например, в некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 34. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 35. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 36. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 33 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 38. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 38. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 35. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 37. В некоторых случаях антитело содержит домен VH, содержащий аминокислотную последовательность SEQ ID NO: 51 и домен VL, содержащий аминокислотную последовательность SEQ ID NO: 12.

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих каркасных участков вариабельного домена тяжелой цепи (FR): FR-H1, содержащий аминокислотную последовательность EEQLVEEGGGLVQPGESLELSCAASGFEIS (SEQ ID NO: 29) или EEQLVEEGGGLVQPGESLRLSCAASGFEIS (SEQ ID NO: 52); (b) FR-H2, содержащий аминокислотную последовательность WVRQEPGEGLEWVA (SEQ ID NO: 30) или WVRQEPGKGLEWVA (SEQ ID NO: 39); (c) FR-H3, содержащий аминокислотную последовательность RFTISADTSENTAYLQMNELRAEDTAVYYCAR (SEQ ID NO: 31); и (d) FR-H4, содержащий аминокислотную последовательность WGQGELVTVSS (SEQ ID NO: 32).

В некоторых случаях любое из предшествующих анти-VEGF антител может включать один, два, три или четыре из следующих FR вариабельного домена легкой цепи: (a) FR-L1, содержащий аминокислотную последовательность DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 17), DIQMTQSPESLSASVGDEVTITC (SEQ ID NO: 25) или DIQMTQSPSSLSASVGDEVTITC (SEQ ID NO: 26); (b) FR-L2, содержащий аминокислотную последовательность WYQQKPGKAPKLLIY (SEQ ID NO: 18) или WYQQKPGEAPKLLIY (SEQ ID NO: 27); (c) FR-L3, содержащий аминокислотную последовательность GVPSRFSGSGSGTDFTLTISSLQPEDAATYYC (SEQ ID NO: 19), GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 24) или GVPSRFSGSGSGTDFTLTIESLQPEDAATYYC (SEQ ID NO: 28); и (d) FR-L4, содержащий аминокислотную последовательность FGQGTKVEIK (SEQ ID NO: 20).

В некоторых случаях изобретение обеспечивает антитело, содержащее (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 48 и/или (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 50. В некоторых вариантах осуществления изобретения, антитело представляет собой G6.31 AARR, экспрессированное в формате Fab.

В некоторых случаях изобретение обеспечивает антитело, содержащее (а) тяжелую цепь, содержащую аминокислотную последовательность SEQ ID NO: 49 и/или (b) легкую цепь, содержащую аминокислотную последовательность SEQ ID NO: 50. В некоторых вариантах осуществления изобретения, антитело представляет собой вариант версии G6.31 AARR, которая не обладает реакционной способностью к анти-человеческому IgG.

В следующем аспекте анти-VEGF антитело в соответствии с любым из вышеприведенных вариантов осуществления изобретения может включать любой из признаков, отдельно или в комбинации, как описано в разделах 1-8 ниже:

1. Аффинность антител

В некоторых вариантах осуществления изобретения, антитело, представленное в данном документе, имеет константу диссоциации (Kd) ≤ 1 мкМ, ≤ 100 нМ, ≤ 10 нМ, ≤ 1 нМ, ≤ 0,1 нМ, ≤ 0,01 нМ или ≤ 0,001 нМ (например, 10-8 М или менее, например, от 10-8 М до 10-13 М, например от 10-9 М до 10-13 М). Например, в некоторых случаях антитело, представленное в данном документе, связывает VEGF человека (hVEGF) с Kd около 10 нМ или ниже. В некоторых случаях антитело, представленное в данном документе, связывает hVEGF с Kd около 5 нМ или ниже. В некоторых случаях антитело, представленное в данном документе, связывает hVEGF с Kd около 2 нМ или ниже. Например, в некоторых случаях антитело связывает hVEGF с Kd между около 25 пМ и около 2 нМ (например, около 25 пМ, около 50 пМ, около 75 пМ, около 100 пМ, около 125 пМ, около 150 пМ, около 175 пМ, около 200 пМ, около 225 пМ, около 250 пМ, около 275 пМ, около 300 пМ, около 325 пМ, около 350 пМ, около 375 пМ, около 400 пМ, около 425 пМ, около 450 пМ, около 475 пМ, около 500 пМ, около 525 пМ, около 550 пМ, около 575 пМ, около 600 пМ, около 625 пМ, около 650 пМ, около 675 пМ, около 700 пМ, около 725 пМ, около 750 пМ, около 775 пМ, около 800 пМ, около 825 пМ, около 850 пМ, около 875 пМ, около 900 пМ, около 925 пМ, около 950 пМ, около 975 пМ, около 1 нМ, около 1,1 нМ, около 1,2 нМ, около 1,3 нМ, около 1,4 нМ, около 1,5 нМ, около 1,6 нМ, около 1,7 нМ, около 1,8 нМ, около 1,9 нМ или около 2 нМ). В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 600 пМ (например, около 75 пМ, около 100 пМ, около 125 пМ, около 150 пМ, около 175 пМ, около 200 пМ, около 225 пМ, около 250 пМ, около 275 пМ, около 300 пМ, около 325 пМ, около 350 пМ, около 375 пМ, около 400 пМ, около 425 пМ, около 450 пМ, около 475 пМ, около 500 пМ, около 525 пМ, около 550 пM, около 575 пМ, около 600 пМ). В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 500 пМ. В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 400 пМ. В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 300 пМ. В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 200 пМ. В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 150 пМ. В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 125 пМ. В некоторых случаях антитело связывает hVEGF с Kd между около 75 пМ и около 100 пМ. В некоторых случаях антитело связывает hVEGF с Kd около 80 пМ. В некоторых случаях антитело связывает hVEGF с Kd около 60 пМ. В некоторых случаях антитело связывает hVEGF с Kd около 40 пМ.

В одном варианте осуществления изобретения, Kd измеряется с помощью радиоактивно меченного антигенсвязывающего анализа (RIA). В одном варианте осуществления изобретения, RIA выполняют с Fab-версией интересующего антитела и его антигена. Например, аффинность связывания раствора Fab для антигена измеряется путем уравновешивания Fab с минимальной концентрацией (125I)-меченого антигена в присутствии титрованной серии немеченого антигена, а затем захвата связанного антигена чашкой, покрытой анти-Fab антигеном (см., например, Chen et al., J. Mol. Biol. 293:865-881(1999)). Чтобы установить условия для анализа, многолуночные планшеты MICROTITER® (Thermo Scientific) покрывают в течение ночи 5 мкг/мл улавливающего антитела против Fab (Cappel Labs) в 50 мМ карбоната натрия (pH 9,6) и затем блокируют 2 % (масса/объем) бычьего сывороточного альбумина (BSA) в натрий-фосфатном буфере (PBS) в течение двух-пяти часов при комнатной температуре (приблизительно 23°C). В неадсорбирующем планшете (Nunc # 269620), 100 пМ или 26 пМ [125I] -антиген смешивают с серийными разведениями Fab, представляющими интерес (например, в соответствии с оценкой антитела против VEGF, Fab-12, в Presta et al., Cancer Res. 57:4593-4599 (1997)). Затем Fab, представляющий интерес, инкубируют в течение ночи; однако инкубация может продолжаться в течение более длительного периода (например, около 65 часов), чтобы обеспечить достижение равновесия. После этого смеси переносятся на захватывающем планшете для инкубации при комнатной температуре (например, в течение одного часа). Затем раствор удаляют, и планшет промывают восемь раз 0,1 % полисорбатом 20 (TWEEN-20®) в PBS. Когда планшеты высушивают, добавляют 150 мкл/лунку сцинтиллянта (MICROSCINT-20™, Packard) и планшеты подсчитывают на гамма-счетчике TOPCOUNT™ (Packard) в течение десяти минут. Концентрации каждого Fab, которые дают менее чем или равные 20 % максимального связывания, выбирают для использования в анализах конкурентного связывания.

Согласно другому варианту осуществления изобретения, Kd измеряется с использованием анализатора поверхностного плазмонного анализа BIACORE®. Например, анализ с использованием BIACORE®-2000 или BIACORE ®-3000 (BIAcore, Inc., Пискатуэй, Нью-Джерси) проводится при 25°C с помощью иммобилизованных антигенов CM5 в ~10 единицах ответа (RU). В одном варианте осуществления изобретения, карбоксиметилированные чипы биодеструктора декстрана (CM5, BIAcore, Inc.) активируются N-этил-N“-(3-диметиламинопропил)-карбодиимидгидрохлоридом (EDC) и N-гидроксисукцинимидом (NHS) в соответствии с инструкциями поставщика. Антиген разбавляют 10 мМ ацетатом натрия, рН 4,8, до 5 мкг/мл (~ 0,2 мкМ) перед инъекцией со скоростью потока 5 мкл/мин, чтобы получить примерно 10 единиц ответа (RU) связанного белка. После инъекции антигена вводят 1М этаноламин для блокирования непрореагировавших групп. Для кинетических измерений двукратные серийные разведения Fab (0,78 нМ до 500 нМ) инъецируют в PBS с помощью 0,05 % поверхностно-активного вещества полисорбата 20 (TWEEN-20™) (PBST) при 25°С со скоростью потока приблизительно 25 мкл/мин. Скорости ассоциации (kon) и скорости диссоциации (koff) рассчитываются с использованием простой индивидуальной модели привязки Лэнгмюра (BIACORE® Evaluation Software версии 3.2) путем одновременной установки сенсорных диаграмм ассоциации и диссоциации. Константа равновесной диссоциации (Kd) рассчитывается как отношение koff/kon. См., например, Chen et al., J. Mol. Biol. 293:865-881 (1999). Если скорость потока превышает 106 М-1 с-1 методом поверхностного плазмонного резонанса выше, то скорость потока может быть определена с использованием метода флуоресцентного тушения, который измеряет увеличение или уменьшение интенсивности флуоресцентного излучения (возбуждение = 295 нм, эмиссия = 340 нм, полоса пропускания 16 нм) при 25 oC 20 нМ антиантигенного антитела (Fab-форма) в PBS, pH 7,2, в присутствии возрастающих концентраций антигена, измеренных на спектрометре, таких как оборудованный стоп-потоком спектрофотометр (Aviv Instruments) или спектрофотометр SLM-AMINCO™ серии 8000 (ThermoSpectronic) с перемешиваемой кюветой.

2. Стабильность антител

Изобретение обеспечивает антитела с повышенной стабильностью, например, по сравнению с антителом против VEGF, например G6.31 (см., например, Патент США № 7758859 и Публикацию международной заявки № WO 2005/012359, которые включены в настоящее описание посредством ссылки во всей их полноте). Стабильность антитела может быть определена с использованием любого метода, известного в данной области, например, дифференциальной сканирующей флуориметрии (DSF), кругового дихроизма (CD), внутренней флуоресценции белка, дифференциальной сканирующей калориметрии, спектроскопии, светорассеяния (например, динамического рассеяния света (DLS) и статического рассеяния света (SLS), само-взаимодействующей хроматографии (SIC). Антитело против VEGF может иметь, например, повышенную температуру плавления (Tm), температуру агрегации (Tагр) или другие показатели стабильности по сравнению с антителом против VEGF, например G6.31.

В некоторых вариантах осуществления изобретения, антитело, представленное в данном документе, имеет Tm, которое больше чем или равно около 80 °C (например, около 81 °C, около 82 °C, около 83 °C, около 84 °C, около 85 °C, около 86 °С, около 87 °С, около 88 °С, около 89 °С, около 90 °С, около 91 °С, около 92 °С или около 93 °С). Например, в некоторых случаях, антитело против VEGF имеет Tm, которое больше чем или равно около 83,5 °C (например, около 83,5 °C, около 84 °C, около 85 °C, около 86 °C, около 87 °C, около 88 °C, около 89 °C, около 90 °C, около 91 °C, около 92 °C или около 93 °C). В некоторых случаях антитело против VEGF имеет Tm от около 82 до около 92 oC (например, около 82 °C, около 83 °C, около 84 °C, около 85 °C, около 86 °C, около 87 °С, около 88 °С, около 89 °С, около 90 °С, около 91 °С или около 92 °С). В некоторых примерах анти-VEGF антитело имеет Tm около 82 °C. В некоторых случаях любое из предшествующих значений Tm антитела против VEGF определяют с использованием DSF. В некоторых вариантах осуществления изобретения, значение Tm антитела против VEGF определяют, как описано в данном документе, например, в примере 1.

3. Фрагменты антител

В некоторых вариантах осуществления изобретения, антитело, представленное в данном документе, представляет собой фрагмент антитела. Фрагменты антитела включают, но не ограничиваются ими, фрагменты Fab, Fab', Fab-C, Fab'-SH, F(ab')2, Fv и scFv и другие фрагменты, описанные ниже. Для обзора некоторых фрагментов антител см. Hudson et al., Nat. Med. 9:129-134 (2003). Для обзора scFv-фрагментов см., например, Pluckthün, в The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); см. также WO 93/16185; и патенты США № 557894 и 5587458. Для обсуждения фрагментов Fab и F(ab')2, содержащих остатки эпитопов, связывающих рецептор связывания, и имеющих увеличенный период полужизни in vivo, см. патент США № 5660146.

Диатела представляют собой фрагменты антител с двумя антигенсвязывающими сайтами, которые могут быть двухвалентными или биспецифическими. См., например, EP 404097; WO 1993/01161; Hudson et al., Nat. Med. 9:129-134 (2003); и Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Триатела и тетратела также описаны в публикации Hudson et al., Nat. Med. 9:129-134 (2003).

Однодоменные антитела представляют собой фрагменты антител, полностью или частично содержащие вариабельный домен тяжелой цепи или полностью или частично содержащие вариабельный домен легкой цепи антитела. В некоторых вариантах осуществления изобретения, однодоменное антитело представляет собой однодоменное антитело человека (Domantis, Inc., Уолтем, Массачуссетс, см., например, патент США № 6248516 B1).

Фрагменты антител могут быть получены различными способами, включая, но не ограничиваясь ими, протеолитическое переваривание интактного антитела, а также продуцирование рекомбинантными клетками-хозяевами (например, E. coli или фагом), как описано в данном документе.

4. Химерные и гуманизированные антитела

В некоторых вариантах осуществления изобретения, антитело, представленное в данном документе, представляет собой химерное антитело. Некоторые химерные антитела описаны, например, в патенте США № 4816567; и Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984). В одном примере химерное антитело содержит нечеловеческий вариабельный участок (например, вариабельный домен, полученный от мыши, крысы, хомяка, кролика или не человека, например обезьяны) и константный домен человека. В другом примере химерное антитело представляет собой антитело с «классом переключения», в котором класс или подкласс был изменен от класса исходного антитела. Термин "химерные антитела" включает антигенсвязывающие фрагменты таких антител.

В некоторых вариантах реализации химерное антитело является гуманизированным антителом. Как правило, нечеловеческое антитело гуманизируется для снижения иммуногенности у людей, сохраняя при этом специфичность и аффинность родительского нечеловеческого антитела. Как правило, гуманизированное антитело содержит один или более вариабельных доменов, в которых HVR, например CDR (или их части), получают из нечеловеческого антитела, и FR (или их части) получают из последовательностей антител человека. Гуманизированное антитело необязательно также будет содержать по меньшей мере часть константного участка человека. В некоторых вариантах осуществления изобретения, некоторые FR-остатки в гуманизированном антителе замещены соответствующими остатками от нечеловеческого антитела (например, антитело, из которого получены HVR-остатки), например, для восстановления или улучшения специфичности антител или аффинности.

Гуманизированные антитела и способы их получения рассматриваются, например, в Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008), и далее описаны, например, в Riechmann et al., Nature 332: 323-329 (1988); Queen et al., Proc. Nat’l Acad. Sci. USA 86: 10029-10033 (1989); патенты США № 5821337, 7527791, 6982321 и 7087409; Kashmiri et al., Methods 36: 25-34 (2005) (описывающий специфичность, определяющую прививку участка (SDR)); Padlan, Mol. Immunol. 28: 489-498 (1991) (описывающий «изменение поверхности»); Dall'Acqua et al., Methods 36: 43-60 (2005) (описывающий «перемещение FR»); и Osbourn et al., Methods 36: 61-68 (2005) и Klimka et al., Br. J. Cancer, 83: 252-260 (2000) (описывающий подход «подгоняемого отбора» к перемещению FR).

Каркасные участки человека, которые могут быть использованы для гуманизации, включают, но не ограничиваются ими: каркасные участки, выбранные с использованием способа «наилучшего соответствия» (см., например, Sims et al., J. Immunol. 151: 2296 (1993)); каркасные участки, полученные из консенсусной последовательности человеческих антител конкретной подгруппы вариабельных участков легкой или тяжелой цепи (см., например, Carter et al., Proc. Natl. Acad. Sci. США, 89: 4285 (1992); и Presta et al., J. Immunol., 151: 2623 (1993)); человеческие зрелые (соматически мутированные) каркасные участки или каркасные участки зародышевой линии человека (см., например, Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008)); и каркасные участки, полученные из скрининга FR-библиотек (см., например, Baca et al., J. Biol. Chem. 272:10678-10684 (1997) и Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).

5. Антитела человека

В некоторых вариантах реализации изобретения антитело, предлагаемое в настоящем документе, представляет собой антитело человека. Человеческие антитела могут быть получены с использованием различных методов, известных в данной области техники. Антитела человека описаны в общих чертах в van Dijk и van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) и Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).

Человеческие антитела могут быть получены путем введения иммуногена трансгенному животному, которое было модифицировано для получения интактных человеческих антител или интактных антител с вариабельными участками человека в ответ на антигенную стимуляцию.

Такие животные обычно содержат все или часть локусов иммуноглобулинов человека, которые заменяют эндогенные локусы иммуноглобулинов, или которые присутствуют вне хромосом, или интегрируются случайным образом в хромосомы животного. Как правило, у таких трансгенных мышей инактивированы эндогенные локусы иммуноглобулинов. Обзор способов получения антител человека из трансгенных животных см. в Lonberg, Nat. Biotech. 23:1117-1125 (2005). См. также, например, патенты США № 6075181 и 6150584, описывающие технологию XENOMOUSE™; патент США № 5770429, описывающий технологию HUMAB®; патент США № 7041870, описывающий технологию K-M MOUSE®, и публикацию патентной заявки США № US 2007/0061900, описывающую технологию VELOCIMOUSE®). Вариабельные участки человека из интактных антител, продуцируемых такими животными, могут быть дополнительно модифицированы, например, путем комбинирования с другим константным участком человека.

Человеческие антитела также могут быть получены с помощью основанных на гибридоме методах. Описанные клеточные линии человеческой миеломы и мышино-человеческой гетеромиеломы для производства человеческих моноклональных антител. (См., например, Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); и Boerner et al., J. Immunol., 147: 86 (1991).) Антитела человека, полученные посредством технологии на основе B-клеточной гибридомы человека, также описаны в Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Дополнительные способы включают те, которые описаны, например, в патенте США № 7188926 (описывающем получение моноклональных антител человека IgM из клеточных линий гибридомы) и Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (с описанием гибридом человек-человек). Технология на основе гибридомы человека (Trioma technology) также описана в статьях Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) и Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).

Антитела человека также можно получить путем изолирования последовательностей вариабельного домена Fv-клона, выбранных из библиотек фагового дисплея человеческого происхождения. Такие последовательности вариабельного домена затем можно объединять с желаемыми константными доменами человека. Методики отбора антител человека из библиотек антител описаны ниже.

6. Антитела, полученные из библиотек

Антитела согласно настоящему изобретению можно выделить путем скрининга комбинаторных библиотек на предмет антител с желаемой активностью или активностями. Например, в данной области известны различные способы для создания библиотек отображения фагов и скрининга таких библиотек на антитела, обладающие желаемыми характеристиками связывания. Такие методы рассматриваются, например, в Hoogenboom et al., Methods in Molecular Biology 178:1-37 (O'Brien et al., Ed., Human Press, Totowa, NJ, 2001) и далее описаны, например, в McCafferty et al., Nature 348: 552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, NJ, 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); и Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004).

В некоторых методах фагового дисплея, репертуары VH и VL-генов отдельно клонируются полимеразной цепной реакцией (ПЦР) и беспорядочно рекомбинируются в фаговых библиотеках, которые затем могут быть подвергнуты скринингу на антигенсвязывающий фаг, как описано в Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Фаг обычно отображает фрагменты антитела в виде одноцепочечных Fv-фрагментов (scFv) или Fab-фрагментов. Библиотеки из иммунизированных источников обеспечивают высокоаффинные антитела к иммуногену без необходимости создания гибридом. Альтернативно, наивный репертуар может быть клонирован (например, от человека), чтобы обеспечить единый источник антител к широкому спектру несамостоятельных, а также самостоятельных антигенов без какой-либо иммунизации, как описано Griffiths et al., EMBO J, 12: 725-734 (1993). Наконец, наивные библиотеки можно также получить путем синтеза, клонируя сегменты V-генов стволовых клеток, не подвергавшиеся реаранжировке, и используя ПЦР-праймеры, содержащие случайные последовательности, для кодирования гипервариабельного участка CDR3 и осуществления реаранжировки in vitro, как описано в статье Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992). Патентные публикации, в которых описаны фаговые библиотеки антител человека, включают, например: Патент США № 5750373 и публикации патента США № 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936 и 2009/0002360.

Антитела или фрагменты антител, выделенные из библиотек человеческих антител, считаются человеческими антителами или фрагментами человеческого антитела в данном документе.

7. Мультиспецифические антитела

В некоторых вариантах осуществления изобретения, антитело, представленное в данном документе, представляет собой мультиспецифическое антитело, например биспецифическое антитело. Мультиспецифическими антителами являются моноклональные антитела, которые имеют связывающую специфичность по меньшей мере для двух разных сайтов. В некоторых вариантах осуществления изобретения, одна из специфических характеристик связывания представлена для VEGF, а другая для любого другого антигена (например, вторая биологическая молекула, например интерлейкин-1 бета (IL-1β), интерлейкин-6 (IL-6); рецептор интерлейкина-6 (IL-6R), интерлейкин-13 (IL-13), рецептор IL-13 (IL-13R), PDGF (например, PDGF-BB); ангиопоэтин; ангиопоэтин 2 (Ang2), Tie2, S1P, интегрины αvβ3, αvβ5 и α5β1, бетацеллюлин, апелин/APJ; эритропоэтин; фактор комплемента D; TNFα, HtrA1; рецептор VEGF (например, VEGFR1, VEGFR2, VEGFR3, мембран-связанный VEGF-рецептор (mbVEGFR) или растворимый рецептор VEGF (sVEGFR)), рецептор ST-2; и белки, генетически связанные с риском возрастной макулярной дегенерации (AMD), такие как компоненты комплемента пути C2, фактор B, фактор H, CFHR3, C3b, C5, C5a и C3a; HtrA1; ARMS2, TIMP3, HLA, интерлейкин-8 (IL-8), CX3CR1, TLR3, TLR4, CETP, LIPC, COL10A1 и TNFRSF10A. Соответственно, биспецифическое антитело может иметь специфичность связывания для VEGF и IL-1β; VEGF и IL-6; VEGF и IL-6R; VEGF и IL-13; VEGF и IL-13R; VEGF и PDGF (например, PDGF-BB); VEGF и ангиопоэтин; VEGF и Ang2; VEGF и Tie2; VEGF и S1P; VEGF и интегрин αvβ3; VEGF и интегрин αvβ5; VEGF и интегрин α5β1; VEGF и бетацеллюлин; VEGF и апелин/APJ; VEGF и эритропоэтин; VEGF и фактор комплемента D; VEGF и TNFα; VEGF и HtrA1; VEGF и VEGF-рецептор (например, VEGFR1, VEGFR2, VEGFR3, mbVEGFR или sVEGFR); VEGF и ST-2 рецептор; VEGF и C2; VEGF и фактор B; VEGF и фактор H; VEGF и CFHR3; VEGF и C3b; VEGF и C5; VEGF и C5a; VEGF и C3a; VEGF и ARMS2; VEGF и TIMP3; VEGF и HLA; VEGF и IL-8; VEGF и CX3CR1; VEGF и TLR3; VEGF и TLR4; VEGF и CETP; VEGF и LIPC; VEGF и COL10A1; или VEGF и TNFRSF10A. В некоторых вариантах осуществления изобретения, биспецифические антитела могут связываться с двумя различными эпитопами VEGF. Биспецифические антитела также могут быть использованы для локализации цитотоксических агентов в клетках, которые экспрессируют VEGF. Биспецифические антитела могут быть получены как полноразмерные антитела или фрагменты антител (например, Fab, Fab' или Fab-C фрагменты).

В некоторых случаях биспецифическое антитело представляет собой биспецифическое анти-VEGF/анти-ангиопоэтин 2 (Ang2) антитело, описанное в заявке на патент США № US 2014/0017244, которая включена в данный документе путем ссылки во всей ее полноте. Например, биспецифическое анти-VEGF/анти-Ang2 антитело может включать первый связывающий домен, который связывает VEGF (такой как любое из антител против VEGF, описанных в данном документе), и второй связывающий домен, который связывает Ang2, который включает (a) HVR -H1, содержащий аминокислотную последовательность GYYMH (SEQ ID NO: 62); (b) HVR-H2, содержащий аминокислотную последовательность WINPNSGGTNYAQKFQG (SEQ ID NO: 63); (c) HVR-H3, содержащий аминокислотную последовательность SPNPYYYDSSGYYYPGAFDI (SEQ ID NO: 64); (d) HVR-L1, содержащий аминокислотную последовательность GGNNIGSKSVH (SEQ ID NO: 65); (e) HVR-L2, содержащий аминокислотную последовательность DDSDRPS (SEQ ID NO: 66); и (f) HVR-L3, содержащий аминокислотную последовательность QVWDSSSDHWV (SEQ ID NO: 67), или комбинацию одного или более из вышеуказанных HVR и одного или более его вариантов, имеющих по меньшей мере около 80 % идентичности последовательности (например, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности) к любому из SEQ ID NO: 62-67.

В некоторых случаях биспецифическое анти-VEGF/анти-Ang2 антитело может включать первый связывающий домен, который связывает VEGF (такой как любое из анти-VEGF антител, описанных в данном документе), и второй связывающий домен, который связывается с Ang2 и включает(ют) VH-домен, содержащий аминокислотную последовательность, имеющую по меньшей мере 80 % идентичности последовательности (например, 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности последовательности) или последовательности SEQ ID NO: 68; (b) домен VL, содержащий аминокислотную последовательность, имеющую по меньшей мере 80 % идентичности последовательности (например, 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 % или 99 % идентичности последовательности) или последовательности SEQ ID NO: 69; или (c) домен VH, как в (a), и домен VL, как в (b). В некоторых случаях биспецифическое анти-VEGF/анти-Ang2 антитело может включать в себя первый связывающий домен, который связывает VEGF (такой как любое из анти-VEGF антител, описанных в данном документе), и второй связывающий домен, который специфически связывается с Ang2, причем второй связывающий домен представляет собой любой связывающий антитело домен, описанный в публикации международной патентной заявки № WO 2010/069532, который включен в данный документ посредством ссылки в полном объеме, или его вариант.

В других случаях биспецифическое анти-VEGF/анти-Ang2 антитело представляет собой любое биспецифическое анти-VEGF/анти-Ang2 антитело, описанное в публикации международной патентной заявки № WO 2016/073157.

В некоторых случаях биспецифическое антитело представляет собой биспецифическое анти-VEGF/анти-IL-6 антитело. В некоторых случаях биспецифическое анти-VEGF/анти-IL-6 антитело может включать первый связывающий домен, который связывает VEGF (такой как любое из антител против VEGF, описанных в данном документе), и второй связывающий домен, который связывает IL-6. Второй связывающий домен может быть связывающим доменом любого анти-IL-6 антитела, известного в данной области, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890, который включен в данном документе посредством ссылки во всей его полноте), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант.

В некоторых случаях биспецифическое антитело представляет собой биспецифическое анти-VEGF/анти-IL-6R антитело. В некоторых случаях биспецифическое анти-VEGF/анти-IL-6R антитело может включать первый связывающий домен, который связывает VEGF (такой как любое из антител против VEGF, описанных в данном документе), и второй связывающий домен, который связывает IL-6R. Второй связывающий домен может быть связывающим доменом любого анти-IL-6R антитела, известного в данной области, например, тоцилизумаб (ACTEMRA®) (см., например, WO 1992/019579, который включен в данный документ посредством ссылки во всей его полноте) сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

Способы получения мультиспецифических антител включают, но не ограничиваются ими, рекомбинантную ко-экспрессию двух пар тяжелой-легкой цепей иммуноглобулина, имеющих различную специфичность (см. Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829 и Traunecker et al., EMBO J. 10: 3655 (1991)) и сконструированные «выступ-во-впадину» (см., например, патент США № 5731168). Мультиспецифические антитела также могут быть получены с помощью сконструированных электростатических управляющих эффектов для получения Fc-гетеродимерных молекул антител (WO 2009/089004A1); сшивание двух или более антител или фрагментов (см., например, патент США № 4676980 и Brennan et al., Science, 229: 81 (1985)); с использованием лейциновых молний для получения биспецифических антител (см., например, Kostelny et al., J. Immunol., 148 (5): 1547-1553 (1992)); используя технологию «диател» для получения биспецифических фрагментов антител (см., например, Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); и с использованием одноцепочечных димеров Fv (sFv) (см., например, Gruber et al., J. Immunol., 152: 5368 (1994)); и получения триспецифических антител, как описано, например, в Tutt et al., J. Immunol. 147:60 (1991).

В данный документ также включены сконструированные антитела с тремя или более функциональными сайтами связывания антигена, включая «антитела-осминоги» (см., например, US 2006/0025576A1).

Антитело или фрагмент по данному документу также включает «двойнойе действующий FAb» или «DAF», содержащий сайт связывания антигена, который связывается с VEGF, а также с другим, отличным антигеном (см., например, US 2008/0069820).

8. Варианты антител

В некоторых вариантах осуществления изобретения, предлагаются варианты аминокислотных последовательностей (например, варианты антител, включая одно или более изменений аминокислотных остатков) антител, представленных в данном документе. Например, может быть желательным улучшить аффинность связывания и/или другие биологические свойства антитела. Варианты аминокислотных последовательностей антитела можно получить путем внесения соответствующих модификаций в нуклеотидную последовательность, кодирующую антитело, или путем пептидного синтеза. Такие модификации включают, например, делеции из, и/или вставки в, и/или замены остатков в аминокислотных последовательностях антитела. Любая комбинация делеции, вставки и замещения может быть выполнена для достижения конечной конструкции, при условии, что конечная конструкция обладает требуемыми характеристиками, например, связыванием антигена.

Варианты замены, вставки и делеции

В некоторых вариантах осуществления изобретения предлагаются варианты антител, содержащие одну или более аминокислотные замены. Сайты, представляющие интерес для заместительного мутагенеза, включают HVR и FR. Консервативные замены показаны в таблице 1 под заголовком «предпочтительные замены». Более существенные изменения приводятся в таблице 1 под заголовком «иллюстративные замены» и как дополнительно описано ниже в отношении классов боковой цепи аминокислот. Аминокислотные замены могут быть введены в представляющее интерес антитело, а продукты, скринированные для желаемой активности, например, сохраняют/улучшают связывание антигена, уменьшают иммуногенность или улучшают ADCC или CDC.

Таблица 1

Оригинальный
Остаток
Иллюстративные замены Предпочтительные замены
Ala (A) Val; Leu; Ile Val
Arg (R) Lys; Gln; Asn Lys
Asn (N) Gln; His; Asp, Lys; Arg Gln
Asp (D) Glu; Asn Glu
Cys (C) Ser; Ala Ser
Gln (Q) Asn; Glu Asn
Glu (E) Asp; Gln Asp
Gly (G) Ala Ala
His (H) Asn; Gln; Lys; Arg Arg
Ile (I) Leu; Val; Met; Ala; Phe; норлейцин Leu
Leu (L) Норлейцин; Ile; Val; Met; Ala; Phe Ile
Lys (K) Arg; Gln; Asn Arg
Met (M) Leu; Phe; Ile Leu
Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr (Y) Trp; Phe; Thr; Ser Phe
Val (V) Ile; Leu; Met; Phe; Ala; норлейцин Leu

Аминокислоты можно сгруппировать по общим свойствам боковой цепи:

(1) гидрофобные: норлейцин, Met, Ala, Val, Leu, Ile;

(2) нейтральные гидрофильные: Cys, Ser, Thr, Asn, Gln;

(3) кислые: Asp, Glu;

(4) основные: His, Lys, Arg;

(5) остатки, влияющие на ориентацию цепи: Gly, Pro;

(6) ароматические: Trp, Tyr, Phe.

Неконсервативные замены влекут за собой обмен членом одного из этих классов на член другого класса.

Один тип замещающего варианта включает замещение одного или более остатков гипервариабельного участка и/или остатков FR из исходного антитела (например, гуманизированного или человеческого антитела). Как правило, результирующий вариант(ы), выбранный для дальнейшего изучения, будет иметь модификации (например, улучшения) в определенных биологических свойствах (например, повышенная аффинность, повышенная стабильность, повышенная экспрессия, измененный pI и/или пониженная иммуногенность) относительно исходного антитела и/или будут по существу сохранены определенные биологические свойства исходного антитела. Типичным вариантом замещения является аффинно созревшее антитело, которое может быть удобно сгенерировано, например, с использованием методов созревания аффинности основанном на фаговом дисплее, таких как описанные в данном документе. Вкратце, один или более остатков HVR мутируют, а варианты антител отображаются на фаге и подвергаются скринингу на конкретную биологическую активность (например, аффинность связывания).

Изменения (например, замены) могут быть сделаны в HVR, например, для улучшения аффинности антитела. Такие изменения могут быть сделаны в «горячих точках» HVR, то есть в остатках, кодируемых кодонами, которые подвергаются мутации с высокой частотой во время процесса соматического созревания (см., например, Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), и/или остатки, которые контактируют с антигеном, причем полученный вариант VH или VL тестируют на аффинность связывания. Созревание аффинности путем построения и повторного выбора из вторичных библиотек было описано, например, в Hoogenboom et al., Methods in Molecular Biology 178: 1-37 (O'Brien et al., Ed., Human Press, Totowa, NJ, (2001)). В некоторых вариантах осуществления созревания аффинности, различие вводится в вариабельные гены, выбранные для созревания любым из множества способов (например, подверженная ошибкам ПЦР, перетасовка цепей или олигонуклеотид-направленный мутагенез). Затем создается вторичная библиотека. Затем библиотеку подвергают скринингу для идентификации любых вариантов антител с желаемой аффинностью. Другой способ введения разнообразия включает в себя HVR-ориентированные подходы, в которых рандомизированы несколько HVR-остатков (например, 4-6 остатков за раз). HVR-остатки, участвующие в связывании антигена, могут быть специфически идентифицированы, например, с использованием аланин сканирующего мутагенеза или моделирования. CDR-H3 и CDR-L3, в частности, часто нацелены.

В некоторых вариантах осуществления изобретения, замены, вставки или делеции могут происходить в пределах одного или более HVR, пока такие изменения существенно не уменьшают способность антитела связывать антиген. Например, консервативные изменения (например, консервативные замены, как указано в данном документе), которые существенно не уменьшают аффинность связывания, могут быть сделаны в HVR. Такие изменения могут, например, находиться вне антигенсвязывающих остатков в HVR. В некоторых вариантах осуществления вариантов VH и VL последовательностей, представленных выше, каждый HVR либо не изменяется, либо содержит не более одной, двух или трех аминокислотных замен.

В некоторых вариантах осуществления изобретения, замены, вставки или делеции могут происходить в пределах одного или более FR, пока такие изменения существенно не уменьшают способность антитела связывать антиген. Такие изменения могут, например, улучшать аффинность антитела и/или стабильность (например, в соответствии с повышенной температурой плавления).

Полезный способ идентификации остатков или участков антитела, которые могут быть нацелены на мутагенез, называется «аланиновый сканирующий мутагенез», как описано в статье Cunningham and Wells (1989) Science, 244: 1081-1085. В этом способе остаток или группу целевых остатков (например, заряженные остатки, такие как Arg, Asp, His, Lys и Glu) идентифицируют и заменяют нейтральной или отрицательно заряженной аминокислотой (например, аланином или полиаланином), чтобы определить влияет на ли взаимодействие антитела с антигеном. Дальнейшие замены могут быть введены в местах аминокислот, демонстрирующих функциональную чувствительность к исходным заменам. В альтернативном или дополнительном варианте формируют кристаллическую структуру антиген-антитело для идентификации точек контакта между антителом и антигеном. Такие контактные остатки и соседние остатки можно подвергать направленному воздействию или исключать из кандидатов для замены. Варианты можно подвергать скринингу с целью определения наличия у них желаемых свойств.

Вставки в аминокислотную последовательность включают амино- и/или карбоксил-концевые слияния длиной от одного остатка до полипептидов, содержащих сто или более остатков, а также вставки одного или множества аминокислотных остатков внутри последовательности. Примеры концевых вставок включают антитело с N-концевым метионильным остатком. Другие варианты вставки молекулы антитела включают слияние с N- или С-концом антитела с ферментом (например, для ADEPT) или полипептидом, которые увеличивают период полувыведения антитела в сыворотке.

a) Варианты гликозилирования

В некоторых вариантах осуществления изобретения, антитело, предложенное в настоящем документе, модифицируют с целью увеличения или уменьшения степени гликозилирования антитела. Добавление или делецию сайтов гликозилирования в антителе легко осуществить путем модификации аминокислотной последовательности, приводящей к созданию или удалению одного или более сайтов гликозилирования.

Если антитело содержит Fc-участок, то можно модифицировать углевод, присоединенный к ней. Нативные антитела, продуцируемые клетками млекопитающих, обычно включают разветвленный биантеннарный олигосахарид, который обычно присоединен N-связью к Asn297 домена CH2 Fc-участка. См., например, Wright et al., TIBTECH 15: 26-32 (1997). Олигосахарид может включать различные углеводы, например маннозу, N-ацетилглюкозамин (GlcNAc), галактозу и сиаловую кислоту, а также фукозу, прикрепленную к GlcNAc в «стебле» биантеннарной олигосахаридной структуры. В некоторых вариантах осуществления изобретения, модификации олигосахарида в антителе по изобретению могут быть сделаны для создания вариантов антител с некоторыми улучшенными свойствами.

В одном варианте осуществления изобретения, предлагаются варианты антител, имеющие углеводную структуру, которая не содержит фукозу, прикрепленную (прямо или косвенно) к Fc-участку. Например, количество фукозы в таком антителе может составлять от 1 % до 80 %, от 1 % до 65 %, от 5 % до 65 % или от 20 % до 40 %. Количество фукозы определяют путем расчета среднего количества фукозы в углеводной цепи при Asn297 по отношению к сумме всех углеводных структур, присоединенных к Asn 297 (например, сложных гибридных структур с высоким содержанием маннозы), измеренной с помощью MALDI-TOF-масс-спектрометрии, как описано, например, в WO 2008/077546. Asn297 относится к остатку аспарагина, расположенному примерно в положении 297 в Fc-участка (ЕС-нумерация остатков Fc-участков); тем не менее, Asn297 также может быть расположен на расстоянии около ± 3 аминокислот до или после положения 297, то есть между положениями 294 и 300, учитывая незначительные вариации последовательности в антителах. Такие варианты фукозилирования могут иметь улучшенную функцию ADCC. См., например, публикацию патента США № US 2003/0157108; US 2004/0093621. Примеры публикаций, относящихся к вариантам «дефукозилированного» или «фукозо-дефицитного» антитела, включают: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al., J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al., Biotech. Bioeng. 87: 614 (2004). Примерами клеточных линий, способных продуцировать дефукозилированные антитела, являются клетки Lec13 CHO, дефицитные в фукозилировании белка (Ripka et al., Arch. Biochem. Biophys. 249: 533-545 (1986); заявка на патент США № US 2003/0157108 A1, Presta, L; и WO 2004/056312 A1, Adams et al., особенно в примере 11), и нокаутные клеточные линии, такие как ген альфа-1,6-фукозилтрансферазы, FUT8, нокаутные клетки СНО (см., например, Yamane-Ohnuki et al. , Biotech. Bioeng. 87: 614 (2004); Kanda et al., Biotechnol. Bioeng., 94(4):680-688 (2006); и WO2003/085107).

Варианты антител дополнительно представлены разделенными пополам олигосахаридами, например, в которых биантеннарный олигосахарид, присоединенный к Fc-участку антитела, делят пополам с помощью GlcNAc. Такие варианты антител могут иметь уменьшенное фукозилирование и/или улучшенную функцию ADCC. Примеры таких вариантов антител описаны, например, в WO 2003/011878; Патенте США № 6602684; и US 2005/0123546 (Umana et al.). Также предусмотрены варианты антител с по меньшей мере одним галактозным остатком в олигосахариде, присоединенном к Fc-участку. Такие варианты антител могут иметь улучшенную функцию CDC. Такие варианты антител описаны, например, в WO 1997/30087; WO 1998/58964; и WO 1999/22764 (Raju, S.).

b) Варианты Fc-участка

В некоторых вариантах осуществления изобретения, одна или более модификаций аминокислот могут быть введены в Fc-участок антитела, представленного в данном документе, тем самым генерируя вариант Fc-участка. Вариант Fc-участка может содержать последовательность Fc-участка человека (например, Fc-участок IgG1, IgG2, IgG3 или IgG4 человека), содержащую изменение аминокислотного остатка (например, замещение) в одном или более положениях аминокислоты. В некоторых вариантах осуществления, изобретение рассматривает вариант антитела, которое обладает некоторыми, но не всеми эффекторными функциями, которые делают его желательным кандидатом, для применений в которых период полувыведения антитела in vivo является важным, но некоторые эффекторные функции (такие как комплемент и ADCC) не нужны или вредны. Анализы цитотоксичности in vitro и/или in vivo могут проводиться для подтверждения уменьшения/истощения CDC и/или ADCC активности. Например, могут быть проведены анализы связывания Fc-рецептора (FcR), чтобы гарантировать, что антитело не имеет FcγR-связывания (следовательно, вероятно, не имеет активности ADCC), но сохраняет способность FcRn-связывания. Первичные клетки для опосредования ADCC, NK-клетки, экспрессируют только FcγRIII, тогда как моноциты экспрессируют FcγRI, FcγRII и FcγRIII. Экспрессия FcR на гематопоэтических клетках приведена в таблице 3 на стр. 464 Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991).

Неограничивающие примеры анализов in vitro для оценки активности ADCC представляющей интерес молекулы описаны в патенте США № 5500362 (см., например, Hellstrom et al., Proc. Nat’l Acad. Sci. USA 83:7059-7063 (1986) и Hellstrom, I et al., Proc. Nat’l Acad. Sci. USA 82:1499-1502 (1985); патенте США № 5821337; и Bruggemann et al., J. Exp. Med. 166:1351-1361 (1987)). Альтернативно, могут быть использованы способы нерадиоактивного анализа (см., например, анализ нерадиоактивной цитотоксичности ACTI™ для проточной цитометрии (CellTechnology, Inc. Mountain View, Калифорния; и CYTOTOX 96®, не радиоактивный анализ цитотоксичности (Promega, Мэдисон, Висконсин). Полезные эффекторные клетки для таких анализов включают мононуклеарные клетки периферической крови (PBMC) и клетки природных киллеров (NK). Альтернативно или дополнительно, активность ADCC представляющей интерес молекулы может быть оценена in vivo, например, в модели на животных, такой как описанная в Clynes et al., Proc. Nat’l Acad. Sci. USA 95:652-656 (1998). Анализы связывания C1q также могут быть проведены для подтверждения того, что антитело неспособно связывать C1q и, следовательно, не обладает активностью CDC. См., например, C1q и C3c связывание в ИФА в WO 2006/029879 и WO 2005/100402. Для оценки активации комплемента может быть проведен анализ CDC (см., например, Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996); Cragg et al., Blood 101:1045-1052 (2003); и Cragg et al., Blood 103:2738-2743 (2004)). Связывание FcRn и определение in vivo клиренса/полувыведения также могут быть выполнены с использованием методов, известных в данной области (см., например, Petkova et al., Int'l. Immunol. 18(12):1759-1769 (2006)).

Антитела с пониженной эффекторной функцией включают антитела с заменой одного или более остатков 238, 265, 269, 270, 297, 327 и 329 Fc-участка (патент США № 6737056). Такие Fc-мутанты включают Fc-мутантов с заменами в двух или более аминокислотных положениях 265, 269, 270, 297 и 327, включая так называемые Fc-мутанты "DANA" с заменой остатков 265 и 297 на аланин (патент США № 7332581).

Описаны некоторые варианты антител с улучшенным или уменьшенным связыванием с FcR. (См., например, патент США № 6737056; WO 2004/056312 и Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001)).

В некоторых вариантах осуществления изобретения, вариант антитела включает Fc-участок с одной или более аминокислотными заменами, которые улучшают ADCC, например, замещения в положениях 298, 333 и/или 334 Fc-участке (нумерация остатков ЕС).

В некоторых вариантах осуществления изобретения, в Fc-участке происходят изменения, которые приводят к изменению (например, улучшенному или уменьшенному) связывания C1q и/или комплементарной зависимой цитотоксичности (CDC), например, как описано в патенте США № 6195551, WO 99/51642 и Idusogie et al., J. Immunol. 164: 4178-4184 (2000).

Антитела с увеличенным периодом полувыведения и улучшенным связыванием с неонатальным Fc-рецептором (FcRn), который отвечает за передачу IgG матери плоду (Guyer et al., J. Immunol. 117:587 (1976) и Kim et al., J. Immunol. 24:249 (1994)), описаны в US2005/0014934A1 (Hinton et al.). Указанные антитела содержат Fc-участок с одной или более заменами, которые улучшают связывание Fc-участка с FcRn. Такие варианты Fc включают те, у которых есть замены в одном или более остатках Fc-участка: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 или 434, например, замещение Fc-участка остатка 434 (патент США № 7371826). См. также Duncan & Winter, Nature 322: 738-40 (1988); патент США № 5648260; патент США № 5624821; и WO 94/29351 относительно других примеров вариантов Fc-участка.

c) Варианты антител, сконструированных с цистеином

В некоторых вариантах осуществления изобретения, может быть желательно создать цистеин-сконструированные антитела, например, «thioMAbs», в которых один или более остатков антитела замещены остатками цистеина. В конкретных вариантах реализации изобретения, замещенные остатки расположены в доступных сайтах антитела. В результате замещения указанных остатков цистеином в доступных участках антитела располагаются реакционноспособные тиольные группы, которые можно использовать для конъюгирования антитела с другими группами, например, лекарственными веществами или группами "линкер-лекарственное вещество" с получением иммуноконъюгата, как дополнительно описано в настоящем документе. В некоторых вариантах реализации изобретения, можно заменить на цистеин один или более из следующих остатков: V205 (нумерация Кабат) легкой цепи; A118 (нумерация ЕС) тяжелой цепи; и S400 (нумерация ЕС) Fc-участка тяжелой цепи. Цистеин-сконструированные антитела могут быть получены, как описано, например, в патенте США № 7521541.

d) Производные антител

В некоторых вариантах реализации изобретения, антитело, предложенное в настоящем документе, можно дополнительно модифицировать путем введения дополнительных небелковых фрагментов, известных в данной области техники и легко доступных. Группы, подходящие для дериватизации антитела, включают, но не ограничиваются ими, водорастворимые полимеры. Неограничивающие примеры водорастворимых полимеров включают, но не ограничиваются ими, полиэтиленгликоль (ПЭГ), сополимеры этиленгликоля/пропиленгликоля, карбоксиметилцеллюлозы, декстрана, поливинилового спирта, поливинилпирролидона, поли-1, 3-диоксолана, поли-1,3,6-триоксана, сополимер этилена/малеинового ангидрида, полиаминокислоты (гомополимеры или случайные сополимеры) и декстран или поли(н-винилпирролидон)полиэтиленгликоля, гомополимеры пропиленгликоля, сополимеры пролипропиленоксида/этиленоксида, полиоксиэтилированные полиолы (например, глицерин), поливиниловый спирт и их смеси. Пропиональдегид полиэтиленгликоля может иметь преимущества в производстве благодаря его стабильности в воде. Указанный полимер может обладать любой молекулярной массой и быть разветвленным или неразветвленным. Количество полимеров, прикрепленных к антителу, может изменяться, и если к нему прикреплено более одного полимера, они могут быть одинаковыми или разными молекулами. В общем, количество и/или тип полимеров, используемых для дериватизации, могут быть определены на основе соображений, включающих, но не ограничиваясь ими, конкретные свойства или функции улучшаемого антитела, независимо от того, будет ли производное антитела использоваться при терапии в определенных условиях и тому подобное. Дополнительные конъюгаты антител описаны в данном документе, например, в разделе K ниже и в примере 13.

В другом варианте осуществления изобретения, предусмотрены конъюгаты антитела и небелкового фрагмента, которые могут избирательно нагреваться под воздействием радиации.

В одном варианте осуществления изобретения, небелковая часть представляет собой углеродную нанотрубку (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)). Излучение может иметь любую длину волны и включает в себя, но не ограничивается ими, длины волн, которые не вредят обычным клеткам, но которые нагревают небелковую часть до температуры, при которой клетки, проксимальные к антитело-непротеиновой части, погибают.

e) Варианты изоэлектрической точки

Изобретение предлагает варианты антител с измененными изоэлектрическими точками. Например, изобретение относится к вариантам антител с уменьшенной изоэлектрической точкой (pI), например, по сравнению с антителом против VEGF, например G6.31. В некоторых случаях поверхностный заряд снижается при физиологическом рН. В некоторых случаях антитело против VEGF имеет pI, равное или менее чем около 8 (например, около 8, около 7, около 6, около 5 или около 4). В некоторых случаях антитело имеет pI от около 4 до около 8 (например, около 4, около 5, около 6, около 7 или около 8). В некоторых случаях антитело против VEGF имеет pI от около 5 до около 7 (например, около 5, около 6 или около 7). В некоторых случаях антитело против VEGF имеет pI от около 5 до около 6 (например, около 5,1, около 5,2, около 5,3, около 5,4, около 5,5, около 5,6, около 5,7, около 5,8, около 5,9 или около 6).

Антитела по изобретению могут быть сконструированы так, чтобы иметь уменьшенный pI, например, путем замещения аминокислотных остатков дикого типа в данном положении аминокислотой, имеющей более низкий pI. pI аминокислоты можно определить на основе значений pKa амина (-NH2), карбоновой кислоты (-COOH) и аминокислоты с боковой цепью, которые известны в данной области. В некоторых вариантах осуществления изобретения, аминокислотные остатки, экспонированные на поверхности, могут быть замещены для уменьшения pI антитела. В одном варианте осуществления изобретения, экспонированные на поверхности аминокислотные остатки могут быть замещены глутаматом (E). В одном варианте осуществления изобретения, экспонированные на поверхности аминокислотные остатки могут быть замещены аспартатом (E).

B. Рекомбинантные способы и композиции

Любое из антител (например, антитела против VEGF), описанных в данном документе, может быть получено с использованием рекомбинантных способов и композиций, например, как описано в патенте США № 4816567. В одном варианте осуществления изобретения, предоставляется изолированная нуклеиновая кислота, кодирующая антитело против VEGF, описанное в данном документе. Такая нуклеиновая кислота может кодировать аминокислотную последовательность, содержащую VL, и/или аминокислотную последовательность, содержащую VH антитела (например, легкие и/или тяжелые цепи антитела). В следующем варианте осуществления изобретения, предусматривается один или более векторов (например, векторов экспрессии), содержащих такую нуклеиновую кислоту. В следующем варианте осуществления изобретения, предлагается клетка-хозяин, содержащая такую нуклеиновую кислоту. В одном из таких вариантов осуществления изобретения, клетка-хозяин содержит (например, была преобразована с): (1) вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и аминокислотную последовательность, содержащую VH антитела, или (2) первый вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VL антитела, и второй вектор, содержащий нуклеиновую кислоту, которая кодирует аминокислотную последовательность, содержащую VH антитела. В одном варианте осуществления изобретения, клетка-хозяин является эукариотической, например, клеткой яичника китайского хомячка (CHO) или лимфоидной клеткой (например, Y0, NS0, клеткой Sp20). В одном варианте осуществления изобретения, предлагается способ получения антитела против VEGF, причем способ включает культивирование клетки-хозяина, содержащей нуклеиновую кислоту, кодирующую антитело, как указано выше, в условиях, подходящих для экспрессии антитела, и, необязательно, выделение антитела из клетки-хозяина (или среды культивирования клеток-хозяев).

Для рекомбинантного продуцирования антитела против VEGF, нуклеиновую кислоту, кодирующую антитело, например, как описано выше, изолируют и вставляют в один или более векторов для дальнейшего клонирования и/или экспрессии в клетке-хозяине. Такая нуклеиновая кислота может быть легко выделена и секвенирована с использованием обычных процедур (например, с использованием олигонуклеотидных зондов, которые способны специфически связываться с генами, кодирующими тяжелую и легкую цепи антитела).

Подходящие клетки-хозяева для клонирования или экспрессии антитело-кодирующих векторов включают прокариотические или эукариотические клетки, описанные в данном документе. Например, антитела могут быть получены в бактериях, в частности, когда гликозилирование и Fc-эффекторная функция не нужны. Для экспрессии фрагментов антител и полипептидов в бактериях см., например, патенты США № 5648237, 5789199 и 5840523. См. также Charlton, Methods in Molecular Biology, Vol. 248 (BKC Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, описывающую экспрессию фрагментов антител в E.coli. После экспрессии антитело может быть выделено из пасты бактериальных клеток в растворимой фракции и может быть дополнительно очищено.

В дополнение к прокариотам, эукариотические микроорганизмы, такие как нитчатые грибы или дрожжи, являются подходящими клонирующими или экспрессирующими хозяевами для антитело-кодирующих векторов, включая грибы и дрожжевые штаммы, чьи пути гликозилирования могут быть «гуманизированы», что приводит к получению антитела с частично или полностью человеческим шаблоном гликозилирования. См. Gerngross, Nat. Biotech. 22:1409-1414 (2004), и Li et al., Nat. Biotech. 24:210-215 (2006).

Пригодные для экспрессии гликозилированного антитела клетки-хозяева также можно получить из многоклеточных организмов (беспозвоночных и позвоночных). Примеры клеток беспозвоночных включают клетки растений и насекомых. Были идентифицированы многочисленные бакуловирусные штаммы, которые можно использовать в сочетании с клетками насекомых, особенно для трансфекции клеток Spodoptera frugiperda.

Культуры клеток растений также могут быть использованы в качестве хозяев. См., например, патенты США № 5959177, 6040498, 6420548, 7125978 и 6417429 (описывающие технологию PLANTIBODIES™ для производства антител в трансгенных растениях).

Клетки позвоночных могут также использоваться в качестве хозяев. Например, могут быть полезны клеточные линии млекопитающих, которые приспособлены для роста в суспензии. Другими примерами полезных клеточных линий млекопитающих являются линия CV1 почки обезьяны, трансформированная с помощью SV40 (COS-7); линия клеток эмбриональной почки человека (293 или 293 клетки, как описано, например, в Graham et al., J. Gen Virol. 36:59 (1977)); клетки почек детеныша хомяка (BHK); клетки мыши сертоли (клетки TM4, как описано, например, в Mather, Biol. Reprod. 23: 243-251 (1980)); клетки почек обезьяны (CV1); клетки почек африканской зеленой обезьяны (VERO-76); клетки карциномы шейки матки человека (HELA); (MDCK, клетки печени крысы-буйвола (BRL 3A), клетки легких человека (W138), клетки печени человека (Hep G2), опухоль молочной железы мыши (MMT 060562), клетки TRI, как описано, например, в Mather et al., Annals N.Y. Acad Sci. 383: 44-68 (1982); клетки MRC 5; и клетки FS4. Другие полезные клеточные линии клеток млекопитающих включают клетки яичника китайского хомячка (CHO), включая клетки DHFR- CHO (Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980)); и клеточные линии миеломы, такие как Y0, NS0 и Sp2/0. Для обзора определенных линий клеток-хозяев млекопитающих, подходящих для продуцирования антител, см., например, Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (BKC Lo, ed., Humana Press, Totowa, NJ), pp. 255-268 (2003).

C. Анализы

Предложенные в данном документе антитела против VEGF, а также композиции, которые включают антитела против VEGF (например, любое антитело против VEGF, представленное в данном документе), такие как конъюгаты антител, слитые белки и полимерные препараты, могут быть идентифицированы, скринированы или охарактеризованы по их физико-химическим свойствам и/или биологической активности с помощью различных анализов, известных в данной области.

1. Анализы связывания и другие анализы

В одном аспекте антитело по изобретению или конъюгат антитела, слитый белок или его полимерный состав испытывают на его антигенсвязывающую активность, например, с помощью известных методов, таких как ИФА, Вестерн-блот и т. д.

В другом аспекте конкурентные анализы могут быть использованы для идентификации антитела, которое конкурирует с антителом, как описано в данном документе, или конъюгатом антитела, слитым белком или его полимерной композицией для связывания с VEGF. В некоторых вариантах осуществления изобретения, такое конкурирующее антитело связывается с одним и тем же эпитопом (например, линейным или конформационным эпитопом), который связан с антителом, как описано в данном документе. Подробные иллюстративные методы картирования эпитопа, с которым связывается антитело, приведены в Morris (1996) “Epitope Mapping Protocols,” in Methods in Molecular Biology vol. 66 (Humana Press, Тотова, Нью-Джерси).

В иллюстративном конкурентном анализе иммобилизованный VEGF инкубируют в растворе, содержащем первое меченое антитело, которое связывается с VEGF, и второе немеченое антителом, которое тестируется на его способность конкурировать с первым антителом для связывания с VEGF. Второе антитело может присутствовать в супернатанте гибридомы. В качестве контроля иммобилизованный VEGF инкубируют в растворе, содержащем первое меченое антитело, но не второе немеченое антитело. После инкубации в условиях, обеспечивающих связывание первого антитела с VEGF, избыточное несвязанное антитело удаляют и измеряют количество метки, связанной с иммобилизованным VEGF. Если количество метки, связанное с иммобилизованным VEGF, существенно уменьшается в тестируемом образце относительно контрольного образца, то это указывает на то, что второе антитело конкурирует с первым антителом для связывания с VEGF. См. Harlow and Lane (1988). Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).

2. Анализ активности

В одном аспекте предлагаются анализы для идентификации антител против VEGF или конъюгатов антител, слитых белков или их полимерных композиций, имеющих биологическую активность. Биологическая активность может включать, например, связывание с VEGF (например, VEGF в потоке крови) или его пептидным фрагментом либо in vivo, in vitro, или ex vivo. В некоторых вариантах осуществления изобретения, биологическая активность может включать блокирование или нейтрализацию VEGF или предотвращение связывания VEGF с лигандом, например, рецептором, таким как KDR или Flt-1. Также предусмотрены антитела или конъюгаты антител, слитые белки или их полимерные составы, имеющие такую биологическую активность in vivo и/или in vitro. В некоторых вариантах осуществления изобретения, антитело по изобретению или конъюгат антитела, слитый белок или его полимерный состав испытывают на такую биологическую активность.

Анализы стабильности

В одном аспекте представлены анализы для определения стабильности (например, термостабильности) антитела против VEGF, или конъюгата антитела, слитого белка или его полимерной композиции. Например, стабильность антитела или конъюгата антитела, слитого белка или его полимерного состава может быть определена с использованием любого метода, известного в данной области техники, например, дифференциальной сканирующей флуориметрией (DSF), круговым дихроизмом (CD), внутренней флуоресценцей белка, дифференциальной сканирующей калориметрией, спектроскопией, светорассеянием (например, динамическим рассеянием света (DLS) и статическим рассеянием света (SLS), само-взаимодействующей хроматографией (SIC). Стабильность анализа может быть определена, как описано в данном документе, например, используя DSF, как описано, например, в примерах 1 и 2.

D. Иммуноконъюгаты

Изобретение также относится к иммуноконъюгатам, содержащим антитело против VEGF, конъюгированное с одним или более цитотоксическими агентами, такими как химиотерапевтические агенты или лекарственные средства, ингибирующие рост агенты, токсины (например, белковые токсины, ферментативно активные токсины бактериального, грибного, растительного или животного происхождение или их фрагменты) или радиоактивные изотопы.

В одном варианте осуществления изобретения, иммуноконъюгат представляет собой конъюгат антитело-лекарственное средство (ADC), в котором антитело конъюгировано с одним или более лекарственными средствами, включая, но не ограничиваясь ими, майтансиноид (см. патенты США № 5208020, 5416064 и европейский патент EP 0 425 235 В1); ауристатин, такой как фрагменты DE и DF лекарственного средства монометилауристатина (MMAE и MMAF) (см. патенты США № 5635483, 5780588 и 7498298); доластатин; калихеамицин или его производное (см. патенты США № 5712374, 5714586, 5739116, 5767285, 5770701, 5770710, 5773001 и 5877296; Hinman et al., Cancer Res. 53:3336-3342 (1993); и Lode et al., Cancer Res. 58: 2925-2928 (1998)); антрациклин, такой как дауномицин или доксорубицин (см. Kratz et al., Current Med. Chem. 13:477-523 (2006); Jeffrey et al., Bioorganic & Med. Chem. Letters 16:358-362 (2006); Torgov et al., Bioconj. Chem. 16:717-721 (2005); Nagy et al., Proc. Natl. Acad. Sci. USA 97:829-834 (2000); Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532 (2002); King et al., J. Med. Chem. 45: 4336-4343 (2002); и патент США № 6630579); метотрексат; виндезин; таксан, такой как доцетаксел, паклитаксел, ларотаксел, тезетаксел и ортатаксел; трихотецен; и CC1065.

В другом варианте осуществления изобретения, иммуноконъюгат содержит антитело, как описано в данном документе, конъюгированное с ферментативно активным токсином или его фрагментом, включая, но не ограничиваясь ими, А цепь дифтерии, не связывающие активные фрагменты дифтерийного токсина, А цепь экзотоксина (от Pseudomonas aeruginosa), А цепь рицина, А цепь абрина, А цепь модекцина, альфа-сарцин, белки Aleurites fordii, белки диантина, белки Phytolaca americana (PAPI, PAPII и PAP-S), ингибитор момордика харантская, курцин, кротин, ингибитор sapaonaria officinalis, гелонин, митогеллин, рестриктоцин, феномицин, эномицин и трикотецены.

В другом варианте осуществления изобретения, иммуноконъюгат содержит антитело, как описано в данном документе, конъюгированное с радиоактивным атомом с образованием радиоконъюгата. Для производства радиоконъюгатов имеется множество радиоактивных изотопов. Примеры включают At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 и радиоактивные изотопы Lu. Когда радиоконъюгат используется для обнаружения, он может содержать радиоактивный атом для сцинтиграфических исследований, например tc99m или I123, или метку спина для получения изображения ядерного магнитного резонанса (ЯМР) (также известную как магнитно-резонансная томография, МРТ), такой как йод-123 снова, йод-131, индий-111, фтор-19, углерод-13, азот-15, кислород-17, гадолиний, марганец или железо.

Конъюгаты антитела и цитотоксического агента могут быть получены с применением множества бифункциональных, связывающих белок агентов, таких как N-сукцинимидил-3-(2-пиридилдитио) пропионат (SPDP), сукцинимидил-4-(N-малеимидометил) циклогексан-1-карбоксилат (SMCC), иминотиолан (IT), бифункциональные производные имидоэфиров (такие как диметиладипимидат HCl), активные сложные эфиры (такие как дисукцинимидил суберат), альдегиды (такие как глутаровый альдегид), бис-азидосоединения (такие как бис(п-азидобензоил) гександиамин), производные бис-диазония (такие как бис-(п-диазонийбензоил)-этилендиамин), диизоцианаты (такие как толуол-2,6-диизоцианат) и бис-активные соединения фтора (такие как 1,5-дифтор-2, 4-динитробензол). Например, иммунотоксин рицина может быть получен, как описано в Vitetta et al., Science 238: 1098 (1987). Углерод-14-меченная 1-изотиоцианатобензил-3-метилдиэтилентриаминпентауксусная кислота (MX-DTPA) представляет собой иллюстративный хелатирующий агент для конъюгации радионуклеотида с антителом. См. WO94/11026. Линкер может представлять собой "отщепляемый линкер", облегчающий высвобождение цитотоксического лекарственного вещества в клетке. Например, можно использовать кислоточувствительный линкер, пептидазочувствительный линкер, фоточувствительный линкер, диметильный линкер или дисульфид-содержащий линкер (Chari et al., Cancer Res. 52: 127-131 (1992); Патент США № 5208020).

Иммуноконъюгаты или ADC явно рассматривают в данном документе, но не ограничиваются ими, такие конъюгаты, полученные с помощью сшивающих реагентов, включая, но не ограничиваясь ими, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, сульфо-EMCS, сульфо-GMBS, сульфо-KMUS, сульфо-MBS, сульфо-SIAB, сульфо-SMCC и сульфо-SMPB и SVSB (сукцинимидил-(4-винилсульфон) бензоат), которые являются коммерчески доступными (например, от Pierce Biotechnology, Inc., Рокфорд, Иллинойс, США).

E. Способы и композиции для очистки, диагностики и обнаружения аффинности

Антитела по изобретению могут быть использованы в качестве агентов аффинной очистки. В этом процессе антитела иммобилизуют на твердой фазе, такой как смола SEPHADEX® или фильтровальная бумага, с использованием способов, хорошо известных в данной области техники. Иммобилизованное антитело контактирует с образцом, содержащим антиген, подлежащий очистке, и после этого носитель промывают подходящим растворителем, который удаляет по существу весь материал в образце, за исключением очищаемого антигена, который связан с иммобилизованным антителом. Наконец, носитель промывают другим подходящим растворителем, таким как глициновый буфер, рН 5,0, который высвобождает антиген из антитела.

В некоторых вариантах осуществления изобретения, любое из антител против VEGF, представленных в данном документе, полезно для обнаружения присутствия VEGF в биологическом образце. Используемый в данном документе термин «обнаружение» охватывает количественное или качественное обнаружение. В некоторых вариантах осуществления изобретения, биологический образец содержит клетку или ткань, такую как кровь (например, цельная кровь, плазма и/или сыворотка), образцы тканей (например, образцы опухолей) и тому подобное.

В одном варианте осуществления изобретения, предлагается анти-VEGF антитело для использования в способе диагностики или обнаружения. В еще одном аспекте представлен способ обнаружения присутствия VEGF в биологическом образце. В некоторых вариантах осуществления изобретения, способ включает контактирование биологического образца с антителом против VEGF, как описано в данном документе, в условиях, разрешающих связывание антитела против VEGF с VEGF, и определение того, образуется ли комплекс между антителом против VEGF и VEGF. Такой способ может быть способом in vitro или in vivo. В одном варианте осуществления изобретения, антитело против VEGF используют для отбора субъектов, подходящих для терапии антителом против VEGF, например, где VEGF представляет собой биомаркер для отбора пациентов.

Иллюстративные расстройства, которые могут быть диагностированы с использованием антитела по изобретению, включают нарушения, связанные с патологическим ангиогенезом (например, окулярные нарушения и клеточные пролиферативные нарушения) и/или нарушения, связанные с нежелательной проницаемостью сосудов (например, отек, связанный с опухолями головного мозга, асцит, связанный со злокачественными новообразованиями, синдром Мейга, воспаление легких, нефротический синдром, перикардиальный выпот, плевральный выпот и проницаемость, связанные с сердечно-сосудистыми заболеваниями). В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD, сухая AMD, промежуточная AMD, прогрессирующая AMD или географическая атрофия (GA)), дегенерацию желтого пятна, отек макулы, DME (например, фокальный, нецентральный DME или диффузный, связанный с центром DME), ретинопатию, диабетическую ретинопатию (DR) (например, пролиферативную DR (PDR), непролиферативную DR (NPDR) или высотную DR), другие связанные с ишемией ретинопатии, ROP, окклюзию вены сетчатки (RVO) (например, центральную (CRVO) и разветвленную (BRVO) формы), CNV (например, миопическую CNV), неоваскуляризацию роговицы, заболевания, связанные с неоваскуляризацией роговицы, неоваскуляризацию сетчатки, заболевания, связанные с ретинальной/хориоидальной неоваскуляризацией, патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, FEVR, болезнь Коутса, болезнь Норри, OPPG, субконъюнктивальное кровоизлияние, рубеоз, неоваскулярное заболевание глаз, неоваскулярную глаукому, пигментный ретинит (RP), гипертоническую ретинопатию, ангиоматозную пролиферацию сетчатки, макулярную телеангиэктазию, неоваскуляризацию зрачка, внутриглазную неоваскуляризацию, дегенерацию сетчатки, цистоидный макулярный отек (CME), васкулит, папилломедому, ретинит, конъюнктивит (например, инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит, амавроз Лебера (также известный как врожденный амавроз Лебера или LCA), увеит (включая инфекционный и неинфекционный увеит), хориоидит (например, многофокальный хориоидит), глазной гистоплазмоз, блефарит, сухость глаз, травматическое повреждение глаз, болезнь Шёгрена. В некоторых случаях окулярное расстройство представляет собой ретинопатию, включающую пролиферативную диабетическую ретинопатию, хориоидальную неоваскуляризацию (CNV), возрастную дегенерацию желтого пятна (AMD), диабетическую и другие связанные с ишемией ретинопатии, диабетический макулярный отек (DME), патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, окклюзию вены сетчатки (включая центральные (CRVO) и разветвленные (BRVO) формы), неоваскуляризацию роговицы, неоваскуляризацию сетчатки, ретинопатию недоношенных (ROP), семейную экссудативную витреоретинопатиб (FEVR), болезнь Коутса, болезнь Норри, синдром остеопороза-псевдоглиомы (OPPG), субконъюнктивальное кровоизлияние или гипертоническую ретинопатию. В некоторых случаях клеточное пролиферативное расстройство представляет собой рак. В некоторых случаях, рак представляет собой рак молочной железы, рак толстой кишки, немелкоклеточный рак легкого, неходжкинскую лимфому (НХЛ), рак почки, рак предстательной железы, рак печени, рак головы и шеи, меланому, рак яичников, мезотелиому или множественную миелому.

В некоторых вариантах осуществления изобретения, представлены меченые антитела против VEGF. Эти метки включают, но не ограничиваются ими, метки или фрагменты, которые обнаруживаются непосредственно (например, флуоресцентные, хромофорные, электронно-плотные, хемилюминесцентные и радиоактивные метки), а также фрагменты, такие как ферменты или лиганды, которые обнаруживаются косвенно, например, посредством ферментативной реакции или взаимодействия молекул. Иллюстративные метки включают, но не ограничиваются ими, радиоизотопы 32P, 14C, 125I, 3H и 131I, флуорофоры, такие как редкоземельные хелаты или флуоресцеин, и его производные, родамин и его производные, дансил, умбеллиферон, люцериферазы, например, люцифераза светлячков и бактериальная люцифераза (патент США № 4737456), люциферин, 2,3-дигидрофталазиндионы, пероксидаза хрена (HRP), щелочная фосфатаза, β-галактозидаза, глюкоамилаза, лизоцим, сахаридные оксидазы, например, глюкозооксидазу, галактозооксидазу и глюкозо-6-фосфатдегидрогеназу, гетероциклические оксидазы, такие как уриказа и ксантиноксидаза, в сочетании с ферментом, который использует пероксид водорода для окисления предшественника красителя, такого как HRP, лактопероксидазу или микропероксидаза, биотин/авидин, спиновые метки, метки бактериофага, стабильные свободные радикалы, и тому подобное.

В другом варианте осуществления изобретения антитело необходимо метить, и его присутствие может быть обнаружено с использованием меченого антитела, которое связывается с антителом.

Антитела по настоящему изобретению могут быть использованы в любом известном аналитическом методе, таком как анализы конкурентного связывания, прямые и косвенные сэндвич-анализы и анализы иммунопреципитации. Zola, Monoclonal Antibodies: A Manual of Techniques, pp.147-158 (CRC Press, Inc. 1987).

Анализы конкурентного связывания полагаются на способность стандарта мечения конкурировать с анализом тестового образца для связывания с ограниченным количеством антител. Количество антигена в тестируемом образце обратно пропорционально количеству стандарта, которое становится связанным с антителами. Чтобы облегчить определение количества стандарта, который становится связанным, антитела обычно нерастворимые до или после конкуренции, так что стандарт и анализ, который связывается с антителами, могут быть удобно отделены от стандарта, и проанализированы, те которые остаются несвязанными.

Сэндвич-анализы включают использование двух антител, каждое из которых способно связываться с другой иммуногенной частью или эпитопом белка, который должен быть обнаружен. В сэндвич-анализе тестируемый образец анализируемого вещества связывается первым антителом, которое иммобилизуется на твердой подложке, и после этого второе антитело связывается с анализируемым веществом, образуя, таким образом, нерастворимый комплекс из трех частей. См., например, патент США № 4376110. Второе антитело само может быть помечено детектируемой частью (прямым сэндвич-анализом) или может быть измерено с использованием антитела против иммуноглобулина, которое помечено детектируемой частью (косвенный сэндвич-анализ). Например, один тип сэндвич-анализа представляет собой анализ ИФА, и в этом случае детектируемая часть представляет собой фермент.

Для иммуногистохимии образец опухоли может быть свежим или замороженным или может быть заключен в парафин и зафиксирован, консервантом, например, таким как формалин.

Антитела также могут быть использованы для диагностических тестов in vivo. Как правило, антитело маркируется радионуклидом (таким как 111In, 99Tc, 14C, 131I, 125I, 3H, 32P или 35S) или красителем, так что опухоль может быть локализована с использованием иммуносцинтиографии.

Диагностические наборы

В целях удобства антитело по настоящему изобретению может быть предоставлено в наборе, то есть упакованной комбинации реагентов в заранее определенных количествах с инструкциями для проведения диагностического анализа. Если антитело помечено ферментом, в набор входят субстраты и кофакторы, требуемые ферментом (например, предшественник субстрата, который обеспечивает детектируемый хромофор или флуорофор). Кроме того, могут быть включены другие добавки, такие как стабилизаторы, буферы (например, блок-буфер или буфер для лизиса) и тому подобное. Относительные количества различных реагентов могут широко варьироваться, чтобы обеспечить концентрации в растворе реагентов, которые существенно оптимизируют чувствительность анализа. В частности, реагенты могут быть представлены в виде сухих порошков, обычно лиофилизированных, включая эксципиенты, которые при растворении обеспечивают раствор реагента, имеющий соответствующую концентрацию.

F. Фармацевтические составы

Фармацевтические составы антитела против VEGF, как описано в данном документе, или конъюгат антитела, слитый белок или его полимерный состав, получают путем смешивания такого антитела, имеющего желаемую степень чистоты, с одним или более необязательными, фармацевтически приемлемыми носителями (Remington's Pharmaceutical Sciences, 16-е издание, Osol, A. Ed. (1980)) в форме лиофилизированных составов или водных растворов. Фармацевтически приемлемые носители, как правило, нетоксичны для реципиентов при используемых дозах и концентрациях и включают, но не ограничиваются ими: буферы, такие как фосфат, цитрат и другие органические кислоты; антиоксиданты, включая аскорбиновую кислоту и метионин; консерванты (такие как октадецилдиметилбензиламмонийхлорид, хлорид гексаметония, хлорид бензалкония, хлорид бензетония, фенол, бутил или бензиловый спирт, алкилпарабены, такие как метил или пропилпарабен, катехол, резорцин, циклогексанол, 3-пентанол и м-крезол); низкомолекулярные (менее чем около 10 остатков) полипептиды; белки, такие как сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; аминокислоты, такие как глицин, глутамин, аспарагин, гистидин, аргинин или лизин; моносахариды, дисахариды и другие углеводы, включая глюкозу, маннозу или декстрины; хелатирующие агенты, такие как ЭДТА; сахара, такие как сахароза, маннит, трегалоза или сорбит; солеобразующие противоионы, такие как натрий; комплексы металлов (например, Zn-белковые комплексы); и/или неионные поверхностно-активные вещества, такие как полиэтиленгликоль (ПЭГ). Примеры фармацевтически приемлемых носителей в данном документе также включают инстерстициальные лекарственные дисперсионные агенты, такие как растворимые нейтрально-активные гиалуронидазные гликопротеины (sHASEGP), например, человеческие растворимые гликопротеины PH-20 гиалуронидазы, такие как rHuPH20 (HYLENEX®, Baxter International, Inc.). Некоторые иллюстративные sHASEGP и способы использования, включая rHuPH20, описаны в публикациях патента США № 2005/0260186 и 2006/0104968. В одном из аспектов sHASEGP объединяют с одним или более дополнительными гликозаминогликаназами, например, хондроитиназами.

Типичные лиофилизированные составы антител описаны в патенте США № 6267958. Водные составы антител включают композиции, описанные в патентах США № 6171586 и WO2006/044908, причем последние составы включают гистидин-ацетатный буфер.

Состав по настоящему изобретению также может содержать более одного активного соединения, если необходимо для конкретного показания, подвергаемого лечению, предпочтительно тех, которые имеют дополнительные активности, которые не оказывают неблагоприятного воздействия друг на друга. Например, может быть желательно дополнительно обеспечить иммуносупрессивный агент. Такие молекулы подходящим образом присутствуют в комбинации в количествах, эффективных для намеченной цели.

Активные ингредиенты могут быть захвачены в микрокапсулы, полученные, например, методами коацервации или межфазной полимеризацией, например, гидроксиметилцеллюлозой или желатиновыми микрокапсулами и поли-(метилметакрилатными) микрокапсулами соответственно в коллоидных системах доставки лекарств (например, липосомы, микросферыы альбумина, микроэмульсии, наночастицы и нанокапсулы) или в макроэмульсиях. Такие методы описаны в Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).

Составы, используемые для in vivo-введения, обычно являются стерильными. Стерильность может быть легко достигнута, например, путем фильтрации через стерильные фильтрующие мембраны.

В некоторых вариантах осуществления изобретения, фармацевтический состав включает одно или более дополнительных соединений. В некоторых вариантах осуществления изобретения, дополнительное соединение связывается со второй биологической молекулой, выбранной из группы, состоящей из IL-1β, IL-6; IL-6R; IL-13; IL-13R; PDGF; ангиопоэтин; ангиопоэтин 2; Tie-2; S1P; интегрины αvβ3, αvβ5 и α5β1; бетацеллюлин; апелин/APJ; эритропоэтин; фактор комплемента D; TNF-alpha; HTRA1; рецептор VEGF; рецептор ST-2; и белки, генетически связанные с возрастной макулярной дегенерацией (AMD), такие как компоненты комплемента пути C2, фактор B, фактор H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, дополнительное соединение представляет собой антитело или его антигенсвязывающий фрагмент.

Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157.

В другом примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант.

В еще одном дополнительном примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6R, например, токилизумаб (ACTEMRA®) (см., например, WO 1992/019579), сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

G. Терапевтические способы и композиции

Любые антитела против VEGF, конъюгаты антител (например, конъюгаты HA, конъюгаты ПЭГ и конъюгаты пролекарственных антител), слитые белки и полимерные составы, представленные в данных документах, могут быть использованы в терапевтических способах.

В одном аспекте обеспечивается антитело против VEGF для использования в качестве лекарственного средства. В другом аспекте предлагается конъюгат антитела для использования в качестве лекарственного средства. В еще одном аспекте обеспечивается слитый белок для использования в качестве лекарственного средства. В еще одном аспекте предлагается полимерная композиция для использования в качестве лекарственного средства. В других аспектах изобретение обеспечивает антитело против VEGF для использования при лечении расстройства, связанного с патологическим ангиогенезом. В другом аспекте изобретение обеспечивает конъюгат антитела для использования при лечении расстройства, связанного с патологическим ангиогенезом. В других аспектах изобретение обеспечивает слитый белок для использования при лечении расстройства, связанного с патологическим ангиогенезом. В других аспектах изобретение обеспечивает полимерную композицию для использования при лечении расстройства, связанного с патологическим ангиогенезом. В некоторых вариантах осуществления изобретения, расстройство, связанное с патологическим ангиогенезом, представляет собой окулярное расстройство или клеточное пролиферативное расстройство. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD, сухая AMD, промежуточная AMD, прогрессирующая AMD или географическая атрофия (GA)), дегенерацию желтого пятна, отек макулы, DME (например, фокальный, нецентральный DME или диффузный, связанный с центром DME), ретинопатию, диабетическую ретинопатию (DR) (например, пролиферативную DR (PDR), непролиферативную DR (NPDR) или высотную DR), другие связанные с ишемией ретинопатии, ROP, окклюзию вены сетчатки (RVO) (например, центральную (CRVO) и разветвленную (BRVO) формы), CNV (например, миопическую CNV), неоваскуляризацию роговицы, заболевания, связанные с неоваскуляризацией роговицы, неоваскуляризацию сетчатки, заболевания, связанные с ретинальной/хориоидальной неоваскуляризацией, патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, FEVR, болезнь Коутса, болезнь Норри, OPPG, субконъюнктивальное кровоизлияние, рубеоз, неоваскулярное заболевание глаз, неоваскулярную глаукому, пигментный ретинит (RP), гипертоническую ретинопатию, ангиоматозную пролиферацию сетчатки, макулярную телеангиэктазию, неоваскуляризацию зрачка, внутриглазную неоваскуляризацию, дегенерацию сетчатки, цистоидный макулярный отек (CME), васкулит, папилломедому, ретинит, конъюнктивит (например, инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит, амавроз Лебера, увеит (включая инфекционный и неинфекционный увеит), хориоидит (например, многофокальный хориоидит), глазной гистоплазмоз, блефарит, сухость глаз, травматическое повреждение глаз, болезнь Шёгрена. В некоторых случаях клеточное пролиферативное расстройство представляет собой рак. В некоторых случаях, рак представляет собой рак молочной железы, рак толстой кишки, немелкоклеточный рак легкого, неходжкинскую лимфому (НХЛ), рак почки, рак предстательной железы, рак печени, рак головы и шеи, меланому, рак яичников, мезотелиому или множественную миелому. В другом аспекте предлагается анти-VEGF антитело для использования при лечении расстройства, связанного с нежелательной проницаемостью сосудов. В некоторых случаях, расстройство, связанное с нежелательной проницаемостью сосудов, является отеком, связанным с опухолями головного мозга, асцитом, ассоциированным со злокачественными новообразованиями, синдромом Мейга, воспалением легких, нефротическим синдромом, перикардиальным выпотом, плевральным выпотом, или проницаемостью, связанной с сердечно-сосудистыми заболеваниями.

В другом аспекте предлагается антитело против VEGF для использования в способе лечения. В другом аспекте предлагается конъюгат антитела для использования в способе лечения. В еще одном аспекте обеспечивается слитый белок для использования в способе лечения. В еще одном аспекте предлагается полимерная композиция для использования в способе лечения. В некоторых случаях изобретение обеспечивает антитело против VEGF для использования в способе лечения субъекта, имеющего расстройство, связанное с патологическим ангиогенезом, включающий введение индивидууму эффективного количества антитела против VEGF. Изобретение также обеспечивает конъюгат антитела для использования в способе лечения субъекта, имеющего расстройство, связанное с патологическим ангиогенезом, включающий введение индивидууму эффективного количества конъюгата антитела. Изобретение также обеспечивает слитый белок для использования в способе лечения субъекта, имеющего расстройство, связанное с патологическим ангиогенезом, включающий введение индивидууму эффективного количества слитого белка. Изобретение также обеспечивает полимерный состав для использования в способе лечения субъекта, имеющего расстройство, связанное с патологическим ангиогенезом, включающий введение индивидууму эффективного количества полимерного состава. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD, сухая AMD, промежуточная AMD, прогрессирующая AMD или географическая атрофия (GA)), дегенерацию желтого пятна, отек макулы, DME (например, фокальный, нецентральный DME или диффузный, связанный с центром DME), ретинопатию, диабетическую ретинопатию (DR) (например, пролиферативную DR (PDR), непролиферативную DR (NPDR) или высотную DR), другие связанные с ишемией ретинопатии, ROP, окклюзию вены сетчатки (RVO) (например, центральную (CRVO) и разветвленную (BRVO) формы), CNV (например, миопическую CNV), неоваскуляризацию роговицы, заболевания, связанные с неоваскуляризацией роговицы, неоваскуляризацию сетчатки, заболевания, связанные с ретинальной/хориоидальной неоваскуляризацией, патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, FEVR, болезнь Коутса, болезнь Норри, OPPG, субконъюнктивальное кровоизлияние, рубеоз, неоваскулярное заболевание глаз, неоваскулярную глаукому, пигментный ретинит (RP), гипертоническую ретинопатию, ангиоматозную пролиферацию сетчатки, макулярную телеангиэктазию, неоваскуляризацию зрачка, внутриглазную неоваскуляризацию, дегенерацию сетчатки, цистоидный макулярный отек (CME), васкулит, папилломедому, ретинит, конъюнктивит (например, инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит, амавроз Лебера, увеит (включая инфекционный и неинфекционный увеит), хориоидит (например, многофокальный хориоидит), глазной гистоплазмоз, блефарит, сухость глаз, травматическое повреждение глаз, болезнь Шёгрена. В некоторых случаях клеточное пролиферативное расстройство представляет собой рак. В некоторых случаях, рак представляет собой рак молочной железы, рак толстой кишки, немелкоклеточный рак легкого, неходжкинскую лимфому (НХЛ), рак почки, рак предстательной железы, рак печени, рак головы и шеи, меланому, рак яичников, мезотелиому или множественную миелому.

В других случаях изобретение обеспечивает антитело против VEGF для использования в способе лечения индивидуума, имеющего расстройство, связанное с нежелательной проницаемостью сосудов. В некоторых случаях, расстройство, связанное с нежелательной проницаемостью сосудов, является отеком, связанным с опухолями головного мозга, асцитом, ассоциированным со злокачественными новообразованиями, синдромом Мейга, воспалением легких, нефротическим синдромом, перикардиальным выпотом, плевральным выпотом, или проницаемостью, связанной с сердечно-сосудистыми заболеваниями. Любое из предшествующих применений может дополнительно включать введение индивидууму эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже.

В некоторых случаях изобретение обеспечивает антитело против VEGF для использования в снижении или ингибировании ангиогенеза у субъекта. В другом аспекте представлен конъюгат антитела для использования в восстановлении или ингибировании ангиогенеза у субъекта. В еще одном аспекте обеспечивается слитый белок для использования в снижении или ингибировании ангиогенеза у субъекта. В еще одном аспекте предлагается полимерный состав для использования в снижении или ингибировании ангиогенеза у субъекта. В некоторых вариантах осуществления изобретение обеспечивает антитело против VEGF для использования в способе снижения или ингибирования ангиогенеза у субъекта, включающего введение индивидууму эффективного анти-VEGF антитела для ослабления или ингибирования ангиогенеза. Изобретение также обеспечивает конъюгат антитела для использования в способе снижения или ингибирования ангиогенеза у субъекта, включающем введение индивидууму эффективного количества конъюгата антитела. Изобретение также обеспечивает слитый белок для использования в способе снижения или ингибирования ангиогенеза у субъекта, включающем введение индивидууму эффективного количества слитого белка. Изобретение также обеспечивает полимерный состав для использования в способе снижения или ингибирования ангиогенеза у субъекта, включающего введение индивидууму эффективного количества полимерного состава. В других случаях изобретение обеспечивает антитело против VEGF для использования в снижении или ингибировании проницаемости сосудов у субъекта. В некоторых вариантах осуществления изобретение обеспечивает антитело против VEGF для использования в снижении или ингибировании сосудистой проницаемости у субъекта, включающее введение индивидууму эффективного анти-VEGF антитела для снижения или ингибирования проницаемости сосудов. «Субъект» в соответствии с любым из вышеуказанных способо использования может быть человеком.

В некоторых случаях изобретение обеспечивает антитело против VEGF для использования при лечении аутоиммунного заболевания у субъекта. В некоторых случаях аутоиммунным расстройством является ревматоидный артрит, анкилозирующий спондилоартрит, псориатический артрит и болезнь Крона. Любое из предшествующих применений может дополнительно включать введение индивидууму эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже.

Изобретение относится к применению антитела против VEGF при изготовлении или приготовлении лекарственного средства. Изобретение также предусматривает использование конъюгата антитела при изготовлении или приготовлении лекарственного средства. Кроме того, изобретение предусматривает использование слитого белка при изготовлении или приготовлении лекарственного средства. Изобретение также относится к применению полимерного состава при изготовлении или приготовлении лекарственного средства. Например, в одном случае лекарственное средство предназначено для лечения расстройства, связанного с патологическим ангиогенезом. В другом случае лекарственное средство предназначено для использования в способе лечения расстройства, связанного с патологическим ангиогенезом, включающем введение субъекту, имеющему расстройство, связанное с патологическим ангиогенезом, эффективное количество лекарственного средства. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD, сухая AMD, промежуточная AMD, прогрессирующая AMD или географическая атрофия (GA)), дегенерацию желтого пятна, отек макулы, DME (например, фокальный, нецентральный DME или диффузный, связанный с центром DME), ретинопатию, диабетическую ретинопатию (DR) (например, пролиферативную DR (PDR), непролиферативную DR (NPDR) или высотную DR), другие связанные с ишемией ретинопатии, ROP, окклюзию вены сетчатки (RVO) (например, центральную (CRVO) и разветвленную (BRVO) формы), CNV (например, миопическую CNV), неоваскуляризацию роговицы, заболевания, связанные с неоваскуляризацией роговицы, неоваскуляризацию сетчатки, заболевания, связанные с ретинальной/хориоидальной неоваскуляризацией, патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, FEVR, болезнь Коутса, болезнь Норри, OPPG, субконъюнктивальное кровоизлияние, рубеоз, неоваскулярное заболевание глаз, неоваскулярную глаукому, пигментный ретинит (RP), гипертоническую ретинопатию, ангиоматозную пролиферацию сетчатки, макулярную телеангиэктазию, неоваскуляризацию зрачка, внутриглазную неоваскуляризацию, дегенерацию сетчатки, цистоидный макулярный отек (CME), васкулит, папилломедому, ретинит, конъюнктивит (например, инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит, амавроз Лебера, увеит (включая инфекционный и неинфекционный увеит), хориоидит (например, многофокальный хориоидит), глазной гистоплазмоз, блефарит, сухость глаз, травматическое повреждение глаз, болезнь Шёгрена. В некоторых случаях клеточное пролиферативное расстройство представляет собой рак. В некоторых случаях, рак представляет собой рак молочной железы, рак толстой кишки, немелкоклеточный рак легкого, неходжкинскую лимфому (НХЛ), рак почки, рак предстательной железы, рак печени, рак головы и шеи, меланому, рак яичников, мезотелиому или множественную миелому. В другом случае лекарственное средство предназначено для снижения или ингибирования ангиогенеза у субъекта. В другом случае лекарственное средство предназначено для использования в способе снижения или ингибирования ангиогенеза у субъекта, включающем введение субъекту количества, эффективного лекарственного средства для снижения или ингибирования ангиогенеза. В любом из предшествующих применений медикаментов способ может включать введение индивидууму эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже.

В другом случае лекарственное средство предназначено для лечения расстройства, связанного с нежелательной сосудистой проницаемостью. В некоторых случаях, расстройство, связанное с нежелательной проницаемостью сосудов, является отеком, связанным с опухолями головного мозга, асцитом, ассоциированным со злокачественными новообразованиями, синдромом Мейга, воспалением легких, нефротическим синдромом, перикардиальным выпотом, плевральным выпотом, или проницаемостью, связанной с сердечнососудистыми заболеваниями. В другом случае лекарственное средство предназначено для использования в способе лечения расстройства, связанного с нежелательной сосудистой проницаемостью, включающем введение субъекту, имеющему связанное с нежелательной сосудистой проницаемостью расстройство, эффективного количества лекарственного средства. В другом случае лекарственное средство предназначено для снижения или ингибирования проницаемости сосудов у субъекта. В другом случае лекарственное средство предназначено для использования в способе снижения или ингибирования проницаемости сосудов у субъекта, включающем введение субъекту количества эффективного лекарственного средства для снижения или ингибирования ангиогенеза. В любом из предшествующих применений медикаментов, способ может включать введение субъекту эффективного количества по меньшей мере одного дополнительного терапевтического агента, например, как описано ниже. «Субъект» в соответствии с любым из вышеуказанных способов использования может быть человеком.

В другом случае лекарственное средство предназначено для лечения аутоиммунного расстройства. В некоторых случаях аутоиммунным расстройством является ревматоидный артрит, анкилозирующий спондилоартрит, псориатический артрит и болезнь Крона. В другом случае лекарственное средство предназначено для использования в способе лечения аутоиммунного заболевания, включающем введение субъекту, имеющему аутоиммунное расстройство, эффективное количество лекарственного средства. «Субъект» в соответствии с любым из вышеуказанных способов использования может быть человеком.

Изобретение относится к способу лечения расстройства, связанного с патологическим ангиогенезом. В одном варианте осуществления изобретения, способ включает введение индивидууму, имеющему расстройство, связанное с патологическим ангиогенезом, эффективного количества антитела против VEGF. В другом примере, способ включает введение индивидууму, имеющему расстройство, связанное с патологическим ангиогенезом, эффективного количества конъюгата антитела. В другом примере, способ включает введение индивидууму, имеющему расстройство, связанное с патологическим ангиогенезом, эффективного количества слитого белка. В другом примере, способ включает введение индивидууму, имеющему расстройство, связанное с патологическим ангиогенезом, эффективного количества полимерного состава. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD, сухая AMD, промежуточная AMD, прогрессирующая AMD или географическая атрофия (GA)), дегенерацию желтого пятна, отек макулы, DME (например, фокальный, нецентральный DME или диффузный, связанный с центром DME), ретинопатию, диабетическую ретинопатию (DR) (например, пролиферативную DR (PDR), непролиферативную DR (NPDR) или высотную DR), другие связанные с ишемией ретинопатии, ROP, окклюзию вены сетчатки (RVO) (например, центральную (CRVO) и разветвленную (BRVO) формы), CNV (например, миопическую CNV), неоваскуляризацию роговицы, заболевания, связанные с неоваскуляризацией роговицы, неоваскуляризацию сетчатки, заболевания, связанные с ретинальной/хориоидальной неоваскуляризацией, патологическую близорукость, болезнь фон Хиппель-Линдау, гистоплазмоз глаза, FEVR, болезнь Коутса, болезнь Норри, OPPG, субконъюнктивальное кровоизлияние, рубеоз, неоваскулярное заболевание глаз, неоваскулярную глаукому, пигментный ретинит (RP), гипертоническую ретинопатию, ангиоматозную пролиферацию сетчатки, макулярную телеангиэктазию, неоваскуляризацию зрачка, внутриглазную неоваскуляризацию, дегенерацию сетчатки, цистоидный макулярный отек (CME), васкулит, папилломедому, ретинит, конъюнктивит (например, инфекционный конъюнктивит и неинфекционный (например, аллергический) конъюнктивит, амавроз Лебера, увеит (включая инфекционный и неинфекционный увеит), хориоидит (например, многофокальный хориоидит), глазной гистоплазмоз, блефарит, сухость глаз, травматическое повреждение глаз, болезнь Шёгрена. В некоторых случаях клеточное пролиферативное расстройство представляет собой рак. В некоторых случаях, рак представляет собой рак молочной железы, рак толстой кишки, немелкоклеточный рак легкого, неходжкинскую лимфому (НХЛ), рак почки, рак предстательной железы, рак печени, рак головы и шеи, меланому, рак яичников, мезотелиому или множественную миелому. В других случаях способ дополнительно включает введение индивидууму эффективного количества по меньшей мере одного дополнительного терапевтического агента, как описано ниже. «Субъект» в соответствии с любым из вышеуказанных способов может быть человеком.

Изобретение относится к способу лечения расстройства, связанного с нежелательной проницаемостью сосудов. В одном варианте осуществления изобретения, способ включает введение индивидууму, имеющему расстройство, связанное с нежелательной проницаемостью сосудов, эффективного количества антитела против VEGF. В некоторых случаях, расстройство, связанное с нежелательной проницаемостью сосудов, является отеком, связанным с опухолями головного мозга, асцитом, ассоциированным со злокачественными новообразованиями, синдромом Мейга, воспалением легких, нефротическим синдромом, перикардиальным выпотом, плевральным выпотом, или проницаемостью, связанной с сердечно-сосудистыми заболеваниями. В других случаях способ дополнительно включает введение индивидууму эффективного количества по меньшей мере одного дополнительного терапевтического агента, как описано ниже. «Субъект» в соответствии с любым из вышеуказанных способов может быть человеком.

Предполагается, что антитело по настоящему изобретению или конъюгат антитела, слитый белок или его полимерный состав могут использоваться для лечения млекопитающего. В одном варианте осуществления изобретения, антитело или конъюгат антитела, слитый белок или его полимерный состав вводят нечеловеческому млекопитающему с целью получения доклинических данных, например. Иллюстративные нечеловеческие млекопитающие, подлежащие лечению, включают нечеловеческих приматов, собак, кошек, грызунов (например, мышей и крыс) и других млекопитающих, на которых проводятся доклинические исследования. Такие млекопитающие могут быть установленными животными моделями заболевания, подлежащего лечению антителом, или могут быть использованы для изучения токсичности или фармакокинетики интересующего антитела. В каждом из этих вариантов осуществления изобретения, исследования эскалации дозы могут быть выполнены у млекопитающего. Например, антитело можно вводить хозяину-грызуну в модели солидной опухоли. Антитело или конъюгат антитела, слитый белок или его полимерный состав можно вводить хозяину (например, грызуну, например кролику) для окулярных фармакокинетических исследований, например, путем интравитреального введения (например, интравитреальной инъекции) или используя устройства доставки порт.

В следующем аспекте изобретение относится к фармацевтическим составам, содержащим любые антитела против VEGF, конъюгаты антител, слитые белки и/или полимерные составы, представленные в данном документе, например, для использования в любом из вышеуказанных терапевтических способов. В одном варианте осуществления изобретения, фармацевтический состав содержит любые антитела против VEGF, конъюгаты антител, слитые белки и/или полимерные составы, представленные в данном документе, и фармацевтически приемлемый носитель. В другом варианте осуществления изобретения, фармацевтический состав содержит любые антитела против VEGF, конъюгаты антител, слитые белки и/или полимерные составы, представленные в данном документе, и по меньшей мере один дополнительный терапевтический агент, например, как описано ниже. В некоторых вариантах осуществления изобретения, фармацевтический состав содержит одно или более дополнительных соединений. В некоторых вариантах осуществления изобретения, дополнительное соединение связывается со второй биологической молекулой, выбранной из группы, состоящей из IL-1β, IL-6; IL-6R; IL-13; IL-13R; PDGF; ангиопоэтина; Ang2; Tie-2; S1P; интегрины αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNF-альфа; HTRA1; рецептора VEGF; рецептора ST-2; и белков, генетически связанных с возрастной макулярной дегенерацией (AMD), такие как компоненты комплемента пути C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; интерлейкин-8 (IL-8); CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, дополнительное соединение представляет собой антитело или его антигенсвязывающий фрагмент. Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157, или его вариант). В другом примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант. В еще одном дополнительном примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6R, например, токилизумаб (ACTEMRA®) (см., например, WO 1992/019579), сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

Антитела по изобретению или конъюгаты антител, слитые белки или их полимерные составы могут использоваться как самостоятельно, так и в сочетании с другими агентами в терапии. Например, антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав могут вводиться совместно с по меньшей мере одним дополнительным терапевтическим агентом. В некоторых вариантах осуществления дополнительным терапевтическим агентом является другое антитело, химиотерапевтический агент, цитотоксический агент, антиангиогенный агент, иммуносупрессивный агент, пролекарство, цитокин, антагонист цитокинов, цитотоксическая радиотерапия, кортикостероид, противоотечный, противоопухолевую вакцину, анальгетик, агент, ингибирующий рост, или их комбинации.

Например, в некоторых вариантах осуществления изобретения, любой из предшествующих способов дополнительно включает введение одного или более дополнительных соединений. В некоторых вариантах осуществления изобретения, антитело против VEGF, конъюгат антитела, слитый белок или полимерный состав вводят одновременно с дополнительным соединением(ями). В некоторых вариантах осуществления изобретения, антитело против VEGF, конъюгат антитела, слитый белок или полимерный состав вводят до или после дополнительного соединения(ий). В некоторых вариантах осуществления изобретения, дополнительное соединение связывается со второй биологической молекулой, выбранной из группы, состоящей из IL-1β, IL-6; IL-6R; IL-13; IL-13R; PDGF; ангиопоэтина; Ang2; Tie-2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNF-альфа; HTRA1; рецептора VEGF; рецептора ST-2; и белков, генетически связанных с риском AMD, таких как компоненты комплемента пути C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; интерлейкин-8 (IL-8); CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, дополнительное соединение представляет собой антитело или его антигенсвязывающий фрагмент. В некоторых вариантах осуществления изобретения, в соответствии с (или применительно к) любым из вышеперечисленных вариантов осуществления, окулярное расстройство представляет собой внутриглазное неоваскулярное заболевание, выбранное из группы, состоящей из пролиферативных ретинопатий, хориоидальной неоваскуляризации (CNV), связанной с возрастном макулярной дегенерации (AMD), диабетической и другой связанной с ишемией ретинопатией, диабетического макулярного отека, патологической близорукости, болезни фон Хиппель-Линдау, гистоплазмоза глаза, окклюзии сетчатки (RVO), включая CRVO и BRVO, неоваскуляризации роговицы, неоваскуляризации сетчатки и ретинопатии недоношенных (ROP). Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157, или его вариант. В другом примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант. В еще одном дополнительном примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6R, например, токилизумаб (ACTEMRA®) (см., например, WO 1992/019579), сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

В некоторых случаях антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав могут вводиться в комбинации по меньшей мере с одним дополнительным терапевтическим средством для лечения окулярного расстройства, например окулярного расстройства описанного в данном документе (например, AMD (например, влажная AMD), DME, DR или RVO). Иллюстративные дополнительные терапевтические агенты для комбинированной терапии для лечения окулярных расстройств включают, без ограничения, антиангиогенные агенты, такие как антагонисты VEGF, включая, например, анти-VEGF антитела (например, анти-VEGF Fab LUCENTIS® (ранибизумаб)), слитые белки растворимого рецептора (например, слитый белок рекомбинантного растворимого рецептора EYLEA® (афлиберцепт, также известный как VEGF Trap Eye, Regeneron/Aventis)), аптамеры (например, пегилированный аптамер против VEGF MACUGEN® (пегаптаниб натрия, NeXstar Pharmaceuticals/OSI Pharmaceuticals)) и ингибиторы тирозинкиназы VEGFR (например, 4-(4-бром-2-фторанилино)-6-метокси-7- (1-метилпиперидин-4-илметокси)хиназолин (ZD6474), 4-(4 -фторо-2-метилиндол-5-илокси)-6-метокси-7-(3-пирролидин-1-илпропокси)хиназолин (AZD2171), ваталаниб (PTK787), семаксамибин (SU5416, SUGEN) и SUTENT® (сунитиниб)); Триптофанил-тРНК-синтетаза (TrpRS); скваламин; RETAANE® (ацетат анекортава для суспензии депо, Alcon, Inc.); пролекарство комбретастатин A4 (CA4P); MIFEPREX® (мифепристон-ru486); субтенон триамцинолона ацетонида; интравитреальный кристаллический триамцинолон ацетонид; матричные ингибиторы металлопротеиназы (например, Приномастат (AG3340, Pfizer)); фтороцинолон ацетонид (включая интраокулярный имплантат флуоцинолона, системы Bausch & Lomb/Control Delivery); линомид; ингибиторы функции интегрина β3; ангиостатин и их комбинации. Эти и другие терапевтические агенты, которые можно вводить в комбинации с антителом по изобретению, описаны, например, в заявке на патент США № US 2014/0017244, которая полностью включена в настоящее описание посредством ссылки.

Другие примеры дополнительных терапевтических агентов, которые могут быть использованы в комбинации с антителом по изобретению, или конъюгат антитела, слитый белок и/или его полимерный состав для лечения окулярного расстройства (например, AMD, DME, DR или RVO), включают, но не ограничиваются ими, VISUDYNE® (вертепорфин, светоактивное лекарственное средство, которое обычно используется в сочетании с фотодинамической терапией с нетепловым лазером), PKC412, Эндовион (NS 3728, NeuroSearch A/S), нейротрофические факторы (например, нейротрофический фактор глиального происхождения (GDNF) и цилиарный нейротрофический фактор (CNTF)), дилтиазем, дорзоламид, PHOTOTROP®, 9-цис-ретиналь, лекарственные средства для глаз (например, ингибиторы йодистого фосфония, эхотиофата или карбоангидразы), веовастат (AE-941, AEterna Laboratories, Inc.), Сирна-027 (AGF-745, Sima Therapeutics, Inc.), нейротрофины (в том числе, в качестве примера, NT-4/5, Genentech), Cand5 (Acuity Pharmaceuticals), INS-37217 (Inspire Pharmaceuticals), антагонисты интегрина (в том числе от Jerini AG и Abbott Laboratories), EG-3306 (Ark Therapeutics Ltd.), BDM-E (BioDiem Ltd.), талидомид (как используется, например, EntreMed, Inc.), кардиотрофин-1 (Genentech), 2-метоксиэстрадиол (Allergan/Oculex), DL-8234 (Toray Industries), NTC-200 (Neurotech), тетратиомолибдат (Мичиганский университет), LYN-002 (Lynkeus Biotech), соединение микроскопических водорослей (Aquasearch/Albany, Mera Pharmaceuticals), D-9120 (Celltech Group plc), ATX-S10 (Hamamatsu Photonics), TGF-бета 2 (Genzyme/Celtrix), ингибиторы тирозинкиназы (например, от Allergan, SUGEN или Pfizer), NX-278-L (NeXstar Pharmaceuticals/Gilead Sciences), Opt-24 (OPTIS France SA), нейропротекторные клетки ганглия сетчатки (Cogent Neurosciences), производные N-нитропиразола (Texas A&M University System), KP-102 (Krenitsky Pharmaceuticals), циклоспорин A, терапевтические агенты, используемые в фотодинамической терапии (например, VISUDYNE®; рецептор-PDT, Bristol-Myers Squibb, Co.; порфимер натрия для инъекций с PDT; вертепорфин, QLT Inc.; ростапорфин с PDT, Miravent Medical Technologies; талапорфин с PDT, Nippon Petroleum; и мотексафин лутетиум, Pharmacyclics, Inc.), антисмысловые олигонуклеотиды (включая, например, продукты, проверенные Novagali Pharma SA и ISIS-13650, Isis Pharmaceuticals) и их комбинации.

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с терапией или хирургической процедурой для лечения окулярного расстройства (например, AMD, DME, DR или RVO), включая, например, лазерную фотокоагуляцию (например, панретинальную фотокоагуляцию (PRP)), лазерную генерацию друзов, операцию с макулярными отверстиями, операцию макулярной транслокации, имплантируемые миниатюрные телескопы, ангиографию PHI-движения (также известную как микролазерная терапия и лечение фидерных сосудов), протонную лучевую терапию, микростимуляционную терапию, отслойку сетчатки и стекловидную хирургию, вдавливание склеры, субмакулярную хирургию, транспупиллярную термотерапию, терапию фотосистемы I, использование РНК-интерференции (RNAi), экстракорпоральный реофероз (также известный как мембранная дифференциальная фильтрация и реотерапия), имплантацию микрочипов, терапию стволовыми клетками, заместительную терапию генами, терапию генами рибозима (включая генную терапию для элемента ответа гипоксии, Oxford Biomedica, Lentipak, Genetix; и генную терапию PDEF, GenVec), трансплантацию фоторецепторов/ретинальных клеток (включая трансплантируемые эпителиальные клетки сетчатки, Diacrin, Inc, трансплантацию клеток сетчатки, Cell Genesys, Inc.), иглоукалывание и их комбинации.

В некоторых случаях антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав могут вводиться в комбинации с антиангиогенным средством для лечения окулярного расстройства (например, AMD, DME, DR, или RVO). Любой подходящий антиангиогенный агент может быть использован в комбинации с антителом по изобретению, включая, но не ограничиваясь ими, те, которые перечислены Carmeliet et al. Nature 407: 249-257, 2000. В некоторых вариантах осуществления изобретения, антиангиогенный агент представляет собой антагонист VEGF, включая, но не ограничиваясь ими, антитело против VEGF (например, анти-VEGF Fab LUCENTIS® (ранибизумаб), RTH-258 (ранее ESBA-1008, анти-VEGF фрагмент одноцепочечного антитела, Novartis) или биспецифическое антитело против VEGF (например, биспецифическое антитело против VEGF/антиангиопоэтин 2, такое как RG-7716, Roche)), слитый белок растворимого рекомбинантного рецептора (например, EYLEA® (афлиберцепт)), вариант VEGF, растворимый фрагмент VEGFR, аптамер, способный блокировать VEGF (например, пегаптаниб) или VEGFR, нейтрализующее антитело против VEGFR, ингибитор малых молекул тирозинкиназ VEGFR, анти-VEGF DARPin® (например, абиципар пегол), малые интерферирующие РНК, которые ингибируют экспрессию VEGF или VEGFR, ингибитор тирозинкиназы VEGFR (например, 4-(4-бромо-2-фторанилино)-6-метокси-7-( 1-метилпиперидин-4-илметокси хиназолин (ZD6474), 4-(4-фтор-2-метилиндол-5-илокси)-6-метокси-7-(3-пирролидин-1-илпропокси)хиназолин (AZD2171), ваталаниб (PTK 787), семаксаминиб (SU5416; SUGEN) и SUTENT® (сунитиниб)) и их комбинации. В некоторых случаях биспецифическое антитело против VEGF связывается со второй биологической молекулой, включая, но не ограничиваясь ими, IL-1β; IL-6; IL-6R; PDGF (например, PDGF-BB); ангиопоэтин; ангиопоэтин 2; Tie-2; S1P; интегрины αvβ3, αvβ5 и α5β1; бетацеллюлин; апелин/APJ; эритропоэтин; фактор комплемента D; TNF-alpha; HTRA1; рецептор VEGF (например, VEGFR1, VEGFR2, VEGFR3, mbVEGFR или sVEGFR); рецептор ST-2; и белки, генетически связанные с риском возрастной макулярной дегенерацией (AMD), такие как компоненты комплемента пути C2, фактор B, фактор H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157, или его вариант.

Другие подходящие антиангиогенные агенты, которые можно вводить в комбинации с антителом по изобретению, или конъюгат антитела, слитый белок и/или его полимерный состав для лечения окулярного расстройства (например, AMD, DME, DR или RVO) включают кортикостероиды, ангиостатические стероиды, анкортав ацетата, ангиостатин, эндостатин, ингибиторы тирозинкиназы, ингибиторы матричной металлопротеиназы (MMP), инсулиноподобный фактор роста-связывающий белок 3 (IGFBP3), антагонисты стромально-доставленного фактора (SDF-1) (например, антитела против SDF-1), фактор пигментного эпителия (PEDF), гамма-секретаза, дельта-подобный лиганд 4, антагонисты интегрина, антагонисты гипоксия-индуцибельного фактора (HIF)-1α, антагонисты CK2 протеинкиназы, агенты, которые ингибируют стволовые клетки (например, эндотелиальная клетка-предшественник) на месте неоваскуляризации (например, антитело против сосудистого эндотелиального кадгерина (CD-144) и/или антитело против SDF-1) и их комбинации.

В другом примере в некоторых случаях антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в комбинации с агентом, который обладает активностью против неоваскуляризации для лечения окулярного расстройства (например, AMD, DME, DR или RVO), таких как противовоспалительное лекарственное средство, мишень ингибитора рапамицина (mTOR) млекопитающего (например, рапамицин, AFINITOR® (эверолимус) и TORISEL® (темсиролимус)), циклоспорин, антагонист фактора некроза опухоли (TNF) (например, антитело против TNFα или его антигенсвязывающий фрагмент (например, инфликсимаб, адалимумаб, цертолизумаб пегол и голимумаб) или слитый белок растворимого рецептора (например, этанерцепт)), агент анти-комплемента, нестероидный противовоспалительный агент (NSAID) или их комбинации.

В еще одном дополнительном примере в некоторых случаях антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в комбинации с агентом, который является нейропротективным и может потенциально уменьшать прогрессирование сухой AMD до влажной AMD, такого как класс лекарств, называемых «нейростероидами», которые включают такие препараты, как дегидроэпиандростерон (DHEA) (торговые марки: PRASTERA™ и FIDELIN®), дегидроэпиандростерона сульфата и прегненолона сульфата.

Любой подходящий терапевтический агент AMD может вводиться в качестве дополнительного терапевтического агента в сочетании с антителом по изобретению или конъюгатом антитела, слитым белком и/или его полимерным составом для лечения окулярного расстройства (например, AMD, DME, DR, или RVO), включая, но не ограничиваясь ими, антагонист VEGF, например анти-VEGF антитело (например, LUCENTIS® (ранибизумаб), RTH-258 (ранее ESBA-1008, одноцепочечный анти-VEGF фрагмент антитела, Novartis) или биспецифическое антитело против VEGF (например, биспецифическое антитело против VEGF/антиангиопоэтин 2, такое как RG-7716, Roche)), растворимый слитый белок рецептора VEGF (например, EYLEA® (афлиберцепт)), анти-VEGF DARPin® (например, абиципар пегол, Molecular Partners AG/Allergan) или анти-VEGF аптамер (например, MACUGEN® (пегаптаниб натрия)); антагонист тромбоцитарного фактора роста (PDGF), например анти-PDGF антитело, антитело против PDGFR (например, REGN2176-3), пэгилированный аптамер против PDGF-BB (например, FOVISTA®, Ophthotech/Novartis), слитый белок растворимого PDGFR-рецептора или двойной антагонист PDGF/VEGF (например, ингибитор малых молекул (например, DE-120 (Santen) или X-82 (TyrogeneX)) или биспецифический анти-PDGF/анти-VEGF антитела)); VISUDYNE® (вертепорфин) в сочетании с фотодинамической терапией; антиоксидант; антагонист системы комплемента, например антагонист фактора комплемента C5 (например, ингибитор малых молекул (например, ARC-1905, Opthotech) или анти-C5-антитело (например, LFG-316, Novartis), антагонист пропердина (например, антитело против пропердина, например CLG-561, Alcon) или антагонист фактора комплемента D (например, антитело против фактора комплемента D, например, лампализумаб, Roche)); модификатор цикла преврацения родопсина (например, гидрохлорид эмиксустат); сквуаламин (например, OHR-102; Pharm Pharmaceutical); витамины и минеральные добавки (например, те, которые описаны в исследовании по изучению заболеваний, связанных с возрастом 1 (AREDS1, цинк и/или антиоксиданты) и в исследовании 2 (AREDS2, цинк, антиоксиданты, лютеин, зеаксантин и/или омега-3 жирные кислоты)); основанная на клетках терапия, например, NT-501 (Renexus); PH-05206388 (Pfizer), трансплантация клеток huCNS-SC (StemCells), CNTO-2476 (Janssen), OpRegen (Neuroscience Cell Cellure) или трансплантация клеток MA09-hRPE (Ocata Therapeutics); антагонист тканевого фактора (например, hI-con1; Iconic Therapeutics); агонист альфа-адренергического рецептора (например, бримонидин тартрат); пептидная вакцина (например, S-646240; Shionogi); антагонист амилоида бета (например, анти-бета амилоидное моноклональное антитело, например GSK-933776); антагонист S1P (например, анти-S1P антитело, например, iSONEP™; Lpath Inc); антагонист ROBO4 (например, антитело против ROBO4, например DS-7080a, Daiichi Sankyo); лентивирусный вектор, экспрессирующий эндостатин и ангиостатин (например, RetinoStat); и любую их комбинацию. В некоторых случаях терапевтические агенты AMD (включая любой из предыдущих терапевтических агентов AMD) могут быть совместно составлены. Например, анти-PDGFR антитело REGN2176-3 может быть совместно сформулировано с афлиберцептом (EYLEA®). В некоторых случаях такой совместный препарат можно вводить в комбинации с антителом по изобретению. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с LUCENTIS® (ранибизумабом) для лечения окулярного расстройства (например, AMD, DME, DR или RVO). LUCENTIS® (ранибизумаб) можно вводить, например, при 0,3 мг/глаз или 0,5 мг/глаз интравитреальной инъекцией, например, каждый месяц. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с EYLEA® (афлиберцепт) для лечения окулярного расстройства (например, AMD, DME, DR или RVO). EYLEA® (афлиберцепт) можно вводить, например, в 2 мг/глаз интравитреальной инъекцией, например, каждые четыре недели (Q4W) или Q4W в течение первых трех месяцев с последующими инъекциями один раз в два месяца для поддержки. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с MACUGEN® (пегаптаниб натрия) для лечения окулярного расстройства (например, AMD, DME, DR или RVO). MACUGEN® (пегаптаниб натрия) можно вводить, например, в 0,3 мг/глаз интравитреальной инъекцией каждые шесть недель. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с VISUDYNE® (вертепорфин) в сочетании с фотодинамической терапией для лечения окулярного расстройства (например, AMD, DME, DR или RVO). VISUDYNE® можно вводить, например, путем внутривенной инфузии в любой подходящей дозе (например, 6 мг/м2 площади поверхности тела) и доставляться один раз каждые три месяца (например, более 10 минут инфузии). В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в комбинации с антагонистом PDGF для лечения окулярного расстройства (например, AMD, DME, DR или RVO). Иллюстративные антагонисты PDGF, которые могут быть использованы в комбинации с антителом по изобретению, включают антитело против PDGF, антитело против PDGFR, ингибитор малых молекул (например, сквуаламин), пэгилированный аптамер против PDGF-B, такой как FOVISTA® (E10030, Ophthotech/Novartis) или двойной антагонист PDGF/VEGF (например, ингибитор малых молекул (например, DE-120 (Santen) или X-82 (TyrogeneX)) или биспецифическое антитело против PDGF/анти-VEGF ). Например, FOVISTA® можно вводить в качестве вспомогательной терапии к антителу по изобретению. FOVISTA® можно вводить в любой подходящей дозе, например, от 0,1 мг/глаз до 2,5 мг/глаз, например, при 0,3 мг/глаз или 1,5 мг/глаз, например, путем интравитреальной инъекции, например каждые четыре недели (Q4W). OHR-102 (офтальмический раствор кальмамина лактата, 0,2 %) можно вводить глазными каплями, например, два раза в день. OHR-102 можно вводить в комбинации с антагонистами VEGF, такими как LUCENTIS® или EYLEA®. В некоторых вариантах осуществления изобретения, антитело по изобретению можно вводить в комбинации с OHR-102, LUCENTIS® и/или EYLEA®. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с RTH-258 для лечения окулярного расстройства (например, AMD, DME, DR или RVO). RTH-258 можно вводить, например, путем интравитреальной инъекции или инфузии в глаз. Для интравитреальной инъекции RTH-258 можно вводить в любой подходящей дозе (например, 3 мг/глаз или 6 мг/глаз), например, каждые четыре недели (Q4W) в течение первых трех месяцев в качестве загрузки, после чего каждую инъекцию 12 недель (Q12W) или каждые восемь недель (Q8W) для поддержания. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с абиципар пеголом для лечения окулярного расстройства (например, AMD, DME, DR или RVO). Абиципар пегол можно вводить, например, путем интравитреальной инъекции. Абиципар пегол можно вводить в любой подходящей дозе (например, 1 мг/глаз, 2 мг/глаз, 3 мг/глаз, 4 мг/глаз или 4,2 мг/глаз), например, каждые четыре недели (Q4W) для первых трех месяцев в качестве загрузки, а затем инъекция каждые 12 недель (Q12W) или каждые восемь недель (Q8W) для поддержания. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Любой подходящий DME и/или терапевтический агент DR можно вводить в комбинации с антителом по изобретению или конъюгатом антитела, слитым белком и/или его полимерным составом для лечения окулярного расстройства (например, AMD, DME, DR, или RVO), включая, но не ограничиваясь ими, антагонист VEGF (например, LUCENTIS® или EYLEA®), кортикостероид (например, имплантат кортикостероидов (например, OZURDEX® (имплантат дексаметазона) или ILUVIEN® (флюоцинолон ацетонид интравитеральный имплантат)) или кортикостероид, приготовленный для введения путем интравитеральной инъекции (например, триамцинолон ацетонид)) или их комбинаций. В некоторых случаях окулярное расстройство представляет собой DME и/или DR.

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с LUCENTIS® (ранибизумабом) для лечения DME и/или DR (например, NPDR или PDR). LUCENTIS® (ранибизумаб) можно вводить, например, при 0,3 мг/глаз или 0,5 мг/глаз интравитреальной инъекцией, например, каждые четыре недели (Q4W).

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с EYLEA® (афлиберцепт) для лечения DME и/или DR (например, NPDR или PDR). EYLEA® (афлиберцепт) можно вводить, например, в 2 мг/глаз интравитреальной инъекцией, например, каждые четыре недели (Q4W) или Q4W в течение первых четырех месяцев с последующими инъекциями один раз каждые восемь недель (Q8W) для поддержания.

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с OZURDEX® (интравитреальный имплантат дексаметазона) для лечения DME и/или DR. OZURDEX® можно вводить в качестве интравитреального имплантата дексаметазона 0,7 мг, который можно вводить каждые шесть месяцев.

Антитело по изобретению или конъюгат антитела, слитый белок и/или его полимерный состав можно вводить в сочетании с ILUVIEN® (интравитреальный имплантат дексаметазона) для лечения DME и/или DR. OZURDEX® можно вводить в качестве интравитреального имплантата флюоцинолона ацетонида 0,19 мг, который можно элюировать со скоростью 0,25 мкг/день и может действовать до около 36 месяцев.

В некоторых случаях режим лечения TAO/PRN или режим лечения TAE можно использовать для введения терапевтического агента AMD (например, ранибизумаба или афлиберцепта) в комбинации с антителом по изобретению или конъюгатом антитела, слитым белком и/или полимерным составом. Для режима TAO/PRN после первоначальных интравитреальных инъекций каждые четыре недели (Q4W) (как правило, в течение около 3 месяцев), субъект контролируется ежемесячно или через каждый месяц (или даже более длительные интервалы), при инъекциях, вводимых в случае доказательства активности заболевания (например, снижения остроты зрения или жидкости на оптической когерентной томографии (ОКТ)). Для режима ТАЕ субъект может обрабатываться каждые четыре недели (Q4W) с последующим продлением интервала лечения на фиксированное число недель (например, +2 недели) для каждого последующего посещения до максимального интервала (например, каждые 6 недель, каждые 8 недель, каждые 10 недель или каждые 12 недель). Глаз(а) можно наблюдать и лечить при каждом посещении, даже если нет признаков активности болезни. Если макула кажется влажной (например, из-за OCT), интервал для инъекций может быть сокращен (например, -2 недели), пока макула снова не станет сухой. В некоторых случаях окулярное расстройство представляет собой AMD (например, влажная AMD).

Такие комбинированные терапии, отмеченные выше, включают комбинированное введение (где два или более терапевтических агентов включены в одни и те же или отдельные составы) и отдельное введение, и в этом случае введение антитела по изобретению может происходить до, одновременно и/или в последующее введение дополнительного терапевтического агента или агентов. В одном варианте осуществления изобретения, введение анти-VEGF антитела, конъюгата антител, слитого белка или полимерного состава и введения дополнительного терапевтического агента происходит в течение около одного, двух, трех, четырех или пяти месяцев или в течение около одной, двух или трех недель или в течение около одного, двух, трех, четырех, пяти или шести дней друг от друга. Антитела, конъюгаты антител, слитые белки и полимерные составы по изобретению могут также использоваться в сочетании с лучевой терапией.

Антитело, конъюгат антитела, слитый белок или полимерный состав по изобретению (и любой дополнительный терапевтический агент) для профилактики или лечения окулярного заболевания или состояния могут вводиться любыми подходящими средствами, включая, но не ограничиваясь ими, например, окулярную, интраокулярную и/или интравитреальную инъекцию и/или околосклеральную инъекцию, и/или субтенозную инъекцию, и/или суперхороидальную инъекцию, и/или местное введение в виде глазных капель и/или мази. Такие антитела, конъюгаты антител, слитые белки или полимерные составы по изобретению могут быть доставлены различными способами, например, интравитреально в качестве устройства и/или депо, которое обеспечивает медленное высвобождение соединения в стекловидное тело, включая описанные в таких ссылках, как Intraocular Drug Delivery, Jaffe, Jaffe, Ashton, and Pearson, editors, Taylor & Francis (March 2006). В одном примере устройство может быть в виде мини-насоса, и/или матрицы, и/или системы пассивной диффузии, и/или инкапсулированных клеток, которые высвобождают соединение в течение длительного периода времени (Intraocular Drug Delivery, Jaffe, Jaffe, Ashton, and Pearson, editors, Taylor & Francis (March 2006). Дополнительные подходы, которые могут быть использованы, описаны в разделе K ниже.

Препараты для окулярного, интраокулярного или интравитреального введения могут быть получены способами и с использованием эксципиентов, известных в данной области техники. Важной особенностью эффективного лечения является правильное проникновение через глаз. В отличие от заболеваний передней части глаза, когда лекарства могут быть доставлены местно, заболевания сетчатки обычно выигрывают от более сайт-специфичного подхода. Глазные капли и мази редко проникают в заднюю часть глаза, а гематоофтальмический барьер препятствует проникновению системно вводимых препаратов в глазную ткань. Соответственно, способ выбора для доставки лекарств для лечения заболевания сетчатки, такого как AMD и CNV, обычно представляет собой прямую интравитреальную инъекцию. Интравитреальные инъекции обычно повторяются с интервалами, которые зависят от состояния пациента, а также от свойств и периода полураспада доставленного препарата. Дополнительные подходы, которые могут быть использованы, описаны в разделе K ниже.

Количество антитела, его вариант антитела, конъюгат антитела, слитый белок или его полимерный состав, который будет эффективен при лечении конкретного окулярного расстройства или состояния, будет зависеть от характера расстройства или состояния и может быть определен стандартными клиническими методами. Там, где это возможно, желательно сначала определить кривую доза-реакция и фармацевтические композиции по изобретению in vitro, а затем в полезных модельных системах животных перед тестированием на людях.

Дополнительные подходящие средства для введения включают в себя парентеральное, внутрилегочное и интраназальное и, при желании, для местного лечения, внутривенное введение. Парентеральные инфузии включают внутримышечное, внутривенное, внутриартериальное, внутрибрюшинное или подкожное введение. Дозирование может происходить любым подходящим путем, например, путем инъекций, таких как внутривенные или подкожные инъекции, в зависимости от того, является ли введение кратковременным или хроническим. В настоящем документе рассматриваются различные графики дозирования, включая, но не ограничиваясь ими, однократное или множественное введение в различные моменты времени, введение болюса и пульсовую инфузию. В некоторых случаях, антитело против VEGF, конъюгат антитела, слитый белок или полимерный состав по изобретению могут вводиться, внутривенно, внутримышечно, внутрикожно, чрескожно, внутриартериально, внутрибрюшинно, внутриочагово, интракраниально, внутрисуставно, внутрипростатически, внутриплеврально, интратрахеально, интратекально, интраназально, интравагинально, интраректально, местно, внутриопухольно, внутрибрюшинно, перитонеально, интравентрикулярно, подкожно, субконъюнктивно, интравезикулярно, через слизистую, интраперикардиально, внутрипуповинно, интраорбитально, перорально, трансдермально, путем ингаляции, путем инъекции, путем имплантации, путем инфузии, путем непрерывной инфузии, локализованными перфузионными ваннами, которые действуют на клетки непосредственно, катетером, промыванием, кремами или липидными композициями.

Для профилактики или лечения заболевания соответствующая доза антитела, конъюгата антитела, слитого белка или полимерного состава по изобретению (при использовании отдельно или в сочетании с одним или более другими дополнительными терапевтическими агентами) будет зависеть от типа заболевания, которое необходимо лечить, типа антитела, тяжести и течения заболевания, независимо от того, вводится ли антитело в профилактических или терапевтических целях, предыдущей терапии, клинической истории пациента и ответа на антитело, а также на усмотрение лечащего врача. Антитело, конъюгат антитела, слитый белок или полимерный состав подходящим образом вводят пациенту в одно время или в течение ряда процедур. В зависимости от типа и тяжести заболевания, от около 1 мкг/кг до 15 мг/кг (например, 0,1 мг/кг, 0,2 мг/кг, 0,4 мг/кг, 0,6 мг/кг, 0,8 мг/кг, 1 мг/кг, 2 мг/кг, 3 мг/кг, 4 мг/кг, 5 мг/кг, 6 мг/кг, 7 мг/кг, 8 мг/кг, 9 мг/кг или 10 мг/кг) антитела может быть исходной дозой для введения пациенту, независимо от, например, с помощью одного или более отдельных введений или путем непрерывной инфузии. В некоторых вариантах осуществления изобретения, антитело используется от около 0,01 мг/кг до около 45 мг/кг, от около 0,01 мг/кг до около 40 мг/кг, от около 0,01 мг/кг до около 35 мг/кг, от около 0,01 мг/кг до около 30 мг/кг, от около 0,01 мг/кг до около 25 мг/кг, от около 0,01 мг/кг до около 20 мг/кг, от около 0,01 мг/кг до около 15 мг/кг, от около 0,01 мг/кг до около 10 мг/кг, от около 0,01 мг/кг до около 5 мг/кг или от около 0,01 мг/кг до около 1 мг/кг. Одна типичная суточная доза может варьироваться от около 1 мкг/кг до 100 мг/кг или более, в зависимости от факторов, упомянутых выше. При повторных введениях в течение нескольких дней или дольше, в зависимости от состояния, лечение, как правило, должно поддерживаться до тех пор, пока не произойдет желаемое подавление симптомов болезни.

В некоторых вариантах осуществления изобретения, способы могут дополнительно включать дополнительную терапию. Дополнительной терапией могут быть лучевая терапия, хирургия, химиотерапия, генная терапия, ДНК-терапия, вирусная терапия, РНК-терапия, иммунотерапия, трансплантация костного мозга, нанотерапия, терапия моноклональными антителами или комбинация вышеизложенного. Дополнительная терапия может быть в виде адъювантной или неоадъювантной терапии. В некоторых вариантах осуществления изобретения, дополнительной терапией является введение небольшого молекулярного ферментативного ингибитора или антиметастатического агента. В некоторых вариантах осуществления изобретения, дополнительной терапией является введение ограничивающих побочные эффекты агентов (например, агентов, предназначенных для уменьшения возникновения и/или тяжести побочных эффектов лечения, таких как агенты против тошноты и т.д.). В некоторых вариантах осуществления изобретения, дополнительной терапией является лучевая терапия. В некоторых вариантах осуществления изобретения, дополнительной терапией является операция. В некоторых вариантах осуществления изобретения, дополнительная терапия представляет собой комбинацию лучевой терапии и хирургии. В некоторых вариантах осуществления изобретения, дополнительной терапией является гамма-облучение. В некоторых вариантах осуществления изобретения, дополнительная терапия может представлять собой отдельное введение одного или более терапевтических агентов, описанных выше.

Понятно, что любой из вышеуказанных составов или терапевтических способов может быть выполнен с использованием иммуноконъюгата по изобретению вместо или в дополнение к анти-VEGF антителу.

Понятно, что любая из вышеуказанных композиций или любой терапевтических способов может быть осуществлен с использованием конъюгата антитела, слитого белка или полимерного состава по изобретению (например, любой описанный в данном документе, например, в разделе K ниже) вместо или дополнительно к анти-VEGF антителу.

H. Изделие

В еще одном аспекте изобретения предложено изделие, содержащее материалы, пригодные для лечения, профилактики и/или диагностики расстройств, описанных выше. Изделие включает контейнер и этикетку или вкладыш в упаковку, вложенный или связанный с контейнером. Подходящие контейнеры включают, например, бутылки, флаконы, шприцы, пакеты с растворами для внутривенного введения и т.д. Контейнеры могут быть изготовлены из различных материалов, например, стекла или пластмассы. Контейнер содержит композицию, эффективно применяемую при лечении, профилактике и/или диагностике патологического состояния отдельно или в комбинации с другой композицией, и может иметь стерильное входное отверстие (например, контейнер может представлять собой пакет с раствором для внутривенного введения или флакон с пробкой, прокалываемой иглой для подкожной инъекции). По меньшей мере один активный агент в композиции является антителом согласно настоящему изобретению. На этикетке или на вкладыше в упаковку указано, что композиция используется для лечения выбранного патологического состояния. Кроме того, изделие может содержать (a) первый контейнер с содержащейся в нем композицией, отличающейся тем, что композиция содержит антитело согласно настоящему изобретению; и (b) второй контейнер с содержащейся в нем композицией, отличающейся тем, что композиция включает дополнительное цитотоксическое или иное терапевтическое средство. Изделие в этом варианте осуществления изобретения может дополнительно содержать вкладыш для упаковки, указывающий, что композиции могут использоваться для лечения конкретного состояния. Альтернативно или дополнительно изделие может дополнительно содержать второй (или третий) контейнер, содержащий фармацевтически приемлемый буфер, такой как бактериостатическая вода для инъекций (BWFI), натрий-фосфатный буфер, раствор Рингера и раствор декстрозы. Он может также включать другие материалы, желательные с коммерческой и пользовательской точек зрения, включая другие буферы, разбавители, фильтры, иглы и шприцы.

Понятно, что любое из вышеуказанных изделий может включать иммуноконъюгат по изобретению вместо или в дополнение к анти-VEGF антителу.

Понятно, что любое из указанных выше изделий может включать в себя конъюгат антитела, слитый белок или полимерный состав по изобретению вместо или в дополнение к анти-VEGF антителу.

I. Способы идентификации вариантов антител и улучшения антител

Изобретение относится к способам улучшения антител и идентификации вариантов антител. В некоторых случаях способы включают в себя идентификацию одного или более изменений аминокислотных остатков, которые обеспечивают усиленное связывание антитела с молекулой-мишенью. В некоторых случаях способы включают в себя идентификацию одного или более изменений аминокислотных остатков, которые обеспечивают повышенную стабильность (например, термическую стабильность), функциональную экспрессию и/или сворачивание белка антитела. В некоторых случаях изобретение относится к способам улучшения аффинности связывания антитела с молекулой-мишенью. В некоторых случаях изобретение относится к способам улучшения стабильности (например, термической стабильности), функциональной экспрессии и/или сворачиванию белка антитела. В некоторых случаях изобретение обеспечивает способы улучшения аффинности связывания антитела с молекулой-мишенью и улучшения стабильности (например, термической стабильности) антитела.

Например, изобретение относится к способам идентификации изменения аминокислотного остатка, которое обеспечивает усиленное связывание антитела с молекулой-мишенью, который включает один или более (например, 1, 2 или 3) следующих этапов: (а) обеспечение библиотеки дисплея, содержащей нуклеиновые кислоты, кодирующие варианты антитела-кандидата, отличающийся тем, что каждый вариант антитела-кандидата содержит изменение аминокислотного остатка в VH или VL по сравнению с эталонным антителом, и причем изменения аминокислотного остатка в каждом положении VH или VL присутствуют в библиотеке дисплея; (b) сортировка библиотеки дисплея на основе связывания вариантов антитела-кандидата с молекулой-мишенью с образованием сортированной библиотеки, причем сортированная библиотека содержит варианты антитела-кандидата с улучшенным связыванием с молекулой-мишенью по сравнению с эталонным антителом; и (c) сравнение частоты, с которой каждое изменение аминокислотного остатка присутствует в библиотеке дисплея и в сортированной библиотеке, определенной с помощью массового параллельного секвенирования, тем самым определение того, обогащено ли каждое изменение аминокислотного остатка в сортированной библиотеке по сравнению с библиотекой дисплея, в которой изменение аминокислотного остатка идентифицируется как способствующее усиленному связыванию с молекулой-мишенью, если оно обогащено в сортированной библиотеке по сравнению с библиотекой дисплея. В некоторых случаях способ дополнительно включает в себя идентификацию аминокислотного остатка, который обеспечивает повышенную устойчивость к антителу, например, как описано ниже.

В другом примере, изобретение предлагает способы идентификации изменения аминокислотного остатка, который обеспечивает повышенную стабильность антитела, который включают один или более (например, 1, 2 или 3) следующих этапов: (а) обеспечение библиотеки дисплея, содержащей нуклеиновые кислоты, кодирующие варианты антитела-кандидата, отличающиеся тем, что каждый вариант антитела-кандидата содержит изменение аминокислотного остатка в VH или VL по сравнению с эталонным антителом, и причем изменения аминокислотного остатка в каждом положении VH или VL присутствуют в библиотеке дисплея; (b) сортировка библиотеки дисплея на основе связывания вариантов антитела-кандидата с молекулой-мишенью с образованием сортированной библиотеки, причем сортированная библиотека содержит варианты антитела-кандидата с улучшенной стабильностью по сравнению с эталонным антителом; и (c) сравнение частоты, с которой каждое изменение аминокислотного остатка присутствует в библиотеке дисплея и в сортированной библиотеке, определенной с помощью массового параллельного секвенирования, тем самым определение того, обогащено ли каждое изменение аминокислотного остатка в сортированной библиотеке по сравнению с библиотекой дисплея в которой изменение аминокислотного остатка идентифицируется как придающее повышенную стабильность антителу, если оно обогащено в сортированной библиотеке по сравнению с библиотекой дисплея. В некоторых случаях способ дополнительно включает в себя идентификацию аминокислотного остатка, который обеспечивает усиленное связывание антитела с молекулой-мишенью, например, как описано выше.

Любой из предыдущих способов может дополнительно включать в себя определение частоты, с которой каждое изменение аминокислоты присутствует в библиотеке дисплея и сортированной библиотеке посредством массового параллельного секвенирования на следующем этапе (b).

В некоторых случаях изменение аминокислотного остатка может быть обогащено по меньшей мере в 2 раза в сортированной библиотеке по сравнению с библиотекой дисплея. Например, изменение аминокислотного остатка может быть обогащено в 1,25 раза, в 1,5 раза, в 2 раза, в 3 раза, в 4 раза, в 5 раз, в 6 раз, в 7 раз, в 8 раз, в 9 раз, в 10 раз, в 11 раз, в 12 раз, в 14 раз, в 16 раз или более в сортированной библиотеке по сравнению с библиотекой дисплея.

Библиотека дисплея может включать любое подходящее количество вариантов антител, например, от около 1×103 до около 1×1012 или более (например, около 1×103, около 1×104, около 1×105, около 1×106, около 1×107, около 1,5×107, около 2,5×107, около 1x108, около 5×108, около 1×109, около 5×109, около 1×1010, около 1×1011, около 1×1012 или более) вариантов антител. В некоторых вариантах осуществления изобретения, библиотека дисплея может включать в себя около 3×109 вариантов антитела. В других вариантах осуществления изобретения, библиотека дисплея может включать в себя около 8×108 вариантов антитела.

В любом из предыдущих способов, изменение аминокислотного остатка может быть кодировано любым подходящим набором кодонов. Например, в некоторых случаях изменение аминокислотного остатка кодируется набором вырожденных кодонов. Способы замещения выбранной аминокислоты в матричной нуклеиновой кислоте хорошо известны в данной области, некоторые из которых описаны в данном документе. См. также патент США № 7985840, который включен в настоящее описание посредством ссылки во всей его полноте. Например, библиотеки, описанные выше или в разделе «Примеры» ниже, могут быть созданы путем замены аминокислот вариантными аминокислотами с использованием метода Кункеля. См., например, Kunkel et al., Methods Enzymol. 154:367-382, 1987.

Изменение аминокислотного остатка может быть кодировано любым подходящим набором кодонов. Множество кодонов представляет собой набор различных нуклеотидных триплетных последовательностей, используемых для кодирования желаемых аминокислот. Наборы кодонов могут быть представлены с использованием символов для обозначения конкретных нуклеотидов или эквимолярных смесей нуклеотидов, как показано ниже в соответствии с кодом IUB.

КОДЫ IUB

G Гуанин

A Аденин

T Тирамин

C Цитозин

R (A или G)

Y (C или T)

M (A или C)

K (G или T)

S (C или G)

W (A или T)

H (A или C или T)

B (C или G или T)

V (A или C или G)

D (A или G или T)

N (A или C или G или T)

В качестве иллюстративного примера, в наборе кодонов DVK, D может быть нуклеотидами A или G или T; V может быть A или G или C; и K может быть G или T. Это множество кодонов может содержать 18 различных кодонов и может кодировать аминокислоты Ala, Trp, Tyr, Lys, Thr, Asn, Ser, Arg, Asp, Glu, Gly и Cys.

Олигонуклеотидные или праймерные наборы могут быть синтезированы с использованием стандартных способов. Набор олигонуклеотидов может быть синтезирован, например, путем твердофазного синтеза, содержащего последовательности, которые представляют все возможные комбинации нуклеотидных триплетов, предоставляемых набором кодонов, и которые будут кодировать желаемую группу аминокислот. Синтез олигонуклеотидов с выбранным нуклеотидным «вырождением» в определенных положениях хорошо известен в этой области техники. Такие наборы нуклеотидов, имеющих определенные наборы кодонов, могут быть синтезированы с использованием коммерческих синтезаторов нуклеиновых кислот (доступны, например, от Applied Biosystems, Фостер Сити, Калифорния), или могут быть получены коммерчески (например, из Life Technologies, Роквилль, Мэриленд). Следовательно, набор олигонуклеотидов, синтезированных с конкретным набором кодонов, обычно включает в себя множество олигонуклеотидов с различными последовательностями, различия, установленные набором кодонов в общей последовательности. Олигонуклеотиды, используемые в соответствии с изобретением, имеют последовательности, которые допускают гибридизацию с шаблоном нуклеиновой кислоты с вариабельным участком, а также могут включать сайты рестрикционных ферментов для целей клонирования.

В любом из предыдущих способов для кодирования изменений аминокислотных остатков можно использовать набор вырожденных кодонов. В некоторых случаях набор вырожденных кодонов представляет собой набор NNK или NNS кодонов, где N представляет собой A, C, G или T; K представляет собой G или T; и S представляет собой C или G. В особых случаях набор вырожденных кодонов представляет собой набор кодонов NNK.

Следует понимать, что любой подходящий способ дисплея, известный в данной области техники или описанный в данном документе, может использоваться в сочетании с любым из предыдущих способов. Например, способы могут включать в себя фаговый дисплей, бактериальный дисплей, дисплей дрожжей, дисплей млекопитающих, дисплей рибосом и/или дисплей мРНК. В любом из предыдущих способов может использоваться любая подходящая библиотека дисплея. Например, библиотека отображения может быть выбрана из группы, состоящей из библиотеки фагового дисплея, библиотеки дисплея бактерий, библиотеки дисплея дрожжей, библиотеки дисплея млекопитающих, библиотеки дисплея рибосом и библиотеки дисплея мРНК. В конкретных вариантах осуществления изображения, библиотека дисплея представляет собой библиотеку фагового дисплея.

Слитые полипептиды вариабельного домена антитела могут быть отображены на поверхности клетки, вируса, фагемида или других частиц в различных форматах. Эти форматы включают, например, scFv, Fab и многовалентные формы этих фрагментов. Многовалентные формы могут представлять собой димер ScFv, Fab или Fab', называемый в данном документе (ScFv)2, Fab2 и F(ab')2 соответственно. Способы дисплея слитых полипептидов, содержащих фрагменты антител, на поверхности бактериофага хорошо известны в данной области, например, как описано в публикации патентной публикации номер WO 92/01047 и в данном документе. Другие патентные публикации, например, WO 92/20791; WO 93/06213; WO 93/11236 и WO 93/19172, описывают связанные способы. Другие публикации показали идентификацию антител с искусственно перестроенными репертуарами V-гена против множества антигенов, отображаемых на поверхности фага (см., например, Hoogenboom et al., J. Mol. Biol. 227: 381-388, 1992; и как описано в WO 93/06213 и WO 93/11236).

В любом из предыдущих способов библиотека дисплея может быть отсортирована (выбрана) и/или скринирована, чтобы идентифицировать, например, связывание с высоким сродством к антигену. Сортировка может выполняться, как описано в данном документе, или другими подходами, известными в данной области техники. См., например, патент США 7985840. В некоторых вариантах осуществления изобретения, сортировка может включать в себя контактирование библиотеки дисплея с иммобилизованным антигеном (например, молекулой-мишенью или ее эпитопом). В других вариантах осуществления изобретения, сортировка может включать контактирование библиотеки дисплея с растворимым антигеном. Варианты антител, которые были выбраны, могут быть дополнительно подвергнуты скринингу, чтобы охарактеризовать вариант антитела с точки зрения аффинности связывания (например, с помощью SPR), стабильности, сворачивания, структуры (например, с помощью рентгеновской кристаллографии) или других атрибутов.

Любой из предыдущих способов может включать в себя массовое параллельное секвенирование, например, для определения частоты изменения с которой аминокислотный остаток появляется в библиотеке после сортировки (называемой сортированной библиотекой) по сравнению с частотой изменения с которой аминокислотный остаток появляется в несортированной библиотеке. Широкий спектр подходов для массового параллельного секвенирования известен в данной области техники, и любой подходящий подход может быть использован в способах по изобретению. См., например, Metzker, Nature Reviews Genetics 11: 31-36, 2010, которая включена в настоящее описание посредством ссылки в полном объеме. Типичные подходы включают в себя массивно-параллельное опознавательное секвенирование (MPSS), полони-секвенирование, пиросеквенирование (454/Roche Diagnostics), ионное полупроводниковое секвенирование, одномолекулярное секвенирование в реальном времени, секвенирование путем синтеза, секвенирование путем лигирования. Коммерчески доступные массивные параллельные платформы для секвенирования доступны в Roche Diagnostics и других компаниях. Секвенирование может быть глубоким секвенированием, ультра-глубоким секвенированием и/или последовательностью следующего поколения.

В любом из предыдущих способов, способ может включать в себя определение последовательности по меньшей мере около 100 000 считываний или более (например, 100 000 чтений, 200 000 чтений, 300 000 чтений, 400 000 считываний, 500 000 чтений, 600 000 чтений, 700 000 считываний, 800 000 чтений, 900 000 чтение, 1 000 000 чтений, 2×106 чтений, 3×106 чтений, 4×106 чтений, 5×106 чтений, 6×106 чтений, 7×106 чтений, 8×106 чтений, 9×106 чтений, 107 чтений, 108 чтений, 109 чтений или 1010 чтений или более). Способ может включать секвенирование на любой подходящей глубине.

В любом из предыдущих способов антитело может быть моноклональным антителом. В любом из предшествующих способов антитело может быть антителом IgG. В любом из предыдущих способов антитело может быть фрагментом антитела. Фрагмент антитела может быть выбран из группы, состоящей из Fab, scFv, Fv, Fab', Fab-C, Fab'-SH, F(ab')2 и диатела. В конкретных случаях фрагмент антитела представляет собой Fab.

В любом из предшествующих способов двойное специфическое антитело может быть моноклональным антителом. В любом из предшествующих способов, двойным специфическим антителом может быть антитело IgG. В любом из предшествующих способов, двойное специфическое антитело может быть фрагментом антитела. Фрагмент антитела может быть выбран из группы, состоящей из Fab, scFv, Fv, Fab-C, Fab', Fab'-SH, F(ab')2 и диатела. В конкретных случаях фрагмент антитела представляет собой Fab.

Любой из предыдущих способов может дополнительно включать в себя получение антитела, которое было идентифицировано с помощью этапов способа. Описанные выше способы могут быть использованы с любым из описанных в данном документе антител.

J. Окулярные долгосрочные подходы к доставке антител против VEGF

Изобретение относится к композициям для лечения окулярных расстройств, которые могут использоваться для доставки анти-VEGF антител длительного действия (включая любое антитело против VEGF, описанное в данном документе, например G6.31 AARR) в глаз. Например, изобретение обеспечивает конъюгаты антител, которые включают антитело против VEGF, описанное в данном документе (например, конъюгаты Fab или Fab-C антитела). Изобретение также обеспечивает слитые белки (например, слитые белки Fab). В других аспектах изобретение обеспечивает составы (например, полимерные составы), которые включают антитело против VEGF, описанное в данном документе. Изобретение также относится к устройствам, которые могут быть использованы для окулярного введения антитела против VEGF, описанного в данном документе. Изобретение также относится к фармацевтическим композициям, которые включают конъюгаты антител, слитые белки и/или составы (например, полимерные композиции), описанные в данном документе. Эти композиции могут быть использованы в любом из описанных в данном документе терапевтических способов, например, способы лечения окулярного расстройства (например, AMD (например, влажная AMD), DME, DR (например, NPDR или PDR) или RVO (например, CRVO или BRVO)).

1. Конъюгаты антител

Изобретение обеспечивает конъюгаты антител, которые включают антитело против VEGF и полимер, ковалентно присоединенный к антителу. Антитело против VEGF может быть ковалентно присоединено к полимеру необратимым образом или обратимым образом. Может быть использован любой подходящий полимер, включая описанные в данном документе или другие, известные в данной области. Полимер может представлять собой гидрофильный полимер или гидрофобный полимер. Следует понимать, что гидрофильный полимер может быть водорастворимым полимером. Может быть использован любой подходящий гидрофильный полимер, например гидрофильный полимер, описанный в публикации международной патентной заявки № WO 2011/066417 и/или Pelegri-O'Day et al. J. Am. Chem. Soc. 136: 14323-14332, 2014, которые включены в данный документ посредством ссылки во всей их полноте. Иллюстративные неограничивающие гидрофильные полимеры, которые могут быть использованы, включают гиалуроновую кислоту (НА), полиэтиленгликоль (ПЭГ, также известный как поли(этиленгликоль)) (например, ПЭГ с прямой цепью, разветвленный ПЭГ, гребенчатый ПЭГ и дендритный ПЭГ), поли[этиленоксид)-ко-(метиленовый этиленоксид)], поли(поли(этиленгликоль) метиловый эфир метакрилата) (pPEGMA), агарозу, альгинат, карагенаны, карбоксиметилцеллюлозу, целлюлозу, производные целлюлозу, хитозан, хондроитинсульфат, коллаген, дерматансульфат, декстран, декстрансульфат, фибрин, фибриноген, фибронектин, фукоидан, желатин, гликозаминогликаны (GAG), гликополимер, гепарин, сульфат гепарина, сильно разветвленный полисахарид (например, галактозный дендример), кератансульфат, метил-целлюлозу, гидроксипропилметилцеллюлозу (НРМС), поли(N-(2-гидроксипропил)метакриламид) (pHPMA), пектины, производные пектина, полисульфат пентозана, крахмал, гидроксиэтилкрахмал (ГЭК), стирол, витронектин, поли(акриловую кислоту), поли(метакриловую кислоту), поли(акриламид), поли(акриловую кислоту), поли(амины), поли(аминокислоты), поли(карбоксибетаин) (PCB), полиэлектролиты, поли(глутаминовую кислота) (PGA), поли(глицерин) (PG) (например, линейный, среднефункциональный, гиперразветвленный, или линейный гиперразветвленный PG), поли(малеиновую кислота), поли(2-оксазолин) (POZ), поли(2-этил-2-оксазолин, полисиаловая кислота (ПСА), полистирол, производные полистирола (например, заряженные производные полистиролы), поли(стиролсульфонат-со-PEGMA), поливинилпирролидон (ПВП), поли(N-акрилоилморфолин) (pNAcM) и их сополимеры. В некоторых случаях полимер представляет собой гидрофобный полимер, например, поли(лакто-со-гликолевую кислоту) (PLGA), полилактид (PLA) и полигликолид (PGA). Полимер может быть биоразлагаемым и/или биосовместимым.

В качестве примера полимер может включать любое подходящее количество мономеров, например, между 2 и около 1×104 мономеров (например, около 10, около 50, 100, около 200, около 300, около 400, около 500, около 600, около 700, около 800, около 900, около 1000, около 2000, около 3000, около 4000, около 5000, около 6000, около 7000, около 8000, около 9000 или около 1×104 мономеров) или более. Например, полимер может включать между около 50 и около 250 мономеров, около 50 и около 500 мономеров, между около 50 и около 1000 мономеров, между около 50 и около 2000 мономеров, между около 50 и около 3000 мономеров, между около 50 и около 4000 мономеров, между около 50 и около 5000 мономеров, между около 50 и около 6000 мономеров, между около 50 и около 7000 мономеров, между около 50 и около 8000 мономеров, между около 50 и около 9000 мономеров, между около 50 и около 10000 мономерами, между около 100 и около 250 мономеров, около 100 и около 500 мономеров, между около 100 и около 1000 мономеров, между около 100 и около 2000 мономеров, между около 100 и около 3000 мономеров, между около 100 и около 4000 мономеров, между около 100 и около 5000 мономеров, между около 100 до около 6000 мономеров, между около 100 до около 7000 мономеров, между около 100 до около 8000 мономеров, между около 100 до около 9000 мономеров, между около 100 и около 10000 мономеров, между около 250 до около 500 мономеров, между около 250 до около 1000 мономеров, между около 250 до около 2000 мономеров, между около 250 до около 3000 мономеров, между около 250 до около 4000 мономеров, между около 250 и около 5000 мономеров, между около 250 до около 6000 мономеров, между около 250 до около 7000 мономеров, между около 250 до около 8000 мономеров, между около 250 до около 9000 мономеров, между около 250 до около 10000 мономеров, между около 500 до около 1000 мономеров, между около 500 и около 2000 мономерами, между около 500 и около 3000 мономерами, между около 500 и около 4000 мономерами, между около 500 и около 5000 мономерами, между около 500 и около 6000 мономерами, между около 500 и около 7000 мономеров, между около 500 и около 8000 мономеров, между около 500 и около 9000 мономеров или между около 500 и около 10000 мономеров. В некоторых случаях полимер может включать около 500 мономеров.

Изобретение обеспечивает конъюгат антитела, который включает антитело против VEGF (например, антитело против VEGF, описанное в данном документе, такое как G6.31 AARR), ковалентно присоединенное к HA-полимеру. Такие конъюгаты антител иногда упоминаются в данном документе как «конъюгаты НА». В некоторых случаях полимер HA имеет молекулярную массу около 2,5 мегадальтона (MДa) или ниже (например, около 2,5 MДa или ниже, около 2,4 MДa или ниже, около 2,3 MДa или ниже, около 2,2. MДa или ниже, около 2,1 MДa или ниже, около 2,0 MДa или ниже, около 1,9 MДa или ниже, около 1,8 MДa или ниже, около 1,7 MДa или ниже, около 1,6 MДa или ниже, около 1,5 MДa или ниже, около 1,4 MДa или ниже около 1,3 МДа или ниже, около 1,2 МДа или ниже, около 1,1 МДа или ниже, около 1,0 МДа или ниже, около 900 кДа или ниже, около 800 кДа или ниже, около 700 кДа или ниже, около 600 кДа или ниже, около 500 кДа или ниже, около 400 кДа или ниже, около 300 кДа или ниже, около 200 кДа или ниже или около 100 кДа или ниже). В некоторых случаях полимер HA имеет молекулярную массу около 1 МДа или ниже (например, около 1,0 МДа или ниже, около 900 кДа или ниже, около 800 кДа или ниже, около 700 кДа или ниже, около 600 кДа или ниже, около 500 кДа или ниже, около 400 кДа или ниже, около 300 кДа или ниже, около 200 кДа или ниже или около 100 кДа или ниже). В некоторых случаях полимер HA имеет молекулярную массу между около 25 кДа и около 2,5 МДа (например, между около 25 кДа и около 2,5 мДа, между около 25 кДа и около 2 МДа, между около 25 кДа и около 1,5 МДа, между около 25 кДа и около 1 МДа, между около 25 кДа и около 900 кДа, между около 25 кДа и около 800 кДа, между около 25 кДа и около 700 кДа, между около 25 кДа и около 600 кДа, между около 25 кДа и около 500 кДа, между около 100 кДа и около 2,5 мДа, между около 100 кДа и около 2 МДа, между около 100 кДа и около 1,5 МДа, между около 100 кДа и около 1 МДа, между около 100 кДа и около 900 кДа, между около 100 кДа и около 800 кДа, между около 100 кДа и около 700 кДа, между около 100 кДа и около 600 кДа, между около 100 кДа и около 500 кДа, между около 250 кДа и около 2,5 МДа, между около 250 кДа и около 2 MДa, между около 250 кДа и около 1,5 МДа, между около 250 кДа и около 1 МДа, между около 250 кДа и около 900 кДа, между около 250 кДа и около 800 кДа, между около 250 кДа и около 700 кДа, между около 250 кДа и около 600 кДа, между около 250 кДа и около 500 кДа, между около 500 кДа и около 2,5 МДа, между около 500 кДа и около 2 МДа, между около 500 кДа и около 1,5 МДа, между около 500 кДа и около 1 МДа, между около 500 кДа и около 900 кДа, между около 500 кДа и около 800 кДа, между примерно 500 кДа и около 700 кДа, между около 500 кДа и около 600 кДа, между около 1 MДa и около 2,5 MДa, между около 1 MДa и около 2 MДa, между около 1 MДa и около 1,5 MДa, между около 1 MДa и около 1,25 MДa, между около 1,25 МДа и около 2,5 МДа, между около 1,25 МДа и около 2 МДа, между около 1,25 МДа и около 1,5 МДа, между около 1,5 МДа и около 2,5 МДа, между около 1,5 МДа и около 2 МДа, между около 1,5 МДа и около 1,75 МДа или между 1,75 МДа и около 2,5 МДа).

В некоторых случаях полимер HA имеет молекулярную массу между около 25 кДа и около 500 кДа (например, между около 25 кДа и около 500 кДа, между около 25 кДа и около 450 кДа, между около 25 кДа и около 400 кДа, между около 25 кДа и около 350 кДа, между около 25 кДа и около 300 кДа, между около 25 кДа и около 300 кДа, между около 25 кДа и около 250 кДа, между около 25 кДа и около 200 кДа, между около 25 кДа и около 150 кДа, между около 25 кДа и около 100 кДа, между около 25 кДа и около 50 кДа, между приблизительно 40 кДа и приблизительно 500 кДа, между около 40 кДа и около 450 кДа, между около 40 кДа и около 400 кДа, между около 40 кДа и около 350 кДа, между около 40 кДа и около 300 кДа, между около 40 кДа и около 300 кДа, между около 40 кДа и около 250 кДа, между около 40 кДа и около 200 кДа, между около 40 кДа и около 150 кДа, между около 40 кДа и около 100 кДа, между около 40 кДа и около 50 кДа, между около 50 кДа и около 500 кДа, между около 50 кДа и около 450 кДа, между около 50 кДа и около 400 кДа, между около 50 кДа и около 350 кДа, между около 50 кДа и около 300 кДа, между около 50 кДа и около 300 кДа, между около 50 кДа и около 250 кДа, между около 50 кДа и около 200 кДа, между около 50 кДа и около 150 кДа, между около 50 кДа и около 100 кДа, между около 50 кДа и около 75 кДа, между около 100 кДа и около 500 кДа, между около 100 кДа и около 450 кДа, между около 100 кДа и около 400 кДа, между около 100 кДа и около 350 кДа, между около 100 кДа и около 300 кДа, между около 100 кДа и около 300 кДа, между около 100 кДа и около 250 кДа, между около 100 кДа и около 200 кДа, между около 100 кДа и около 150 кДа, между около 150 кДа и около 500 кДа, между около 150 кДа и около 450 кДа, между около 150 кДа и около 400 кДа, между около 150 кДа и около 350 кДа, между около 150 кДа и около 300 кДа, между около 150 кДа и около 300 кДа, между около 150 кДа и около 250 кДа, между около 150 кДа и около 200 кДа, между около 175 кДа и около 500 кДа, между около 175 кДа и около 450 кДа, между около 175 кДа и около 400 кДа, между около 175 кДа и около 350 кДа, между около 175 кДа и около 300 кДа, между около 175 кДа и около 300 кДа, между 175 200 кДа и около 250 кДа, между около 175 кДа и около 225 кДа, между около 200 кДа и около 500 кДа, между около 200 кДа и около 450 кДа, между около 200 кДа и около 400 кДа, между около 200 кДа и около 350 кДа, между около 200 кДа и около 300 кДа, между около 200 кДа и около 300 кДа, между около 200 кДа и около 250 кДа, или между около 200 кДа и около 225 кДа).

В некоторых случаях полимер HA имеет молекулярную массу от около 100 кДа до около 250 кДа (например, около 100 кДа, около 110 кДа, около 120 кДа, около 130 кДа, около 140 кДа, около 150 кДа, около 160 кДа, около 170 кДа, около 180 кДа, около 190 кДа, около 200 кДа, около 210 кДа, около 220 кДа, около 230 кДа, около 240 кДа или около 250 кДа). В конкретных случаях полимер HA имеет молекулярную массу около 200 кДа.

Любая из предшествующих молекулярных масс может представлять собой средневесовую молекулярную массу (также известную как среднемассовая молярная масса).

В некоторых случаях любой из предшествующих HA-полимеров является линейным, т.е. не сшитым.

В других случаях изобретение обеспечивает конъюгат антитела, который включает антитело против VEGF (например, антитело против VEGF, описанное в данном документе), ковалентно присоединенное к ПЭГ-полимеру. Такие конъюгаты антител иногда упоминаются как «конъюгаты ПЭГ». Может использоваться любой подходящий полимер ПЭГ. ПЭГ может представлять собой разветвленный ПЭГ, звездчатый ПЭГ или гребенчатый ПЭГ. ПЭГ-полимер может быть, например, тетрамером ПЭГ, гексамером ПЭГ или октамером ПЭГ. В некоторых случаях конъюгат антитела включает антитело против VEGF (например, антитело против VEGF, описанное в данном документе, такое как G6.31 AARR), ковалентно прикрепленное к ПЭГ-дендримеру. Полимеры ПЭГ коммерчески доступны, например, от JenKem Technology, Quanta BioDesign, NOF America Corporation и других производителей.

В некоторых случаях полимер ПЭГ имеет молекулярную массу между около 1 кДа и около 500 кДа (например, между около 1 кДа и около 500 кДа, между около 1 кДа и около 450 кДа, между около 1 кДа и около 400 кДа, между около 1 кДа и около 350 кДа, между около 1 кДа и около 300 кДа, между около 1 кДа и около 300 кДа, между около 1 кДа и около 250 кДа, между около 1 кДа и около 200 кДа, между около 1 кДа и около 150 кДа, между около 1 кДа и около 100 кДа, между около 1 кДа и около 50 кДа, между около 10 кДа и около 500 кДа, между около 10 кДа и около 450 кДа, между около 10 кДа и около 400 кДа, между около 10 кДа и около 350 кДа, между около 10 кДа и около 300 кДа, между около 10 кДа и около 300 кДа, между около 10 кДа и около 250 кДа, между около 10 кДа и около 200 кДа, между около 10 кДа и около 150 кДа, между около 10 кДа и около 100 кДа, между около 10 кДа и около 50 кДа, между около 20 кДа и около 500 кДа, между около 20 кДа и около 450 кДа, между около 20 кДа и около 400 кДа, между около 20 кДа и около 350 кДа, между около 20 кДа и около 300 кДа, между около 20 кДа и около 300 кДа, между около 20 кДа и около 250 кДа, между около 20 кДа и около 200 кДа, между около 20 кДа и около 150 кДа, между около 20 кДа и около 100 кДа, между около 20 кДа и около 75 кДа, между около 30 кДа и около 500 кДа, между около 30 кДа и около 450 кДа, между около 30 кДа и около 400 кДа, между около 30 кДа и около 350 кДа, между около 30 кДа и около 300 кДа, между около 30 кДа и около 300 кДа, между около 30 кДа и около 250 кДа, между около 30 кДа и около 200 кДа, между около 30 кДа и около 150 кДа, между около 40 кДа и около 500 кДа, между около 40 кДа и около 450 кДа, между около 40 кДа и около 400 кДа, между около 40 кДа и около 350 кДа, между около 40 кДа и около 300 кДа, между около 40 кДа и около 300 кДа, между около 40 кДа и около 250 кДа, между около 40 кДа и около 200 кДа, между около 50 кДа и около 500 кДа, между около 50 кДа и около 450 кДа, между около 50 кДа и около 400 кДа, между около 50 кДа и около 350 кДа, между около 50 кДа и около 300 кДа, между около 50 кДа и около 300 кДа, между около 50 кДа и 200 кДа и около 250 кДа, или между около 50 кДа и около 225 кДа).

В некоторых случаях полимер ПЭГ имеет молекулярную массу от около 5 кДа до около 250 кДа (например, около 1 кДа, около 5 кДа, около 10 кДа, около 15 кДа, около 20 кДа, около 25 кДа, около 30 кДа, около 35 кДа, около 40 кДа, около 50 кДа, около 60 кДа, около 70 кДа, около 80 кДа, около 90 кДа, 100 кДа, около 110 кДа, около 120 кДа, около 130 кДа, около 140 кДа, около 150 кДа , около 160 кДа, около 170 кДа, около 180 кДа, около 190 кДа, около 200 кДа, около 210 кДа, около 220 кДа, около 230 кДа, около 240 кДа или около 250 кДа). В конкретных случаях полимер ПЭГ имеет молекулярную массу около 20 кДа. В других случаях полимер ПЭГ имеет молекулярную массу около 40 кДа.

Любая из предшествующих молекулярных масс может представлять собой средневесовую молекулярную массу (также известную как среднемассовая молярная масса).

В некоторых случаях ПЭГ-полимер представляет собой тетрамер ПЭГ. ПЭГ-тетрамеры коммерчески доступны в, например, NOF America SUNBRIGHT® PTE-400MA, PTE-200MA, PTE-100MA и JenKem Technology USA 4 рукавный ПЭГ малеимид (кат. № 4ARM-MAL). В некоторых случаях тетрамер ПЭГ имеет ядро пентаэритритола. Например, в некоторых случаях тетрамер ПЭГ включает в себя структуру формулы (I), где n независимо представляет любое подходящее целое число:

Формула I:

В другом примере, в некоторых случаях, ПЭГ-полимер представляет собой гексамер ПЭГ. Гексамеры ПЭГ являются коммерчески доступными, например, JenKem Technology USA 6 рукавный ПЭГ амин (кат. № 6ARM(DP)-NH2HCl) или гексамеры ПЭГ из Quanta BioDesign. В некоторых случаях гексамер ПЭГ включает ядро дипентилэритритола.

В некоторых случаях ПЭГ-полимер представляет собой октамер ПЭГ. ПЭГ-октамеры являются коммерчески доступными, например, серия NOF America SUNBRIGHT® HGEO или JenKem Technology USA 8 arm ПЭГ малеимид (кат. № 8ARM(TP)-MAL). В некоторых случаях октамер ПЭГ может включать ядро трипентаэритритола. Например, в некоторых случаях октамер ПЭГ включает в себя структуру формулы (II), где n независимо представляет любое подходящее целое число:

Формула II:

В еще одном примере, в некоторых случаях, октамер ПЭГ включает в себя трипентаэритритоловое ядро.

Следует понимать, что любой подходящий подход конъюгации, в том числе описанный в данном документе, и другие, известные в данной области, могут быть использованы для конъюгации антитела против VEGF по изобретению с полимером. Например, полимер может быть конъюгирован с любой подходящей функциональной группой белка, включая первичную аминогруппу, карбоксильную группу, сульфгидрильную группу или карбонильную группу. Любая подходящая химически реакционная группа может быть использована для нацеливания на функциональную группу белка, например, карбодиимид (например, EDC), эфир NHS, имидоэфир, пентафторфениловый эфир, гидроксиметилфосфин, малеимид, галоацетил (например, бромоацетил или йодоацетил), пиридилдисульфид, тиосульфонат, винилсульфон, гидразин, алкоксиамин, диазирин, арилазид, изоцианат или другие, известные в данной области. См., например, Hermanson, Bioconjugate Techniques, 3rd Edition, 2013.

Любой из предшествующих конъюгатов антител может иметь гидродинамический радиус между около 5 нм и около 200 нм (например, около 5 нм, около 10 нм, около 20 нм, около 30 нм, около 40 нм, около 50 нм, около 60 нм, около 70 нм, около 80 нм, около 90 нм, около 100 нм, около 110 нм, около 120 нм, около 130 нм, около 140 нм, около 150 нм, около 160 нм, около 170 нм, около 180 нм, около 190 нм или около 200 нм). В некоторых случаях конъюгат антитела имеет гидродинамический радиус между около 5 нм и около 150 нм (например, около 5 нм, около 10 нм, около 20 нм, около 30 нм, около 40 нм, около 50 нм, около 60 нм, около 70 нм, около 80 нм, около 90 нм, около 100 нм, около 110 нм, около 120 нм, около 130 нм, около 140 нм или около 150 нм). В некоторых случаях конъюгат антитела имеет гидродинамический радиус между около 5 нм и около 100 нм (например, около 5 нм, около 10 нм, около 20 нм, около 30 нм, около 40 нм, около 50 нм, около 60 нм, около 70 нм, около 80 нм, около 90 нм или около 100 нм). В некоторых случаях конъюгат антитела имеет гидродинамический радиус между около 5 нм и около 60 нм (например, около 5 нм, около 10 нм, около 20 нм, около 30 нм, около 40 нм, около 50 нм, около 60 нм). В некоторых случаях конъюгат антитела имеет гидродинамический радиус между около 25 нм и около 35 нм (например, около 25 нм, около 26 нм, около 27 нм, около 28 нм, около 29 нм, около 30 нм, около 31 нм, около 32 нм, около 33 нм, около 34 нм или около 35 нм). В некоторых случаях гидродинамический радиус составляет около 28 нм.

В некоторых случаях конъюгат антитела имеет гидродинамический радиус между около 10 нм и около 200 нм, между около 10 нм и около 180 нм, между около 10 нм и около 160 нм, между около 10 и около 140 нм, между около 10 нм и около 120 нм, между около 10 нм и около 100 нм, между около 10 нм и около 80 нм, между около 10 нм и около 60 нм, между около 10 нм и около 50 нм, между около 10 нм и около 40 нм, между около 10 нм и около 30 нм, между около 20 нм и около 200 нм, между около 20 нм и около 180 нм, между около 20 нм и около 160 нм, между около 20 нм и около 140 нм, между около 20 нм и около 120 нм, между около 20 нм и около 100 нм, между около 20 нм и около 80 нм, между около 20 нм и около 60 нм, между около 20 нм и около 50 нм, между около 20 нм и около 40 нм, между около 20 нм и около 30 нм, между около 30 нм и около 200 нм, между около 30 нм и около 180 нм, между около 30 нм и около 160 нм, между около 30 нм и около 140 нм, между около 30 нм и около 120 нм, между около 30 нм и около 100 нм, между около 30 нм и около 80 нм, между около 30 нм и около 60 нм, между около 30 нм и около 50 нм, между около 30 нм и около 40 нм, между около 40 нм и около 200 нм, между около 40 до около 180 нм, между около 40 до около 160 нм, между около 40 до около 140 нм, между около 40 нм и около 120 нм, между около 40 нм и около 100 нм, между около 40 нм и около 80 нм, между около 40 нм и около 60 нм, между около 40 нм и около 50 нм, между около 50 нм и около 200 нм, между около 50 нм и около 180 нм, между около 50 нм и около 160 нм, между около 50 нм и около 140 нм, между около 50 нм и около 120 нм, между около 50 нм и около 100 нм, между около 50 нм и около 80 нм, между около 50 нм и около 60 нм, между около 60 нм и около 200 нм, между около 60 нм и около 180 нм, между около 60 нм и около 160 нм, между около 60 нм и около 140 нм, между около 60 нм и около 120 нм, между около 60 нм до около 100 нм или между около 60 нм и около 80 нм.

В некоторых случаях конъюгат антитела представляет собой конъюгат антител пролекарства (также называемый пролекарством, связанным с носителем), в котором антитело против VEGF (например, антитело против VEGF, описанное в данном документе, например, G6.31 AARR) является обратимо конъюгированным с носителем (например, гидрогелем), например, с помощью линкера (например, обратимого пролекарственного линкера). Этот подход описан далее, например, в публикациях международной патентной заявки WO 2006/003014, WO 2009/095479, WO 2011/012715, WO 2013/053856 и WO 2014/056923, которые включены в данный документ посредством ссылки во всей их полноте. Такие пролекарства конъюгатов антител коммерчески доступны от Ascendis Pharma (например, технологической платформы TransCon). Линкер может иметь присущие саморасщепляющиеся свойства (например, линкер может быть не ферментативно гидролизован при введении в глаз), что приводит к контролируемому во времени высвобождению антитела против VEGF в глаз (например, стекловидное тело).

Например, в некоторых случаях изобретение обеспечивает пролекарство конъюгата антитела, который включает антитело против VEGF (например, антитело против VEGF, описанное в данном документе, например, G6.31 AARR), которое ковалентно прикрепляется к носителю с помощью линкера. В конкретных случаях линкер представляет собой обратимый пролекарственный линкер. В некоторых случаях носитель включает полимер, например ПЭГ. Например, ПЭГ может быть линейным, разветвленным, многорукавным или дендритным ПЭГ. В некоторых случаях носитель представляет собой гидрогель, включающий биодеградируемый гидрогель. Можно использовать любой подходящий гидрогель, например, гидрогель на основе ПЭГ. Гидрогель на основе ПЭГ может включать, например, по меньшей мере 10 % ПЭГ, по меньшей мере 20 % ПЭГ, по меньшей мере 30 % ПЭГ или более. Гидрогель может иметь форму микрочастиц гранул. Такие микрочастицы гранулы могут иметь диаметр от около 1 мкм до около 1000 мкм, например, от около 5 мкм до около 500 мкм, от около 10 мкм до около 100 мкм, от около 20 мкм до около 100 мкм или от около 20 мкм до около 80 мкм. Диаметры гранул можно измерить, когда микрочастицы гранулы суспендируют в изотоническом водном буфере. В некоторых случаях гидрогель может быть любым гидрогелем, описанным в WO 2006/003014 или WO 2011/012715.

В любом из предыдущих конъюгатов антитела, антитело может представлять собой фрагмент антитела, который связывает VEGF, например, фрагмент антитела анти-VEGF антитела, описанного в данном документе, который связывает VEGF. В некоторых случаях фрагмент антитела выбирают из группы, состоящей из Fab, Fab', Fab-C, Fab'-SH, Fv, scFv и (Fab')2 фрагментов. В конкретных случаях фрагмент антитела представляет собой Fab, Fab'или Fab-C. В некоторых случаях фрагмент антитела представляет собой Fab-C.

Любой из предшествующих конъюгатов антитела может иметь период окулярного полувыведения, который увеличен по сравнению с контрольным антителом, которое нековалентно связано с полимером (например, гидрофильным полимером). В некоторых случаях период окулярного полувыведения увеличивают, по меньшей мере около в 2 раза (например, около в 2 раза, около в 3 раза, около в 4 раза, около в 5 раз, около в 6 раз, около в 7 раз, около в 8 раз, около в 9 раз, около в 10 раз, около в 12 раз, около в 14 раз, около в 16 раз, около в 18 раз, около в 20 раз или более) относительно эталонного антитела. В некоторых случаях период окулярного полувыведения увеличивается по меньшей мере около в 4 раза относительно эталонного антитела. В некоторых случаях период окулярного полувыведения представляет собой жизненный период жизни. В некоторых случаях, эталонное антитело идентично антителу конъюгата антитела. В других случаях эталонное антитело не идентично антителу конъюгата антитела.

Любой из предшествующих конъюгатов антител может иметь окулярный клиренс, который уменьшается, относительно эталонного антитела, которое не ковалентно связано с полимером (например, гидрофильным полимером). В некоторых случаях клиренс уменьшается, по меньшей мере около в 2 раза (например, около в 2 раза, около в 3 раза, около в 4 раза, около в 5 раз, около в 6 раз, около в 7 раз, около в 8 раз, около в 9 раз, около в 10 раз, около в 12 раз, около в 14 раз, около в 16 раз, около в 18 раз, около в 20 раз или более) относительно эталонного антитела. В некоторых случаях клиренс уменьшается, по меньшей мере на около в 4 раза относительно эталонного антитела. В некоторых случаях клиренс представляет собой клиренс из стекловидного тела. В некоторых случаях, эталонное антитело идентично антителу конъюгата антитела. В других случаях эталонное антитело не идентично антителу конъюгата антитела.

В некоторых случаях период времени между двумя внутриглазными введениями (например, интравитреальной инъекцией) любого из предыдущих конъюгатов антител (например, конъюгатов НА, конъюгатов ПЭГ и конъюгатов пролекарственных антител) составляет по меньшей мере 1 месяц, например, по меньшей мере 1 месяц, по меньшей мере 5 недель, по меньшей мере 6 недель, по меньшей мере 7 недель, по меньшей мере 8 недель, по меньшей мере 9 недель, по меньшей мере 10 недель, по меньшей мере 11 недель, по меньшей мере 12 недель, по меньшей мере 13 недель, по меньшей мере 14 недель, по меньшей мере 15 недель, по меньшей мере 16 недель, по меньшей мере 20 недель, по меньшей мере 24 недели, по меньшей мере 28 недель, по меньшей мере 32 недели, по меньшей мере 36 недель, по меньшей мере 40 недель, по меньшей мере 44 недели, по меньшей мере 48 недель, по меньшей мере 52 недель или более. В некоторых случаях максимальный период между двумя внутриглазными введениями длится не более четырех лет, например, не дольше чем три года, не дольше чем два года или дольше чем один год. Конъюгат антитела можно вводить, например, каждые два-двенадцать месяцев, например каждые четыре-десять месяцев. В некоторых случаях конъюгат антитела вводят каждые шесть месяцев.

Изобретение также обеспечивает композиции (например, фармацевтические композиции), которые включают любые конъюгаты антител, описанные выше (например, конъюгаты НА, конъюгаты ПЭГ и конъюгаты пролекарственных антител). В некоторых вариантах осуществления изобретения, композиция содержит одно или более дополнительных соединений. В некоторых вариантах осуществления изобретения, дополнительное соединение связывается со второй биологической молекулой, выбранной из группы, состоящей из IL-1β, IL-6; IL-6R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie-2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNF-альфа; HTRA1; рецептора VEGF; рецептора ST-2; и белков, генетически связанных с возрастной макулярной дегенерацией (AMD), такие как компоненты комплемента пути C2, фактора B, фактор H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; интерлейкина (IL-8); CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, дополнительное соединение представляет собой антитело или его антигенсвязывающий фрагмент. Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157, или его вариант). В другом примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант. В еще одном дополнительном примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6R, например, токилизумаб (ACTEMRA®) (см., например, WO 1992/019579), сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

Изобретение также предлагает композиции (например, фармацевтические композиции), которые включают любые конъюгаты антител, описанные выше (например, конъюгаты НА, конъюгаты ПЭГ и конъюгаты пролекарственных антител) и дополнительный антагонист VEGF.

2. Слитые белки

Изобретение обеспечивает слитые белки, которые включают антитело против VEGF (например, любое антитело против VEGF, описанное в данном документе, например, G6.31 AARR) и окулярно-связывающий домен. Окулярный связывающий домен может связываться, например, с биологическим веществом, находящимся в глазу (например, роговицей, стекловидным стеклом, сетчаткой, эпителием сетчатки или сосудистой оболочкой), что может увеличить время удержания в глазу (например, витреального) (например, путем увеличения периода полувыведения и/или уменьшения клиренса) антитела. Окулярный связывающий домен может связываться с любым подходящим биологическим веществом, включая, например, компонент внеклеточного матрикса. Например, подходящие биологические вещества в глазу (например, стекловидное тело) могут включать внеклеточный матричный компонент, такой как углевод (например, заряженный углевод (например, гликозаминогликан)), гликопротеин (например, фибриллин и оптицин) и белок (например, коллаген (например, типы коллагена I-XXVII, в частности коллаген II, коллаген IX, коллаген V, коллаген VI, коллаген XI и гетеротипические фибриллы коллагена) или другие компоненты внеклеточного матрикса, описанные, например, в Le Goff et al., Eye 22: 1214-1222, 2008. В некоторых случаях компонент внеклеточного матрикса представляет собой гликозаминогликан, например, гиалуроновую кислоту (HA) или протеогликан (например, хондроитинсульфат или сульфат гепарина). В конкретных случаях гликозаминогликан представляет собой НА. Связывающие HA домены, а также слитые белки, которые включают HA-связывающие домены, описаны, например, в Park et al., Molecular Pharmaceutics 6 (3): 801-812, 2009; Патенты США № 5986052, 7183377, 7723472 и 8846034; публикация патентной заявки США № 2004/005277; и международной патентной заявки № WO 1998/052590, WO 2010/045506, WO 2014/099997, WO 2015/198243, WO 2015/110809, которые включены в данный документ путем ссылки во всей их полноте. Окулярный связывающий домен может быть ковалентно присоединен к антителу, например, с помощью рекомбинантно-слитого с антителом против VEGF. В других случаях окулярный связывающий домен может быть ковалентно конъюгирован или нековалентно конъюгирован (например, с помощью связывания биотин-стрепавидин) с антителом против VEGF.

Например, изобретение обеспечивает слитый белок, который включает антитело против VEGF (например, любое антитело против VEGF, описанное в данном документе, такое как G6.31 AARR), ковалентно присоединенное к HA-связывающему домену. В некоторых случаях HA-связывающий домен ковалентно присоединен к тяжелой цепи или легкой цепи антитела. Например, HA-связывающий домен ковалентно присоединен к тяжелой цепи. В другом примере связывающий домен HA ковалентно присоединен к легкой цепи. HA-связывающий домен может быть ковалентно присоединен к анти-VEGF антителу в любом подходящем месте, например N-конце, C-конце или внутреннем сайте (например, вставке). HA-связывающий домен может ковалентно присоединяться к С-концу тяжелой цепи или к С-концу легкой цепи. Например, в некоторых случаях HA-связывающий домен ковалентно присоединен к С-концу тяжелой цепи. В других случаях HA-связывающий домен ковалентно присоединен к С-концу легкой цепи.

В любом из предшествующих слитых белков, слитый белок может дополнительно включать линкер, причем линкер расположен между антителом и HA-связывающим доменом. Любой подходящий линкер может быть использован, например, (Glyn-Sern)n или (Sern-Glyn)n-линкер, где n независимо представляет собой целое число, равное или больше чем 1 (например, 1, 2, 3, 4, 5 , 6, 7, 8, 9, 10, 11, 12, 13 и более). В WO 2014/099997 описывается ряд линкеров, любой из которых может быть использован в слитых белках по изобретению. В некоторых случаях, линкер может включать аминокислотную последовательность GGGGS (SEQ ID NO: 61). В некоторых случаях, линкер может состоять из аминокислотной последовательности GGGGS (SEQ ID NO: 61). Другие подходящие линкеры включают (Gly4Ser)4, (Gly4Ser)3 и тому подобное. В некоторых случаях, серин можно заменить аланином (например, (Gly4Ala) или (Gly3Ala)).

В любом из предыдущих слитых белков, антитело может представлять собой фрагмент антитела, который связывает VEGF. В некоторых случаях фрагмент антитела выбирают из группы, состоящей из Fab, Fab', Fab-C, Fab'-SH, Fv, scFv и (Fab')2 фрагментов. Например, в некоторых случаях фрагмент антитела представляет собой Fab, Fab'или Fab-C. В некоторых случаях HA-связывающий домен ковалентно присоединен к С-концу CH1 домена Fab. В других случаях, HA-связывающий белок ковалентно присоединен к C-концу CL домена Fab.

В любом из предыдущих слитых белков HA-связывающий домен может быть выбран из группы, состоящей из модуля связи, домена G1, богатого лизином олигопептида и других связывающих HA доменов, известных в данной области. Например, HA-связывающий домен может представлять собой любой связывающий HA домен, описанный в Park et al., Molecular Pharmaceutics 6 (3): 801-812, 2009; Патенты США № 5986052, 7183377, 7723472 и 8846034; Публикация патентной заявки США № 2004/005277; и/или международной патентной заявки № WO 1998/052590, WO 2010/045506, WO 2014/099997, WO 2015/198243, WO 2015/110809. Например, HA-связывающий домен может быть HA10, HA10.1, HA10.2, HA11 или HA11.1, как описано в WO 2014/099997.

В некоторых случаях, HA-связывающий домен является модулем связи. Может использоваться любой подходящий модуль связи. Например, в некоторых случаях модуль связи выбирают из группы, состоящей из TSG6, CD44, рецептора 1 гиалуроновой кислоты эндотелия лимфатического сосуда (LYVE-1), белка, связывающего гиалуроновую кислоту и протеогликан (HAPLN) 1, HAPLN2, HAPLN3, HAPLN4, аггрекана, бревикана, нейрокана, фосфакана, версикана, CAB61358, KIA0527, стабилина-1 и стабилина-2 или их вариантами. В некоторых случаях модуль связи является модулем связи TSG6, например, человеческим TSG6-модулем связи. В некоторых случаях, модуль связи HA-связывающего белка TSG6 может включать аминокислотные остатки 36-128 TSG6 человека (UniProt № доступа P98066).

Любой из предыдущих слитых белков может дополнительно включать по меньшей мере один дополнительный HA-связывающий домен. Например, слитый белок может дополнительно включать по меньшей мере 1, 2, 3, 4, 5, 6, 7 или 8 дополнительных HA-связывающих доменов(домена). В некоторых случаях, по меньшей мере один дополнительный HA-связывающий домен ковалентно присоединен к тяжелой цепи или легкой цепи антитела. Например, в некоторых случаях по меньшей мере один дополнительный HA-связывающий домен ковалентно присоединен к тяжелой цепи антитела. В других случаях, по меньшей мере один дополнительный HA-связывающий домен ковалентно присоединен к легкой цепи антитела. В некоторых случаях, по меньшей мере один дополнительный HA-связывающий белок соединен с антителом линкером. Может использоваться любой подходящий линкер, такой как линкер, описанный выше. В некоторых случаях линкер включает аминокислотную последовательность GGGGS (SEQ ID NO: 61). В некоторых случаях, линкер состоит из аминокислотной последовательности GGGGS (SEQ ID NO: 61). В некоторых случаях, первый HA-связывающий домен ковалентно присоединен к тяжелой цепи, а второй HA- связывающий домен ковалентно присоединен к легкой цепи. По меньшей мере, один дополнительный HA-связывающий домен может быть ковалентно присоединен к анти-VEGF антителу в любом подходящем месте, например N-конце, C-конце или внутреннем сайте (например, вставке). В тех случаях, когда антитело включает в себя более чем один дополнительный HA-связывающий домен в антителе, вставки могут находиться в одном сайте в антителе или в нескольких различных сайтах в антителе. Например, в некоторых случаях, первый HA-связывающий домен соединен с C-концом тяжелой цепи, а второй HA-связывающий домен соединен с C-концом легкой цепи. В некоторых случаях, по меньшей мере один дополнительный HA-связывающий белок выбирают из группы, состоящей из модуля связи, домена G1 и богатого лизином олигопептида. Например, в некоторых случаях, по меньшей мере один дополнительный HA-связывающий белок представляет собой модуль связи. Модуль связи может быть любым модулем связи, описанным в данном документе или известным в данной области. В некоторых случаях модуль связи является модулем связи TSG6, например, человеческим TSG6-модулем связи. В некоторых случаях, модуль связи HA-связывающего белка TSG6 может включать аминокислотные остатки 36-128 TSG6 человека (UniProt № доступа P98066).

Любой из предшествующих слитых белков может специфически связываться с VEGF и HA. В некоторых случаях слитый белок связывает HA с Kd около 10 мкМ или ниже. Например, в некоторых случаях слитый белок связывает HA с Kd около 10 мкМ или ниже, 8 мкМ или ниже, 6 мкМ или ниже, 4 мкМ или ниже, 2 мкМ или ниже, 1 мкМ или ниже, 750 нМ или ниже, 500 нМ или ниже, 250 нМ или ниже, 100 нМ или ниже, 50 нМ или ниже, 10 нм или ниже или 1 нм или ниже. В некоторых случаях слитый белок связывает HA с Kd около 2 нМ или ниже. В некоторых случаях слитый белок связывает HA с Kd между около 1 нМ и около 2 мкМ, например, между около 1 нМ и около 1,8 мкМ, между около 1 нМ и около 1,6 мкМ, между около 1 нМ и около 1,4 мкМ , между около 1 нМ и около 1,2 мкМ, между около 1 нМ и около 1,0 мкМ, между около 1 нМ и около 900 нМ, между около 1 нМ и около 800 нМ, между около 1 нМ и около 700 нМ, между около 1 нМ и около 600 нМ, между около 1 нМ и около 500 нМ, между около 1 нМ и около 400 нМ, между около 1 нМ и около 300 нМ, между около 1 нМ и около 200 нМ, между около 1 нМ и около 100 нМ, между около 1 нМ и около 50 нМ, между около 1 нМ и около 40 нМ, между около 1 нМ и около 30 нМ, между около 1 нМ и около 20 нМ, между около 1 нМ и около 10 нМ, между около 5 нМ и около 100 нМ, между около 5 нМ и около 50 нМ, между около 5 нМ и около 25 нМ, между около 5 нМ и около 15 нМ или между около 5 нМ и около 10 нМ. В некоторых случаях слитый белок связывает HA с Kd около 10 нМ.

Любой из предшествующих слитых белков может иметь окулярный период полувыведения, который увеличен по сравнению с эталонным антителом, которое не ковалентно присоединено к HA-связывающему домену. В некоторых случаях период окулярного полувыведения увеличивают, по меньшей мере около в 2 раза (например, около в 2 раза, около в 3 раза, около в 4 раза, около в 5 раз, около в 6 раз, около в 7 раз, около в 8 раз, около в 9 раз, около в 10 раз, около в 12 раз, около в 14 раз, около в 16 раз, около в 18 раз, около в 20 раз или более) относительно эталонного антитела. В некоторых случаях период окулярного полувыведения увеличивается по меньшей мере около в 4 раза относительно эталонного антитела. В некоторых случаях период окулярного полувыведения представляет собой витреальный период полувыведения. В некоторых случаях, эталонное антитело идентично антителу слитого белка. В других случаях эталонное антитело не идентично антителу слитого белка.

Любой из предыдущих слитых белков может иметь окулярный клиренс, который уменьшается относительно эталонного антитела, которое не ковалентно присоединено к HA-связывающему домену. В некоторых случаях клиренс уменьшается, по меньшей мере около в 2 раза (например, около в 2 раза, около в 3 раза, около в 4 раза, около в 5 раз, около в 6 раз, около в 7 раз, около в 8 раз, около в 9 раз, около в 10 раз, около в 12 раз, около в 14 раз, около в 16 раз, около в 18 раз, около в 20 раз или более) относительно эталонного антитела. В некоторых случаях клиренс уменьшается, по меньшей мере на около в 4 раза относительно эталонного антитела. В некоторых случаях клиренс представляет собой клиренс из стекловидного тела. В некоторых случаях, эталонное антитело идентично антителу слитого белка. В других случаях эталонное антитело не идентично антителу слитого белка.

В некоторых случаях период времени между двумя внутриглазными введениями (например, интравитреальной инъекцией) любого из предыдущих слитых белков составляет по меньшей мере 1 месяц, например, по меньшей мере 1 месяц, по меньшей мере 5 недель, по меньшей мере 6 недель, по меньшей мере 7 недель, по меньшей мере 8 недель, по меньшей мере 9 недель, по меньшей мере 10 недель, по меньшей мере 11 недель, по меньшей мере 12 недель, по меньшей мере 13 недель, по меньшей мере 14 недель, по меньшей мере 15 недель, по меньшей мере 16 недель, по меньшей мере 20 недель, по меньшей мере 24 недели, по меньшей мере 28 недель, по меньшей мере 32 недели, по меньшей мере 36 недель, по меньшей мере 40 недель, по меньшей мере 44 недели, по меньшей мере 48 недель, по меньшей мере 52 недель или более. В некоторых случаях максимальный период между двумя внутриглазными введениями длится не более чем четыре года, например, не более чем три года, не более чем два года или не более чем один год. Слитый белок можно вводить, например, каждые два-двенадцать месяцев, например каждые четыре-десять месяцев. В некоторых случаях слитый белок вводят каждые шесть месяцев.

Изобретение также относится к композициям (например, фармацевтическим композициям), которые включают любой из слитых белков, описанных выше. В некоторых вариантах осуществления изобретения, композиция содержит одно или более дополнительных соединений. В некоторых вариантах осуществления изобретения, дополнительное соединение связывается со второй биологической молекулой, выбранной из группы, состоящей из IL-1β, IL-6; IL-6R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie-2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNF-альфа; HTRA1; рецептора VEGF; рецептора ST-2; и белков, генетически связанных с риском AMD, такие как компоненты комплемента пути C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, дополнительное соединение представляет собой антитело или его антигенсвязывающий фрагмент. Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157, или его вариант). В другом примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант. В еще одном дополнительном примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6R, например, токилизумаб (ACTEMRA®) (см., например, WO 1992/019579), сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

Изобретение также относится к композициям (например, фармацевтическим композициям), которые включают любой из слитых белков, описанных выше слитых белков и дополнительный антагонист VEGF.

3. Полимерные составы

Изобретение относится к составам, которые включают антитело против VEGF по изобретению и полимер. Полимерная композиция может представлять собой, например, микросферу, имплантат, гидрогель, органогель, наноагрегат, мицеллу, in situ сформированное депо или другой тип полимерной композиции, известный в данной области техники. Любой подходящий полимер может быть использован в полимерных составах по изобретению. Например, полимер может представлять собой гидрофильный полимер или гидрофобный полимер. Следует понимать, что гидрофильный полимер может быть водорастворимым полимером. Может быть использован любой подходящий гидрофильный полимер, например гидрофильный полимер, описанный в публикации международной патентной заявки № WO 2011/066417 или Pelegri-O'Day et al. J. Am. Chem. Soc. 136:14323-14332, 2014. В других случаях, например, могут быть использованы гидрофобные полимеры. Полимер может быть биоразлагаемым и/или биосовместимым.

Иллюстративные неограничивающие гидрофильные полимеры, которые могут быть использованы, включают гиалуроновую кислоту (НА), полиэтиленгликоль (ПЭГ, также известный как поли(этиленгликоль)) (например, ПЭГ с прямой цепью, разветвленный ПЭГ, гребенчатый ПЭГ и дендритный ПЭГ), поли[этиленоксид)-ко-(метиленовый этиленоксид)], поли(поли(этиленгликоль) метиловый эфир метакрилата) (pPEGMA), агарозу, альгинат, карагенаны, карбоксиметилцеллюлозу, целлюлозу, производные целлюлозы, хитозан, хондроитинсульфат, коллаген, дерматансульфат, декстран, декстрансульфат, фибрин, фибриноген, фибронектин, фукоидан, желатин, гликозаминогликаны (GAG), гликополимер, гепарин, сульфат гепарина, сильно разветвленный полисахарид (например, галактозный дендример), кератансульфат, метил-целлюлозу, гидроксипропилметилцеллюлозу (НРМС), поли(N-(2-гидроксипропил)метакриламид) (pHPMA), пектины, производные пектина, полисульфат пентозана, крахмал, гидроксиэтилкрахмал (ГЭК), стирол, витронектин, поли(акриловую кислоту), поли(метакриловую кислоту), поли(акриламид), поли(акриловую кислоту), поли(амины), поли(аминокислоты), поли(карбоксибетаин) (PCB), полиэлектролиты, поли(глутаминовую кислоту) (PGA), поли(глицерин) (PG) (например, линейный, среднефункциональный, гиперразветвленный, или линейный гиперразветвленный PG), поли(малеиновую кислоту), поли(2-оксазолин) (POZ), поли(2-этил-2-оксазолин, полисиаловую кислоту (ПСА), полистирол, производные полистирола (например, заряженные производные полистиролы), поли(стиролсульфонат-со-PEGMA), поливинилпирролидон (ПВП), поли(N-акрилоилморфолин) (pNAcM) и их сополимеры. В других случаях может быть использован любой подходящий гидрофобный полимер, включающий, например, поли(молочно-ко-гликолевую кислоту) (PLGA), полилактид (PLA) и полигликолид (PGA).

Изобретение относится к анти-VEGF антителам, составленным в виде депо с полимерным растворителем (также известным как in situ сформированные имплантаты). Например, депо полимерного растворителя может включать полимер (например, любой из описанных в данном документе полимеров, например гидрофобный полимер, такой как PLGA), растворитель (например, органический растворитель) и анти-VEGF антитело (например, любое антитело против VEGF, описанное в данном документе). Растворитель может иметь низкую смешиваемость с водой. Примеры органических растворителей, которые могут быть использованы, включают триацетин (ацетат глицерина), N-метил-2-пирролидон, диэтиловый эфир поли(этиленгликоля) и этилбензоат. В одном рабочем примере, депо полимерного растворителя может быть получено диспергированием высушенного распылением порошка антитела против VEGF (например, любого антитела против VEGF, описанного в данном документе, например, G6.31 AARR) в растворе PLGA-триацетина (см., например, Chang et al. J. Pharm. Sci. 104 (10): 3404-17, 2015, который включен в настоящее описание посредством ссылки в полном объеме). PLGA может иметь молекулярную массу около 10 кДа, около 41 кДа, или около 56 кДа, например. Полимеры PLGA являются коммерчески доступными, например, RG 752S, RG755S и RG 756S (Evonik Industries, Дармштадт, Германия). Концентрация PLGA может составлять около 7,5 %, около 10 %, около 12,5 %, около 15 %, около 20 % или более (мас.%). Концентрация антитела может составлять около 1 %, около 1,5 %, около 2 %, около 2,5 %, около 3 %, около 4 %, около 5 % или более (% мас.). В некоторых случаях концентрация антител составляет около 1,5 % (мас.%). Любой состав депо полимерных растворителей может быть введен, например, через иглу 27 калибра (27G). При введении (например, путем инъекции (например, интравитреальной инъекции)) такие составы депо полимерных растворителей могут превращаться в гель или твердое депо в глазу. Гель или твердое депо могут образовываться в результате расслаивания водной и неводной фаз. В зависимости частично от скорости переноса растворителя в водной фазе, инъецированное депо может перейти в твердый материал или гель из-за осаждения полимера и физически захватывать анти-VEGF антитело (и любые дополнительные терапевтические агенты или соединения). В других случаях, например, поперечное сшивание in situ или in situ-затвердевающие органогели могут быть использованы для образования геля или твердого депо. Депо полимерного растворителя может обеспечить долгосрочную доставку, например, в течение около 30 дней или более, например, около 30 дней, около 40 дней, около 50 дней, около 60 дней, около 70 дней, около 80 дней, около 90 дней, около 100 дней, около 110 дней, около 120 дней, около 130 дней или более. В некоторых случаях депо полимерных растворителей может обеспечить долгосрочную доставку в течение около 80 дней в глазу.

Изобретение также относится к анти-VEGF антителу (например, к любому анти-VEGF антителу, описанному в данном документе), составленному в виде полимерной мицеллы. Полимерная мицелла может быть образована, например, путем самосборки полимера (например, амфифильного блока (например, диблочного или многоблочного) сополимера) в наночастицу, имеющую гидрофобную сердцевину и гидрофильную оболочку. Полимерная мицелла может иметь любой подходящий диаметр (например, средний диаметр), например, диаметр от около 1 нм до около 1000 нм (например, около 1 нм, около 10 нм, около 100 нм, около 200 нм, около 300 нм, около 400 нм, около 500 нм, около 600 нм, около 700 нм, около 800 нм, около 900 нм, около 1000 нм) или более. В некоторых случаях полимерная мицелла может иметь диаметр (например, средний диаметр) от около 5 нм до около 100 нм (например, около 5, около 10, около 20, около 30, около 40, около 50, около 60, около 70, около 80, около 90 или около 100 нм). Можно использовать любой подходящий полимер, включая, например, амфифильные блок-сополимеры, такие как поли(пропиленоксид) (PPO), поли(D, L-молочная кислота) (PDLLA), поли(ε-капролактон) (PCL), поли(L-аспартат) и полоксамеры (например, поли(этиленоксид)-блок-поли(пропиленоксид)-блок-поли(этиленоксид) сополимеры (например, PLURONICS®)). Другие амфифильные блок-сополимеры известны в данной области. В некоторых случаях антитело против VEGF может быть присоединено к гидрофильной оболочке полимерной мицеллы, например, путем ковалентного присоединения к полимеру. Соответственно, в некоторых случаях конъюгат антитела, описанный выше, может быть использован для получения полимерной мицеллы, которая включает антитело против VEGF.

Изобретение также относится к анти-VEGF антителу (например, к любому анти-VEGF антителу, описанному в данном документе, например, G6.31 AARR), составленному в виде полимерного имплантата. Полимерный имплантат представляет собой жесткий объект, в котором твердый лекарственный препарат (например, антитело) равномерно распределяется внутри гидрофобного полимера (например, PLGA). Полимерный имплантат обычно имеет миллиметровый размер (например, 0,1 мм, 0,2 мм, 0,3 мм, 0,4 мм, 0,5 мм, 0,6 мм, 0,7 мм, 0,8 мм, 0,9 мм, 1 мм, 1,1 мм, 1,2 мм, 1,3 мм, 1,4 мм, 1,5 мм, 1,6 мм, 1,7 мм, 1,8 мм, 1,9 мм, 2 мм, 2,1 мм, 2,2 мм, 2,3 мм, 2,5 мм, 3 мм, 4 мм, 5 мм, 6 мм, 7 мм, 8 мм , 9 мм, 10 мм, 11 мм, 12 мм, 13 мм, 14 мм, 15 мм, 16 мм, 17 мм, 18 мм, 19 мм, 20 мм или более). Полимерный имплантат можно вводить в глаз, например, хирургической процедурой (например, микрохирургии) или путем инъекции (например, путем интравитреальной инъекции) с использованием подходящего устройства. Полимерный имплантат может быть составлен для введения в любой подходящий участок в глазу, например, в стекловидную, переднюю или заднюю камеры глаза или внутриретинальный, субретинальный, интрахоридный, супрахориоидальный, эписклеральный, субконъюнктивальный, внутрикорнеальный или в эпикорнеальный участки глаз. В конкретных случаях полимерный имплантат готовят для введения в стекловидное тело.

Полимерный имплантат, который включает антитело против VEGF (например, любое антитело против VEGF, описанное в данном документе, например G6.31 AARR), может быть получено с использованием процесса экструзии горячим расплавом (HME). Теплом воздействуют на расплав (псевдоожижение) полимера, а затем механический сдвиг может быть передан для смешивания и микрокомпозиции твердого лекарственного состава в фазе жидкого полимера. Затем смесь лекарственного препарата-полимера может быть экструдирована через матрицу миллиметрового размера (например, круглую головку). Когда экструдату дают остыть (например, до комнатной температуры), он образует стержни (например, циндрильные стержни), которые можно разрезать на любую желаемую длину. В некоторых случаях полимерный имплантат может быть стержнем PLGA, который включает антитело против VEGF и PLGA. Полимерные имплантаты, которые могут быть использованы в контексте настоящего изобретения, описаны, например, в Rajagopal et al. J. Pharmaceutical Sciences 102 (8): 2655-2666, 2013 и публикации международной патентной заявки № WO 2006/093758, которые включены в настоящее описание посредством ссылки во всей их полноте.

В одном рабочем примере антитело против VEGF (например, любое антитело против VEGF, описанное в данном документе) может быть получено в виде высушенной распылением композиции, которая может включать трегалозу и гистидин-HCl-буфер для стабильности при повышенных температурах, которая может быть добавлена к гидрофобному полимеру, такому как PLGA, и подвержена HME с образованием полимерного имплантата (см., например, Rajagopal et al., выше). Например, высушенная распылением композиция может включать антитело в любой подходящей концентрации (например, 1 мг/мл, 2 мг/мл, 3 мг/мл, 4 мг/мл, 5 мг/мл, 6 мг/мл, 7 мг/мл, 8 мг/мл, 9 мг/мл, 10 мг/мл, 11 мг/мл, 12 мг/мл, 13 мг/мл, 14 мг/мл, 15 мг/мл, 16 мг/мл, 20 мг/мл, 25 мг/мл, 30 мг/мл), трегалозу в любой подходящей концентрации (например, 1 мг/мл, 2 мг/мл, 3 мг/мл, 3,3 мг/мл, 4 мг/мл, 5 мг/мл, 6 мг/мл, 7 мг/мл, 10 мг/мл и/или буфер (например, 10 мМ гистидин HCl). Высушенный распылением состав может иметь любой подходящий рН, например, рН около между около 5 и около 8 (например, около 5, около 6, около 7 или около 8). В некоторых случаях высушенный распылением состав может иметь рН около 6 или около 6,2. В отдельных случаях высушенный распылением состав включает антитело против VEGF, 3,3 мг/мл трегалозы и 10 мМ гистидин-HCl, pH 6,2. Полимерный имплантат может быть получен с помощью HME-высушенного распылением состава с помощью гидрофобного полимера, такого как PLGA. Например, твердые гранулы PLGA и высушенный распылением состав можно предварительно смешивать при комнатной температуре и подавать в конический, противовращающийся двухшнековый экструдер. Комбинация может быть микрокомпонентной, а затем экструзией при 100 °C через круглую головку диаметром 0,5 мм. В некоторых случаях высушенный распылением состав подвергают воздействию 100 °C в течение менее 30 минут.

Полимерный имплантат может содержать, например, от около 1 % до около 90 % антитела против VEGF (например, около 1 %, около 5 %, около 10 %, около 20 %, около 30 %, около 40 % около 50 %, около 60 %, около 70 %, около 80 % или около 90 %) по весу. В некоторых случаях полимерный имплантат включает около 10 % антитела против VEGF по весу. Полимерный имплантат может иметь любые подходящие размеры, например, в некоторых случаях имплантат имеет диаметр от около 0,1 до около 1 мм (например, около 0,5 мм) и длину от около 1 до около 30 мм (например, около 14 мм). Для имплантатов PLGA (например, стержней PLGA) процент полимолочной кислоты в PLGA-сополимере может составлять 0-100 %, например, около 15-85 %, около 35-65 % или 50 %. В некоторых случаях PLGA-имплантат (например, стержень PLGA) может дополнительно включать один или более дополнительных полимеров, например гидроксипропилметилцеллюлозу (HPMC).

В любом из предшествующих полимерных составов (например, депо полимерных растворителей, полимерные мицеллы и полимерные имплантаты) антитело может представлять собой фрагмент антитела, который связывает VEGF. В некоторых случаях фрагмент антитела выбирают из группы, состоящей из Fab, Fab', Fab-C, Fab'-SH, Fv, scFv и (Fab')2 фрагментов. Например, в некоторых случаях фрагмент антитела представляет собой Fab, Fab'или Fab-C.

Любой из предшествующих полимерных составов (например, депо полимерных растворителей, полимерных мицелл и полимерных имплантатов) может иметь период окулярного полувыведения, который увеличен относительно эталонного антитела, которое не составлено в виде полимерного состава. В некоторых случаях период окулярного полувыведения увеличивают, по меньшей мере около в 2 раза (например, около в 2 раза, около в 3 раза, около в 4 раза, около в 5 раз, около в 6 раз, около в 7 раз, около в 8 раз, около в 9 раз, около в 10 раз, около в 12 раз, около в 14 раз, около в 16 раз, около в 18 раз, около в 20 раз или более) относительно эталонного антитела. В некоторых случаях период окулярного полувыведения увеличивается по меньшей мере около в 4 раза относительно эталонного антитела. В некоторых случаях период окулярного полувыведения представляет собой жизненный период жизни. В некоторых случаях, эталонное антитело идентично антителу полимерного состава. В других случаях эталонное антитело не идентично антителу полимерного состава.

Любой из предшествующих полимерных составов (например, депо полимерных растворителей, полимерных мицелл и полимерных имплантатов) может иметь окулярный клиренс, который уменьшается относительно эталонного антитела, которое не составлено в виде полимерного состава. В некоторых случаях клиренс уменьшается, по меньшей мере около в 2 раза (например, около в 2 раза, около в 3 раза, около в 4 раза, около в 5 раз, около в 6 раз, около в 7 раз, около в 8 раз, около в 9 раз, около в 10 раз, около в 12 раз, около в 14 раз, около в 16 раз, около в 18 раз, около в 20 раз или более) относительно эталонного антитела. В некоторых случаях клиренс уменьшается, по меньшей мере на около в 4 раза относительно эталонного антитела. В некоторых случаях клиренс представляет собой клиренс из стекловидного тела. В некоторых случаях, эталонное антитело идентично антителу полимерного состава. В других случаях эталонное антитело не идентично антителу полимерного состава.

В некоторых случаях период времени между двумя внутриглазными введениями (например, интравитреальной инъекцией) любой из предшествующих полимерных составов составляет по меньшей мере 1 месяц, например, по меньшей мере 1 месяц, по меньшей мере 5 недель, по меньшей мере 6 недель, по меньшей мере 7 недель, по меньшей мере 8 недель, по меньшей мере 9 недель, по меньшей мере 10 недель, по меньшей мере 11 недель, по меньшей мере 12 недель, по меньшей мере 13 недель, по меньшей мере 14 недель, по меньшей мере 15 недель, по меньшей мере 16 недель, по меньшей мере 20 недель, по меньшей мере 24 недели, по меньшей мере 28 недель, по меньшей мере 32 недели, по меньшей мере 36 недель, по меньшей мере 40 недель, по меньшей мере 44 недели, по меньшей мере 48 недель, по меньшей мере 52 недель или более. В некоторых случаях максимальный период между двумя внутриглазными введениями длится не более четырех лет, например, не более трех лет, не более двух лет или не более одного года. Полимерный состав можно вводить, например, каждые два-двенадцать месяцев, например каждые четыре-десять месяцев. В некоторых случаях полимерный состав вводят каждые шесть месяцев.

Изобретение также относится к композициям (например, фармацевтическим композициям), которые включают в себя любые полимерные составы (например, депо полимерных растворителей, полимерные мицеллы и полимерные имплантаты), описанные выше. В некоторых вариантах осуществления изобретения, композиция содержит одно или более дополнительных соединений. В некоторых вариантах осуществления изобретения, дополнительное соединение связывается со второй биологической молекулой, выбранной из группы, состоящей из IL-1β, IL-6; IL-6R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie-2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNF-альфа; HTRA1; рецептора VEGF; рецептора ST-2; и белков, генетически связанные с риском AMD, такие как компоненты комплемента пути C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, дополнительное соединение представляет собой антитело или его антигенсвязывающий фрагмент. Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157, или его вариант). В другом примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант. В еще одном дополнительном примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6R, например, токилизумаб (ACTEMRA®) (см., например, WO 1992/019579), сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

Изобретение также относится к композициям (например, фармацевтическим композициям), которые включают в себя любые полимерные составы (например, депо полимерных растворителей, полимерные мицеллы и полимерные имплантаты), описанные выше и дополнительный антагонист VEGF.

4. Приборы

Любую из описанных в данных документах композиций (например, антитела против VEGF, конъюгаты антител, слитые белки и полимерные составы) можно вводить в глаз с помощью устройства доставки порт. Устройство доставки порт представляет собой имплантируемое многоразовое устройство, которое может выпускать терапевтический агент (например, антитело против VEGF) в течение нескольких месяцев (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 , 10, 11, 12 и более месяцев). Иллюстративные устройства доставки порт, которые могут быть использованы, включают в себя те из ForSight Labs, LLC и/или ForSight VISION4, например, как описано в публикациях международной патентной заявки № WO 2010/088548, WO 2015/085234, WO 2013/116061, WO 2012/019176, WO 2013/040247 и WO 2012/019047, которые включены в настоящее описание посредством ссылки во всей их полноте.

Например, изобретение относится к устройствам доставки порт, которые включают в себя резервуары, содержащие любые из описанных в данном документе композиций (например, антитела против VEGF, конъюгаты антител, слитые белки и полимерные составы). Устройство доставки порт может дополнительно содержать проксимальный участок, трубчатый корпус, соединенный с проксимальным участком, сообщающийся по текучей среде с резервуаром, и один или более выходов, сообщающихся по текучей среде с резервуаром и выполненных с возможностью впрыскивания композиции в глаз. Трубчатый корпус может иметь наружный диаметр, который может быть вставлен через разрез или отверстие в глазу размером около 0,5 мм или меньше. Длина устройства может составлять от около 1 мм до около 15 мм в длину (например, около 1 мм, около 2 мм, около 4 мм, около 5 мм, около 6 мм, около 7 мм, около 9 мм, около 11 мм, около 13 мм или около 15 мм в длину). Резервуар может иметь любой подходящий объем. В некоторых случаях резервуар имеет объем от около 1 мкл до около 100 мкл (например, около 1 мкл, около 5 мкл, около 10 мкл, около 20 мкл, около 50 мкл, около 75 мкл или около 100 мкл). Устройство или его составные части могут быть изготовлены из любого подходящего материала, например полиимида.

В некоторых случаях устройство доставки порт включает резервуар, содержащий любую из описанных в данном документе композиций (например, антитела против VEGF, конъюгаты антител, слитые белки и полимерные составы) и одно или более дополнительных соединений. В некоторых вариантах осуществления изобретения, дополнительное соединение связывается со второй биологической молекулой, выбранной из группы, состоящей из IL-1β, IL-6; IL-6R; PDGF; ангиопоэтина; ангиопоэтина 2; Tie-2; S1P; интегринов αvβ3, αvβ5 и α5β1; бетацеллюлина; апелина/APJ; эритропоэтина; фактора комплемента D; TNF-альфа; HTRA1; рецептора VEGF; рецептора ST-2; и белков, генетически связанных с риском AMD, таких как компоненты комплемента пути C2, фактора B, фактора H, CFHR3, C3b, C5, C5a и C3a; HTRA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; и TNFRSF10A. В некоторых вариантах осуществления изобретения, дополнительное соединение представляет собой антитело или его антигенсвязывающий фрагмент. Например, в некоторых случаях дополнительное соединение представляет собой биспецифическое антитело (например, биспецифическое антитело против VEGF/анти-Ang2, такое как RG-7716 или любое биспецифическое анти-VEGF/анти-Ang2 биспецифическое антитело, описанное в WO 2010/069532 или WO 2016/073157, или его вариант). В другом примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6, например, EBI-031 (Eleven Biotherapeutics, см., например, WO 2016/073890), силтуксимаб (SYLVANT®), олокизумаб, клазакизумаб, сирукумаб, элсилимомаб, герилимзумаб, OPR-003, MEDI-5117, PF-04236921 или их вариант. В еще одном дополнительном примере в некоторых случаях дополнительное соединение представляет собой антитело против IL-6R, например, токилизумаб (ACTEMRA®) (см., например, WO 1992/019579), сарилумаб, вобарилизумаб (ALX-0061), SA-237 или его вариант.

В некоторых случаях устройство доставки порт включает в себя любую из описанных в данном документе композиций (например, антитела против VEGF, конъюгаты антител, слитые белки и полимерные составы) и дополнительный антагонист VEGF.

III. ПРИМЕРЫ

Ниже приведены примеры способов и композиций согласно настоящему изобретению. Следует понимать, что учитывая общее описание, представленное выше, можно осуществить различные другие варианты реализации настоящего изобретения.

Пример 1: Глубокий сканирующий мутагенез G6.31 определяет позиции, важные для сборки стабильной собранной Fab

G6.31 представляет собой высокоаффинное антитело против VEGF (Fuh et al., J. Biol. Chem. 281(10):6625-6631 (2006); Liang et al., J. Biol. Chem. 281(2):951-961 (2006). G6.31 считается представителем человеческих антител, поскольку его вариабельные домены тяжелой и легкой цепей часто используются зародышевыми линиями IGHV3-23 и IGKV1-39 человеческого происхождения, соответственно.

Чтобы систематически оценивать влияние одиночных мутаций в доменах VH и VL G6.31, была создана насыщенная библиотека мутагенеза одного сайта для каждого вариабельного домена (VL положения 2-107 и VH положения 2-113 согласно схеме нумерации Кабата). Эти библиотеки называются библиотеками прохождения VH и VL NNK соответственно. Использование этих библиотек в глубоком мутационном сканирующем эксперименте позволило рассчитать коэффициент обогащения (ER) для каждой мутации в обеих библиотеках во время отбора, которые служат оценкой влияния мутации на пригодность молекулы. ER специфической мутации агрегирует множество эффектов, включая влияние мутации на функциональную экспрессию, влияние мутации на стабильность сворачивания и влияние мутации на связывание с селекционным белком (например, анти-gD (пептидная метка, слитая с С-концом легкой цепи), белок А, белок L или VEGF).

Чтобы оценить влияние каждой мутации на функциональную экспрессию и стабильность сворачивания Fab, библиотеки VH и VL были пэннингированы раздельно против анти-gD, белка A или белка L. Эти стратегии пэннингирования обнаруживают, отображается ли молекула Fab на фаге и, в какой-то степени, правильно ли он свернут и собран. ER для 2331 и 2226 аминокислотных замен (включая стопы) и соответствующей аминокислоты дикого типа в данном положении библиотеки тяжелой цепи и библиотеки легкой цепи, соответственно, определяли для каждого из трех пэннингов (Фиг.1A- 1F). Сравнение трех стратегий пэннингирования тяжелой цепи или трех пэннингов легкой цепи показывает, что очень похожие результаты были получены (Фиг.2А-2В). Например, ER показывают хорошую линейную зависимость (r2 = 0,98) между анти-gD и пэннингированием белка L (Фиг.2A). Сравнение между набором данных пэннингирования белка A и набором данных пэннингирования белка L показало более низкую линейную корреляцию (r2 = 0,611), что можно отнести к подмножеству мутаций, которые оказывают непосредственное влияние на связывание белка A и, следовательно, дифференциальное обогащение в двух отборах. Аналогичная картина наблюдалась для легкой цепи (Фиг. 2В).

В одном подходе для определения позиций, которые влияют на функциональную экспрессию и стабильность Fab, определялись положения, которые были консервативны и которые не переносят мутации во время отбора. Используя набор данных, полученный из пэннинга анти-gD в качестве репрезентативного сканирования, средний коэффициент обогащения всех мутаций в данной позиции (ERpos) был рассчитан для каждой позиции как мера консервативности (Фиг. 3A-3B). В обоих доменах VH и VL центральные остатки ядра, которые состоят из пары цистеина (HC-C22, HC-C93, LC-C23, LC-88) между β-нитями B и F, а также смежный остаток триптофана (HC-W36, LC-W35) были высококонсервативными (Фиг. 3А-3D). Гидрофобное ядро складки иммуноглобулина описано, например, у Halaby et al. Protein Engineering 12 (7): 563-571, 1999. Рядом с центральным ядром находятся несколько гидрофобных остатков, расположенных в нижней половине молекулы (когда Fab ориентирован так, что HVR обращены вверх), которые являются частью расширенного гидрофобного ядра. Они были консервативны, но показали меньшие значения ERpos, чем центральные остатки ядра. Среди этих остатков есть тирозин (HC-Y90, HC-86), который, как было показано ранее, важен для стабильности Ig-складки (см., например, Hamill et al., J. Mol. Biol. 295(3):641-649 (2000). Третья группа консервативных остатков находилась в интерфейсе VH/VL (HC-L45, HC-Y91, HC-W103, LC-P44, LC-Y36, LC-Y96). Остатки интерфейса VH/VL были не только консервативны в пэннинге с непрямым выбором (например, данные VH из пэннинга белка L), но также и прямым выбором (например, данные VH из пэннинга белка A), что указывает на то, что мутации в упомянутых положениях интерфейса привели к собранному Fab с пониженной стабильностью. Четвертая группа консервативных остатков (HC-E46, HC-R38, HC-D86, LC-R61, LC-D82) включает остатки в водородных сетях связи в нижней половине Fab, которые важны для стабильности. Особенно аспартатный остаток в α1-спирали относится к позициям, которые показали одну из самых высоких консервативностей в наборе данных. Мутация в положении LC-R61 и LC-D82 была показана ранее, чтобы индуцировать образование фибрилл и индуцировать агрегацию в легких цепях (см. Helms et al., J. Mol. Biol. 257(1):77-86 (1996)). Наконец, четыре позиции в HVR-H3 были идентифицированы как высококонсервативные: HC-A93, HC-R94, HC-P100, HC-D101. Поскольку эти стратегии пэннинга не были выбраны для связывания антигена, эти результаты показали, что конформация петли HVR3 связана со стабильностью Fab.

Таким образом, за исключением того, что несколько позиций вариабельных доменов являются высококонсервативными, многие позиции могут переносить мутации, не влияя на общую стабильность и экспрессию молекулы Fab в этих селекциях. Кроме того, даже некоторые позиции, имеющие небольшой ERpos, могут переносить консервативные аминокислотные замены. Например, данные мутагенеза показали, что гидрофобные остатки нижней сердцевины могут быть замещены аналогичным гидрофобным остатком, не влияя на стабильность Fab (Фиг.1A-1F). Толерантность VH/VL стабильности для отдельных замещений контрастирует с результатами, полученными при глубоком сканировании мутагенеза домена CH3 IgG1 человека, в котором большинство остатков не переносят никаких мутаций (см. Traxylmayr et al., J. Mol , Biol. 423(3):397-412 (2012)).

Материалы и способы

A. Разработка и создание полного вариабельного домена библиотеки прохождения NNK.

Полные VH (остатки 2-113) и VL (остатки 2-107) G6.31 подвергались рандомизации. 10-12 последующих остатков были рандомизированы на каждую суб-библиотеку. Внутри суб-библиотеки TAA кодон вводили в каждую рандомизированную позицию с помощью мутагенеза Кункела (Kunkel, Proc. Natl. Acad. Sci. USA 83(2):488-492 (1985)). Создано 10 VL суб-библиотек и 12 VH суб-библиотек стоп-шаблонов. Для проектирования библиотеки каждая позиция была рандомизирована олигонуклеотид-направленным мутагенезом с кодоном NNK, где N представляет собой любой из четырех природных нуклеотидов, а K представляет собой 50 % T (тимин) и 50 % G (гуанин). Кодон NNK может кодировать любую из 20 природных аминокислот. Суб-библиотеки для легкой цепи и тяжелой цепи были сделаны отдельно, а затем соответственно библиотеки для каждой цепочки были объединены с образованием библиотеки VL и библиотеки VH. Объединенные библиотеки также называются библиотеками прохождения NNK VH или VL. Библиотеки были сделаны в векторе отображения фагового Fab-фрагмента. Библиотека прохождения NNK VH имела размер 3×109 членов, а библиотека прохождения NNK VL имела размер 8×108 членов.

B. Отбор пэннинга фага на анти-gD, белке L или белке A

Связывающие клоны отбирали путем инкубации библиотеки прохождения фагового дисплея NNK VH или VL с 5, 0,5, 0,1 нМ биотинилированным VEGF в последовательных раундах отбора, а затем конкурировали со 100 нМ небиотинилированного VEGF при комнатной температуре или 37°C для уменьшения связывания клонов с низкой аффинностью к VEGF. Связанные клоны фиксировали на пластинах ИФА, покрытых нейтравидином, промывали и элюировали в 100 мМ HCl в течение 20 минут при комнатной температуре. Элюированный фаг нейтрализовали 1/10 объема 1 М Трис pH 8,0 и использовали для заражения E. coli для амплификации для следующего раунда отбора.

Для отбора с помощью анти-gD, белка L или белка A клоны для связывания выбирали путем инкубации библиотеки прохождения фагового дисплея NNK VH или VL на пластинах ИФА, покрытых анти-gD, белком L или белком A, промывали и элюировали 100 мМ HCl в течение 20 минут при комнатной температуре. Элюированный фаг нейтрализовали 1/10 объема 1 М Трис pH 8,0 и использовали для заражения E. coli для амплификации для следующего раунда отбора.

C. Illumina секвенирование глубоко мутационных сканирующих библиотек G6.31

Для глубокого секвенирования, ДНК фагемидов выделяли из клеток XL1 E. coli, переносящих векторы фагемидов либо из не выбранной, либо из выбранной библиотеки прохождения NNK VH или VL. Очищенную ДНК использовали в качестве матрицы для ПЦР на основе ограниченного цикла амплификации участков VL и VH. Продукты ПЦР очищали экстракцией и очисткой с помощью агарозного геля (комплект для экстракции геля Qiagen). Элюированная ДНК ампликонов использовалась в качестве основы для подготовки библиотеки глубокого секвенирования со стандартными методами подготовки библиотеки Illumina с использованием образца проб ДНК TRUSEQ™ (Illumina). Библиотеки, связанные с адаптерами, подвергали однократному циклу ПЦР и секвенировали на Illumina MISEQ®, парном конце 300 п.о., чтобы покрыть всю длину ампликона.

D. Анализ данных глубинного сканирования мутагенеза

Последовательные парные считывания концов были объединены с использованием FLASh (Magoc et al., Bioinformatics 27 (21): 2957-2963 (2011)). Дальнейший анализ данных последовательности выполнялся с использованием языка статистического программирования R (Team RC «R: A language and environment for statistical computing” R Foundation for Statistical Computing (2014)) и пакета ShortRead (Morgan et al., Bioinformatics 25(19):2607-2608 (2009)). Первым шагом в контроле качества была фильтрация для последовательностей, которые содержали соответствующий HC и LC штрихкод. На втором этапе фланкирующие участки домена VH и VL были идентифицированы для каждого объединенного считывания и проверены на правильную длину, чтобы удалить подавляющее большинство чтений с мутациями вставки или делеции (indels). Чтобы дополнительно исправить ошибки последовательности, мутации, отличные от NNK, были преобразованы обратно в базу дикого типа, и данные, содержащие более двух мутаций NNK, были отфильтрованы. Матрицы массы позиции были сгенерированы путем вычисления частоты всех мутаций каждой рандомизированной позиции. Коэффициенты обогащения для всех мутаций рассчитывались путем деления частоты данной мутации в данной позиции в отсортированном образце с частотой той же самой мутации в несортированном образце, как описано ранее (Fowler et al., Nature Methods 7 (9) ): 7412-746 (2010)).

Пример 2: Скрининг глубокого сканирующего мутагенеза G6.31 идентифицирует варианты аминокислотных остатков с повышенной стабильностью и/или улучшенной аффинностью связывания с VEGF

Чтобы получить исчерпывающий обзор влияния одиночных замещений G6.31 на связывание антигена, библиотеки прохождения NNK VH и VL, описанные в примере 1, были подвергнуты пэннингу против VEGF (Фиг.4A-4B). Полученные значения коэффициента обогащения (ER) показали бимодальное распределение (Фиг.5A-5B). Подмножество мутаций оказало сильное отрицательное влияние на функцию связывания, тогда как большинство мутаций были нейтральными, и несколько мутаций оказали сильное положительное влияние на пригодность. Мутации, которые отрицательно влияли на связывание, по большей части находились либо в HC-HVR, так как эти петли, как полагают, обеспечивают большую часть функции связывания G6.31 или в консервативных остатках каркаса, как определено в пэннинге анти-gD (см. пример 1). Сильно обогащенные мутации были расположены главным образом в менее консервативном разделе каркасных участков и HC-HVR. Эти результаты подтверждают наблюдение из gD-пэннинга, описанного выше (см. Пример 1), что вариабельные домены являются надежными и могут переносить много одиночных мутаций без существенного влияния на антигенсвязывающую функцию Fab.

Для подтверждения результатов, полученных при глубоком сканирующем мутагенезе, выбранные мутации были экспрессированы и очищены, а их аффинность к VEGF была измерена с использованием поверхностного плазмонного резонанса BIACORE® (SPR), и их термостабильность (в соответствии с оценкой температуры плавления Tm) измерялась с использованием дифференциальной сканирующей флуориметрии (DSF). Было оценено влияние выбранных сильно обогащенных мутаций на связывание и фолдинг антигена. Кроме того, мутации с высоким обогащением выбирались исходя из их появления в данной позиции в человеческих антителах в соответствии с базой данных Absis. Кроме того, некоторые мутации, которые были сильно истощены, также тестировались как отрицательный контроль. Kd и Tm указанных вариантов G6.31 показаны в таблице 2. Значения Kd, перечисленные в таблице 2, были измерены с использованием кинетического анализа с одним циклом с использованием устройства BIACORE® T200.

Таблица 2: Характеристика вариантов G6.31, идентифицированных методом глубокого сканирующего мутагенеза

Клон kon (1/Mс) koff (1/с) Kd (нM) Разница сворачивания (относительно G6.31) Температура плавления (°C)
G6.31 WT 4,45E+05 6,86E-04 1,54 -- 83,4
LC-Q3A 3,89E+05 3,59E-04 0,92 1,7 82,8
LC-M4Q 5,93E+05 6,57E-04 1,11 1,4 72,8
LC-S7Q 7,31E+05 6,71E-04 0,92 1,7 83,2
LC-S9Q 1,47E+06 6,55E-04 0,44 3,5 83,2
LC-S12M 8,94E+05 6,79E-04 0,76 2,0 82,9
LC-G16K 3,67E+05 3,56E-04 0,97 1,6 79,1
LC-T22D 4,87E+05 3,48E-04 0,72 2,1 81,8
LC-D28R 1,17E+06 6,55E-04 0,56 2,8 80,6
LC-Y36G 2,25E+05 5,58E-04 2,47 0,6 66,8
LC-Q37A 6,03E+05 5,15E-04 0,85 1,8 81,6
LC-S50M 4,67E+05 6,11E-04 1,31 1,2 84,5
LC-L73G 5,89E+05 6,44E-04 1,09 1,4 68,8
LC-F83A 8,55E+05 4,33E-04 0,50 3,1 88,8
LC-Q89N 9,91E+05 4,35E-04 0,44 3,5 79,6
LC-Q89T 1,17E+06 4,93E-04 0,42 3,7 79,1
LC-T97N 4,32E+05 8,02E-04 1,86 0,8 81
LC-N94A 3,34E+05 1,31E-03 3,93 0,4 85,8
LC-N94Q 2,78E+05 1,33E-03 4,78 0,3 84,6
HC-V2R 4,64E+05 3,41E-04 0,73 2,1 81,6
HC-S7L 7,36E+05 5,68E-04 0,77 2,0 83
HC-Q13M 1,26E+06 5,19E-04 0,41 3,8 83,1
HC-A40E 1,13E+06 4,66E-04 0,41 3,8 83
HC-I51H 2,48E+06 1,52E-03 0,62 2,5 83,1
HC-A53R 8,29E+05 3,50E-04 0,42 3,7 84,3
HC-T57E 1,93E+06 4,02E-04 0,2 7,7 84,4
HC-Y58R 1,48E+06 2,55E-04 0,17 9,1 83,2
HC-Y58Q 3,52E+05 3,58E-04 1,02 1,5 84,2
HC-Y59T 3,60E+05 9,74E-04 2,71 0,6 82,9
HC-A60M 3,86E+05 7,29E-04 1,89 0,8 82,8
HC-S70H 6,58E+05 6,60E-04 1 1,5 83
HC-T73N 6,78E+05 5,75E-04 0,85 1,8 83,1
HC-Q81S 1,07E+06 4,87E-04 0,45 3,4 83
HC-Q81W 1,20E+06 5,42E-04 0,45 3,4 83,2
HC-N82aR 1,39E+06 322E-04 0,23 6,7 83,1

Используя данные из 34 мутаций (16 на VH и 18 на VL), не наблюдалось линейной зависимости между коэффициентом обогащения и полученным улучшением в аффинности или стабильности (Фиг.5C-5D). Не желая связывать себя теорией, это может отражать тот факт, что на ER влияет множество факторов, включая функциональную экспрессию в E. coli, стабильность Fab на фаговой частице, а также связывание с селекционным белком. Одним из примеров, иллюстрирующих это, является мутация LC-L73G, которая является частью гидрофобного ядра легкой цепи. Замена гидрофобного лейцина в этом положении глицином, вероятно, уменьшает упаковку в сердцевине и приводит к менее стабильной легкой цепи. Tm мутанта LC-L73G на 14,4 °C ниже, чем у G6.31 Fab. Мутация LC-L73G была истощена в эксперименте по пэннингу VEGF, хотя она не оказывала заметного влияния на антигенсвязывающую аффинность, как измерено BIACORE® SPR (приблизительно в 1,6 раза больше (т.е. более низкое Kd) в аффинности по сравнению с G6.31 дикого типа). Истощение G6.31LCL73G, вероятно, было следствием уменьшения отображения мутанта на фаге, и этот эффект доминировал над выбором этого мутанта по сравнению с фактическим выбором антигена. Кроме того, верно и обратное: мутация, которая увеличивает отображение (например, путем усиления экспрессии и/или стабильности), может быть обогащена, хотя фактическая функция связывания антигена нарушена или не изменена по сравнению с диким типом (генерирование ложноположительно). Поэтому варианты, идентифицированные с помощью обогащения, могут быть улучшены для аффинности связывания, стабильности, экспрессии и/или других свойств.

Две мутации в HVR-H2, идентифицированные методом глубокого сканирующего мутагенеза, HC-T57E и HC-Y58R, имели наибольшее увеличение аффинности (в 8-9 раз) по сравнению с G6.31 дикого типа (Фиг.5E). Мутация каркасного участка, HC-N82aR, привела к приблизительно увеличению аффинности в 6,6 раз по сравнению с G6.31 дикого типа (Фиг.5E). Несколько других мутаций каркасного участка показали увеличение аффинности в 2-4 раза по сравнению с G6.31 дикого типа (Фиг.5E-5F). Наибольшее увеличение термостабильности было получено при мутации легкой цепи LC-F83A (+ 5,4 °C) (Фиг.5F). В дополнение к увеличению температуры плавления LC-F83A увеличивал аффинность G6.31 к VEGF в 3 раза. Удивительно, но многие из мутаций, которые приводили к увеличению аффинности, были расположены дистальнее антигенсвязывающего сайта (Фиг.5Е-5F). Среди них был HC-N82aR, который расположен в петле между спиралью α1 и нитью β E, более чем на 22Å от антигенсвязывающего сайта, и LC-F83A, который расположен на границе между VL и легкой цепью константного домена (CL), более чем на 25Å от HVR.

Таким образом, глубокий сканирующий мутагенез G6.31 с использованием библиотек прохождения NNK VH и VL и секвенирование нового поколения идентифицировали изменения аминокислотных остатков, которые увеличивали сродство связывания с VEGF и/или стабильность Fab.

Материалы и способы

A. Выбор пэннинга фагов на VEGF

Связывающие клоны отбирали путем инкубации библиотеки прохождения фагового дисплея NNK VH или VL (описанной в примере 1) с 5, 0,5, 0,1 нМ биотинилированным VEGF в последовательных раундах отбора, а затем конкурировали с 100 нМ небиотинилированного VEGF при комнатной температуре или 37 °C для уменьшения связывания клонов с низкой аффинностью к VEGF. Связанные клоны фиксировали на пластинах ИФА, покрытых нейтравидином, промывали и элюировали в 100 мМ HCl в течение 20 минут при комнатной температуре. Элюированный фаг нейтрализовали 1/10 объема 1 М Трис pH 8,0 и использовали для заражения E. coli для амплификации для следующего раунда отбора.

B. Illumina секвенирование глубоко мутационных сканирующих библиотек G6.31 и анализ данных

Для глубокого секвенирования, ДНК фагемидов выделяли из клеток XL1 E. coli, переносящих векторы фагемидов либо из не выбранной, либо из выбранной библиотеки прохождения NNK VH и VL, подвергнутых воздействию VEGF. Очищенную ДНК использовали в качестве матрицы для ПЦР на основе ограниченного цикла амплификации участков VL и VH. Продукты ПЦР очищали экстракцией и очисткой с помощью агарозного геля (комплект для экстракции геля Qiagen). Элюированная ДНК ампликонов использовалась в качестве основы для подготовки библиотеки глубокого секвенирования со стандартными методами подготовки библиотеки Illumina с использованием образца проб ДНК TRUSEQ™ (Illumina). Библиотеки, связанные с адаптерами, подвергали однократному циклу ПЦР и секвенировали на Illumina MISEQ®, парном конце 300 п.о., чтобы покрыть всю длину ампликона. Анализ данных проводили, как в примере 1, для расчета матрицы весовых позиций и коэффициентов обогащения.

C. Экспрессия антитела

VH и VL последовательности выбранных вариантов были клонированы в вектор Fab млекопитающих для экспрессии. Плазмиды как для тяжелой, так и легкой цепей трансфицировали (15 мкг) в 30 мл 293Т-клеток в течение 7 дней. Супернатант собирали для очистки с помощью колонки белка G.

D. Определение аффинности антител с помощью BIACORE® SPR

Для определения аффинности связывания выбранных вариантов Fab, использовалось измерение SPR с помощью прибора BIACORE® T200. Вкратце, чип CM5 серии S был активирован реагентами 1-этил-3-(3-диметиламинопропил) карбодиимида (EDC) и N-гидроксисукцинимида (NHS) в соответствии с инструкциями поставщика, а человеческий VEGF (hVEGF) соединяли для достижения 50-80 единиц ответа (RU), затем следуя за блокировкой непрореагировавших групп с 1М этаноламином.

Были введены трехкратные серийные разведения Fab в буфере HBS-P (0,01 М HEPES, pH 7,4, 0,15 М NaCl, 0,005 % поверхностно-активного вещества Р20) от низких (0,02 нМ) до высоких (50 нМ) (скорость потока: 30 мкл/мин). Реакции связывания на hVEGF корректировались путем вычитания RU из пустой проточной клетки. Сенсорграмма была записана и подлежит оценке и вычитанию из буфера перед оценкой с помощью программного обеспечения BIACORE® T200 Evaluation Software (версия 2.0). Коэффициент ассоциации (kon) и скорости диссоциации (koff) были рассчитаны с использованием простой индивидуальной модели привязки Ленгмюра. Константа равновесной диссоциации (Kd) рассчитывалась как отношение koff/kon.

E. Определение температуры плавления (Tm) методом дифференциальной сканирующей флуориметрии

Дифференциальная сканирующая флуориметрия (DSF) контролирует термическое разворачивание белков в присутствии флуоресцентного красителя и обычно выполняется с использованием прибора ПЦР реального времени (например, Bio-Rad CFX). SYPRO® Оранжевый краситель (Invitrogen, кат. № S6650) разбавляли 1:20 в натрий-фосфатном буфере (PBS). 1 мкл разбавленного красителя добавляли в 24 мкл белка Fab (приблизительно 100 мкг/мл) на лунку. Температуру повышали от 20 до 100 °С с использованием прибора ПЦР реального времени (Bio-Rad CFX), и была рассчитана интенсивность флуоресценции, а точку перегиба кривой перехода (Tm) рассчитывали с использованием таких уравнений, как уравнение Больцмана (см., например, Niesen et al., Nature Protocols 2 (9): 2212-2221 (2007)).

Пример 3: Конформационные изменения LC-F83 коррелируют с конформацией изгиба Fab в структурах G6

Чтобы понять, как мутации, пространственно удаленные от сайта связывания антигена, могут оказывать такое сильное влияние на связывание и стабильность антигена, структурный эффект мутации LC-F83A был рассмотрен более подробно. Родительское антитело G6.31, G6, ранее кристаллизовалось в VEGF-связываемых и VEGF-свободных формах (Fuh et al., выше). G6.31 содержит только четыре замены в HVR-L3 по сравнению с G6. Поэтому кристаллическая структура G6 использовалась в качестве модели для G6.31. Кристаллическая структура свободной от VEGF формы G6 содержит 12 молекул Fab в асимметричной единице. Структуры Fab могут быть сгруппированы в две разные группы, основанные на ориентации константных доменов на переменные домены (интерфейс V-C) (Фиг.6A), который является результатом различных конформаций в участке изгиба Fab и может быть определен количественно путем измерения угол изгиба Fab (см., например, Stanfield et al., J. Mol. Biol. 357(5):1566-1574 (2006)).

Гибкость угла изгиба Fab зависит от шарового шарнирного соединения в тяжелой цепи (см., например, Lesk et al., Nature 335 (6186): 188-190 (1988)), но также и, возможно, более важно, где доминирует класс легкой цепи. Хотя антитела легкой цепи каппа, как правило, ограничены по углу изгиба, они могут адаптироваться и демонстрировать бимодальное распределение, достигающее максимума приблизительно 140° и приблизительно 175°, редко превышающее 180°, антитела легкой цепи лямбда могут принимать более широкий диапазон углов (см., например, Stanfield et al., выше). Шесть молекул G6 в кристаллической структуре имеют небольшие углы изгиба (143-155°) и плотную упаковку DE-петли домена CL против α1 VL, тогда как остальные шесть молекул имеют большой угол изгиба (170 - 187°) со свободно упакованным интерфейсом VL-CL (Фиг.6В-6С). Распределение области интерфейса различных Fab-молекул, имеющих слабо упакованный или плотно упакованный интерфейс VL-CL, показано на Фиг.7C. Плотно упакованная площадь интерфейса составляет в среднем около 600 Å, а площадь слабо упакованной поверхности составляет примерно 450 Å. Дальнейший и более подробный анализ показал, что шесть молекул G6свободный имеют небольшие углы изгиба (143-155°), которые связаны с плотно упакованным интерфейсом VL-CL (включающим DE-петлю CL домена, упакованного против α1 VL, 304 ± 48 Å2), тогда как остальные шесть имеют большой угол изгиба (170-187°) с менее плотно упакованным интерфейсом VL-CL (площадь интерфейса 234 ± 29 Å2). Таким образом, кристаллическая структура G6 показывает, что G6 ведет себя как легкая цепь каппа типичного человеческого антитела с углами изгиба ниже 180° (Фиг.6A-6C).

Конформация боковой цепи LC-F83 коррелировала с изменениями угла изгиба Fab. В структурах с большим углом изгиба LC-F83 плотно связан в гидрофобном кармане (упоминается как «в» конформации) в участке дистального укупоривания домена VL (Фиг.6C). В структурах небольшого изгиба LC-F83 выходит (упоминается как «вне» конформации) из гидрофобного кармана и частично подвергается воздействию растворителя (Фиг.6В). Несмотря на то, что LC-F83 расположен в пространстве близко к области изгиба Fab, он не является частью изгиба. Однако конформационные изменения LC-F83 отражаются изменениями положения боковой цепи остатка изгиба LC-I106. В структурах, в которых LC-F83 является «вне» конформации, боковая цепь LC-F106I перемещается «вверх» и занимает гидрофобный карман. Напротив, в структурах, в которых LC-F83 находится «в» конформации, боковая цепь LC-I106 перемещается «вниз» (обратите внимание, что ориентации «вверх» и «вниз» описаны со ссылкой на HVR как «вверх» и константный домен находится «внизу»). В отличие от LC-F83, движение LC-I106 не ограничивается боковой цепью и приводит также к конформационным изменениям в остове белка (LC-105 Φ-угол, LC-106 ψ-угол), что, вероятно, приводит к наблюдаемым различным углам изгиба. Таким образом, кристаллические структуры G6 предполагают, что изменения угла изгиба в G6 требуют конформационных изменений в положении LC-I106 и LC-F83.

Пример 4: Связь конформаций LC-83F с LC-106I является общей чертой в структурах антител человека

G6/G6.31 происходит из библиотеки фагов, которая построена на общих каркасных участках для тяжелой и легкой цепей (Lee et al., J. Mol. Biol. 340(5):1073-1093 (2004)). Ближайшими генами зародышевой линии легкой цепи являются IGKV1-39 и IGKJ1. Наиболее часто используемые подгруппы IGKV человека, согласно базе данных IMGT (Lefranc et al., In Silico Biology 5 (1): 45-60 (2005)), IGKV1 и IGKV3 несут фенилаланин в положении LC-83, тогда как другие менее часто используемые зародышевые линии обычно содержат валин (IGKV2 и IGKV4) или аланин (IGKV5 и IGKV6) в положении 83. Изолейцин в положении LC-106 сохраняется во всех пяти генах зародышевой линии IGKJ человека.

Чтобы определить, является ли связывание конформации боковой цепи положения F83 с конформацией изгиба Fab общей чертой в человеческих антителах, конформацию LC-F83 определяли в 319 кристаллических структурах Fab из банка данных о белках (PDB). Структуры были сгруппированы как структуры с LC-F83 в «в» конформации (двугранный угол chi1 между -50° и -100°) и структурами во «вне» конформации (угол chi1 в основном между 50° и 180°) (Фиг. 7А). Конформация LC-F83 коррелировала в подавляющем большинстве структур с изменениями в участке изгиба Fab в положении LC-106 (Фиг.7B). Кроме того, две группы демонстрировали значительные различия в угле изгиба (Фиг.7C), а также в области интерфейса V-C, демонстрируя, что структуры с большим углом изгиба имеют меньший, менее плотно упакованный интерфейс V-C, тогда как структуры с большим углом изгиба имеет большой интерфейс V-C (Фиг.7C).

Так как мутация LC-F83A приводила к более высокой термостабильности и более высокой аффинности к антигену, определяли угол изгиба 20 человеческих Fab-структур, доступных в PDB, несущих LC-83A и LC-106I. Эти структуры отражали свойства структур «вне» конформации LC-83F: они проявляли небольшой угол изгиба и большой интерфейс V-C (Фиг.7C).

Таким образом, эти результаты показали, что бимодальное распределение по углу изгиба Fab антител легкой цепи каппа человека, как наблюдалось ранее (Stanfield et al., выше), в основном является результатом различных конформаций боковой цепи фенилаланина в положении LC-83. Данные далее показали, что тип аминокислоты, которая присутствует в положении LC-83, оказывает большое влияние на угол изгиба Fab.

Материалы и способы

Структуры человеческих антител были получены из базы данных структурных антител (SAbDab, Dunbar et al., Nucleic Acids Research 42: D1140-1146 (2014)). Фильтрование дополнительной структуры и обработка структуры (изменение нумерации аминокислот, определение двугранного угла, структурные выравнивания) выполняли с использованием Bio3D (Grant et al., Bioinformatics 22 (21): 2695-2696 (2006)). Площадь интерфейса между константными и переменными доменами рассчитывалась с использованием локального примера CCP4-Pisa (Krissinel et al., J. Mol. Biol. 372(3):774-797 (2007)). ABangle (Dunbar et al., Protein Eng. Des. Sel. 26 (10): 611-620 (2013)) был использован для характеристики взаимодействия VH-VL. Для расчета угла изгиба использовался Pymol и общедоступный скрипт.

Пример 5: Моделирование молекулярной динамики подтверждает, что положение LC-83 действует как переключение к переходу между большой и малой конфигурацией изгиба Fab

Молекулярную динамику использовали для получения дальнейшего понимания эффектов мутации LC-F83A, идентифицированных в структурном мета-анализе, описанном в примере 4. Эффект мутации LC-F83A был имитирован в двух разных структурных фонах. Использовалась кристаллическая структура G6 Fab с большим углом изгиба (цепи G6 VU, «VU.F83») и кристаллическая структура с небольшим углом изгиба (цепи G6 BA, «BA.F83»). Обе структуры в дополнение к мутированным структурам (VU.F83A и BA.F83A) были смоделированы в течение 100 нс в воде. Во время моделирования никаких изменений в конформации F83 не наблюдалось: в случае VU.F83, LC-F83 оставался в «в» конформации, тогда как в случае BA.F83 остаток оставался во «вне» конформации (Фиг.8А). Сравнение изменений угла изгиба во времени на протяжении моделирования показало, что углы изгиба всех четырех молекул оставались довольно стабильными во время моделирования после начальной фазы уравновешивания около 25 нс (Фиг.8В). Не наблюдалось статистически значимой разницы в распределении углов изгиба BA.F83 и BA.F83A. Для обеих молекул угол изгиба колебался около 135°. Тем не менее, была значительная разница между углом изгиба VU.F83 и VU.F83A во время симулирования. В течение первых 25 нс симулирования угол изгиба VU.F83A коллапсировал и колебался около 140°, а угол изгиба VU.F83 отставался стабильным под большим углом 161° (Фиг.9А).

Результаты, представленные выше, демонстрируют важность «в» конформации LC-F83 для стабилизации большого угла изгиба Fab. Мутация LC-F83A привела к немедленному переходу к малому уголу изгиба и большого интерфейса VL-CL в имитировании молекулярной динамики. Поскольку не было никакого перехода боковой цепи LC-F83 от «в» до «вне» конформации и наоборот, эти результаты показывают, что LC-F83 накладывает значительный энергетический барьер на изменения угла изгиба молекулы.

В совокупности увеличение термостабильности G6.31LC-F83A по сравнению с G6.31 можно объяснить увеличением области взаимодействия интерфейса V-C, которая, в свою очередь, дополнительно стабилизирует складку четырех доменов Fab. Кроме того, более плотная упаковка в интерфейсе V-C снижает растворимость гидрофобных остатков, таких как LC-I106.

Материалы и способы

Имитация молекулярной динамики проводилось с использованием amber12 (Case et al., J. Comput. Chem. 26(16):1668-1688 (2005)). Если не указано иное, 100 нс моделировались при постоянном давлении и 300 К. Перед имитацией, секции в константных доменах структур G6, которые не были решены из-за отсутствия электронной плотности, были дополнены с использованием PDB введения 4hh9. Полученные имитированные структуры анализировали с использованием VMD (Humphrey et al., Journal of Molecular Graphics 14 (1): 33-38, 27-38 (1996)), Bio3d, CCP4-Pisa, Pymol и ABangle.

Пример 6: Динамика угла изгиба G6 Fab влияет на антиген-связывающий интерфейс путем модуляции угла кручения VH-VL

В то время как изменение угла изгиба Fab объясняло увеличение температуры плавления в варианте LC-F83A, эффект этой мутации на связывание антигена напрямую не объяснялся изменением динамики изгиба Fab. Не желая связывать себя теорией, мутация LC-F83A может косвенно влиять на антиген-связывание посредством изменения угла изгиба Fab или напрямую влиять на антиген-связывание, поскольку LC-F83A находится близко к VH-VL-интерфейсу и может влиять на ориентацию доменов VH и VL друг к другу. Интерфейс VH-VL, хотя и не находится в прямом контакте с антигеном, может оказывать сильное влияние на аффинность антиген-связывания (см., например, Masuda et al., FEBS J. 273 (10): 2184-2194 (2006), Khalifa et al., Journal of Molecular Recognition 13 (3): 127-139 (2000)). Кроме того, в свободном от антигена состоянии, VH-VL-интерфейс Fab обычно является гибким, с антиген-связыванием, что приводит к увеличению жесткости (Dunbar et al., Prot. Eng. Des. Sel. 26(10):611-620 (2013)). Кроме того, ориентация VH-VL может существенно различаться между лиганд-свободной и антиген-связанной формой (см., например, Stanfield et al., Structure 1 (2): 83-93 (1993)).

Действительно, кристаллические структуры G6 показали гибкость и существенные различия в углах кручения VH/VL (угол кручения HL) между различными антиген-свободными структурами G6 (G6несвязанный) и VEGF-связанными структурами (G6связанный).Средний угол кручения VH/VL (угол кручения HL) шести G6свободных молекул, которые имеют большой угол изгиба, составляет приблизительно 60°, в то время как для шести молекул, имеющих небольшой изгиб, примерно 58°. Это, в свою очередь, существенно ближе к среднему углу кручения HL G6VEGF, который составляет -55° (Фиг.9В).

Имитирование молекулярной динамики использовалось для исключения возможности того, что эти изменения угла кручения были артефактом кристаллизации. Средний угол кручения HL для VU.F83 составляет приблизительно 62°, в то время как для BA.F83 был приблизительно 59°, что соответствует результатам, найденным в кристаллических структурах G6. Более того, два мутантных Fab (BA.F83A и VU.F83A) демонстрировали еще меньший угол кручения (приблизительно 57° и приблизительно 57° соответственно), что еще ближе к углу кручения, наблюдаемому в структурах, связанных с G6 (Фиг.9C). Более того, мутация в LC-F83A предполагала дополнительный эффект мутации на VH-VL-интерфейсе, поскольку HL-угол BA.F83A был значительно меньше, чем у BA.F83 (p <0,0001)

Эти результаты показали, что мутация LC-F83A влияет на угол кручения HL и, в свою очередь, связывает антиген двумя различными механизмами. Во-первых, мутация LC-F83A опосредует это косвенно, изменяя угол изгиба Fab. Структурные данные и моделирование молекулярной динамики показали, что существует корреляция между углом изгиба и углом HL (Фиг. 8A-8C и 9A-9D). Во-вторых, LC-83 напрямую влияет на интерфейс VH-VL. Наблюдалось дополнительное значительное увеличение угла кручения HL при введении LC-F83A (Фиг.9A-9D, сравнение молекул BA.F83 и BA.F83A). Результатом является конфигурация сайта связывания антигена в антиген-свободной форме G6.31LC-F83A, которая ближе к той, которая наблюдается в структуре G6VEGF. Не желая связывать себя теорией, перегруппированный интерфейс связывания антигена G6.31LC-F83A может привести к снижению энергетической стоимости для связывания VEGF и, следовательно, к наблюдаемому увеличению аффинности (уменьшение Kd) G6.31LC-F83A. Кроме того, предположительно лучшая упаковка интерфейса VH-VL в G6.31LC-F83A может обеспечить альтернативный или дополнительный механизм стабилизации складок (см., например, Rothlisberger et al., J. Mol. Biol. 347 (4): 773-789 (2005)), чтобы объяснить наблюдаемое увеличение Tm.

Материалы и способы

Структурный анализ и моделирование молекулярной динамики проводили, как описано в примерах 3-5.

Пример 7: Масс-спектрометрия с обменом водорода и дейтерием (HDX-MS) подтверждает конформационные изменения в интерфейсе с постоянной переменной, а также в антиген-связывающем участке в G6.31F83A по сравнению с G6.31.

HDX-MS использовали для демонстрации того, что изменения в междоменной динамике молекулы Fab из-за мутации LC-F83A, описанные в примерах 3-6, можно наблюдать в растворе. HDX-MS измеряет коэффициент обменивания атомов водорода остова амида с дейтерием. Атомы водорода амидного остова обычно обмениваются быстрее, если они подвергаются воздействию растворителей и не участвуют в образовании водородных связей по сравнению с тем, когда они погружены и/или участвуют в образовании водородных связей. В нескольких участках показаны различия, когда модель обмена водород-дейтерий G6.31 сравнивается с G6.31LC-F83A (Фиг.9D). DE-петля домена CL, который формирует интерфейс VL-CL и находится в непосредственной близости от мутации LC-F83A, обмениваясь медленнее в G6.31LC-F83A по сравнению с G6.31. Наблюдались также изменения коэффициента обмена петель HVR и соседних участков. Петли HVR H1 и L2 обменивались медленнее в G6.31LC-F83A по сравнению с G6.31, тогда как соседние участки петли HVR-H3, которые находятся в интерфейсе VH-VL, обменивались быстрее. Петли HVR-L2 и HVR-H3 являются частью интерфейса VH-VL (см., например, Vargas-Madrazo et al., Journal of Molecular Recognition 16 (3): 113-120 (2003), Aburatani et al., J. Biochem. 132(5):775-782 (2002); Padlan, Molecular Immunology 31(3):169-217 (1994)). Поэтому изменения в схеме обмена, наблюдаемые в HVR и интерфейсе VL-CL в HDX-MS между G6.31 и G6.31LC-F83A, независимо подтвердили результаты, полученные в результате структурного анализа и имитирования молекулярной динамики.

Материалы и способы

Образцы мутанта G6.31 ДТ и F83A (45 мкМ) разбавляли в 15 раз в 20 мМ гистидин-ацетатного буфера при pD 7,0 и 50 мМ NaCl с содержанием D2O > 90 % для начала реакции мечения при 20°C. При шести интервалах времени с логарифмическим интервалом, составляющем от 30 секунд до 1000 минут, реакцию маркировки гасили путем снижения рН (рН 2,5) и добавления 2 М хлорида гуанидиния (GdmCl) и 0,25 М трис(2-карбоксиэтил)фосфина (TCEP) до инъекции в холодную онлайн-систему (см., например, Mayne et al., J. Am. Soc. Mass Spectrom. 22(11):1898-1905, 2011).

Вкратце, погашенные образцы сначала пропускали через колонку иммобилизованного пепсина (2,1×30 мм, Applied Biosystems) при 0°C для протеолиза и затем связывали с колонкой-ловушкой для обессоливания (ACQUITY VANGUARD™ C8) перед отделением хроматографией с обращенной фазой (ACQUITY UPLC® BEH C18, размер частиц 1,7 мкм, 1,0×50 мм) и вводится в масс-спектрометр (Thermo ORBITRAP ELITE™, разрешение 120 кГц при m/z 400) для измерения содержания дейтерия. Хроматографические подвижные фазы получали, как описано ранее (Walters et al., J. Am. Soc. Mass Spectrom. 23 (12): 2132-2139, 2012) с рН 2,25 для максимизации восстановления дейтерия, который составлял в среднем 82 % путем измерения полностью дейтерированных контролей. Эксперименты с мутантом и диким типом были чередующимися, а рандомизированные временные точки были собраны в трех экземплярах; весь процесс был автоматизирован робототехнической платформой LEAPv1 (Leap Technologies, Каррборо, Северная Каролина), которая выполняла все этапы обработки образцов. Этот процесс привел к 152 уникальным пептидам, последовательно идентифицированным программой ExMS (Kan et al., J. Am. Soc. Mass Spectrom. 22 (11): 1906-1915, 2011) как для образцов дикого типа, так и для мутантов, обеспечивая покрытие порядка примерно 95 %. Анализ содержания дейтерия включал использование ранее описанных пользовательских сценариев python (Kan et al., выше, Walters et al. Proc. Natl. Acad. Sci. USA 110(47):18898-18903, 2013; и Hu et al. Proc. Natl. Acad. Sci. USA 110 (19): 7684-7689, 2013), и существенные различия в уровнях поглощения дейтерия между диким типом и мутантом были идентифицированы с помощью t-критерия Стьюдента как имеющее p-значение < 0,05, описанное ранее для экспериментов HDX-MS (Leurs et al. Anal. Chem. 86(23):11734-11741, 2014).

Пример 8: Соматическая гипермутационная мишень LC-83 и LC-106 в антителах человека

Положение LC-83 расположено вблизи мотива горячей точки AID (RGYW, где R представляет собой пурин, Y представляет собой пиримидин, а W представляет собой A или T) в гене легкой цепи зародышевой линии IGKV1-39. Увеличение термостабильности, вызванное мутацией LC-F83A, можно было переносить на другие антитела, которые происходят из тех же зародышевых линий, что и G6.31. Поэтому была оценена частота соматических мутаций в положении LC-83 в человеческих антителах. Кроме того, LC-106 также был включен в этот анализ.

Для изучения распределения соматической гипермутации (SHM) были использованы два подхода в последовательностях легкой цепи, происходящих из зародышевых линий IGKV1. Первым было сопоставление соматических мутаций 4623 уникальных человеческих последовательностей легкой цепи IGKV1, доступных в нескольких общедоступных базах данных (Фиг. 10А, верхняя вставка). Во-вторых, путем амплификации последовательностей IGKV1 из РНК, происходящих из более чем 1000 отдельных человеческих лимфоидных тканей, за которыми следует высокоточное одномолекулярное секвенирование в реальном времени (SMRT) и сравнение SHM. Несмотря на различное происхождение двух наборов данных, наблюдалось очень сходное распределение соматических мутаций (Фиг. 10А-10С). LC-83 является одной из наиболее часто мутированных позиций в сегменте VL; 7 % и 19 % всех последовательностей IGKV1 переносят мутацию в LC-83 в двух наборах данных, соответственно. Интересно, что положение LC-106 также часто мутировалось в последовательностях IGKV1 (9 % и 20 % соответственно), а наиболее распространенной мутацией является валин. Самыми близкими сегментами гена зародышевой линии для G6 VL являются IGKV1-39 и IGJ1. Таким образом, были исследованы антитела к источнику зародышевой линии IGKV1.39, которые показали, что соматические мутации у LC-F83 в основном приводят к меньшим боковым цепям (включая серин, валин и лейцин) (Фиг.10A-10C). Аланиновые замены в антителах IGKV1.39 не наблюдались, вероятно, из-за того, что мутация аланина потребовала бы замены на два основания в кодоне в LC-F83, которая редко встречается.

Затем были получены варианты Fab G6.31, несущие наиболее частые соматические мутации для положения LC-83 и LC-106, и их влияние на связывание и термостабильность антигена было определено (Фиг. 10D). Все варианты одиночной мутации увеличили Tm на 4,8 °C до 6 °C, предположительно, уменьшив угол изгиба Fab и увеличив площадь интерфейса VL-CL. Закономерно, двойная мутация LC-F83A/LC-I106V не привела к значительному увеличению Tm. Не желая связывать себя теорией, одновременное уменьшение размера обеих боковых цепей оставляло бы пустоту в гидрофобной полости, обычно занимаемую LC-F83 или LC-I106, и уменьшала способность VL стабильно упаковывать против CL. Влияние мутации LC-83 на аффинность VEGF является смешанной. LC-F83V приводит к 3-кратному увеличению аффинности, аналогичному LC-F83A, тогда как мутации LC-F83S и LC-I106V почти не увеличивают аффинность. Влияние мутации LC-83 на аффинность антигена может быть зависимым от контекста. Мутации LC-F83A вводили в другое антитело, происходящее из той же зародышевой линии, что и G6.31, и наблюдалось подобное увеличение термостабильности и аффинности. Кроме того, сообщалось, что мутация LC-F83S увеличивает аффинность анти-эстрадиального антитела.

Таким образом, LC-83 и LC-106 часто мутируют в человеческих антителах. Учитывая влияние этих двух позиций на аффинность и стабильность, оптимизация общей динамики домена Fab является молекулярным механизмом, который может быть использован во время созревания аффинности антител in vivo.

Материалы и способы

Последовательности легкой цепи человека были получены из различных общедоступных источников: Absis (доступен на сайте bioinf.org.uk/abysis), база данных Кабат (Martin, Proteins 25 (1): 130-133 (1996)), база данных IMGT (Lefranc, Molecular Biotechnology 40 (1): 101-111 ( 2008)), GenBank (Benson et al., Nucleic Acids Research 43: D30-35 (2015)) и Банк белковых структур (Berman et al., Nucleic Acids Research, 28 (1): 235-242 (2000)). Дублированные последовательности удаляли, а самые близкие гены зародышевой линии были назначены для соответствующих V-сегментов с использованием IGBlast (Ye et al., Nucleic Acids Research 41: W34-40 (2013)). Последовательности, для которых была назначена зародышевая линия мыши или крысы, были удалены из набора данных. Последовательности были пронумерованы по Кабат (см., например, Wu et al., J. Exp. Med. 132 (2): 211-250 (1970)) и были идентифицированы соматические мутации в каркасе V-сегмента. Мутации в участках HVR (как определено схемой нумерации по Кабат) в этом анализе не рассматривались.

Второй источник последовательностей антител человека был получен из коммерчески доступной РНК из человеческих селезенки, миндалин, костного мозга и лимфоцитов периферической крови, полученных от 1088 индивидуумов (Clonetech and Amsbio). РНК сначала транскрибировали в кДНК с использованием набора для амплификации кДНК SMARTER® RACE (Clonetech). IGKV-специфическую ДНК амплифицировали с использованием 5'RACE (Advantage 2 PCR Kit, Clonetech) с обычным праймером, отжигающим 5'-участок участка IGKC (5'-CATCAGATGGCGGGAAGATGAAGACAGATGGTGC-3' (SEQ ID NO: 56)), тогда как IGKV1 сегменты были обогащены во второй стадии ПЦР с использованием праймеров: вперед: 5'-GCCATCCAGATGACCCAGTCTCC-3' (SEQ ID NO: 57) и обратно: 5'-GGCTGCACCATCTGTCTTC-3' (SEQ ID NO: 58). Продукт ПЦР очищали в геле и секвенировали с использованием Pacific Bioscience RSII (EA Genomic Services). Получено в общем 994,8 Мб. Консенсусная последовательность каждого чтения была создана с использованием программного пакета Pacific Bioscience SMRT Analysis 2.3. Аннотацию зародышевой линии консенсусных последовательностей проводили с использованием VDJFasta (Glanville et al. Proc. Natl. Acad. Sci. USA 106(48):20216-20221). Последовательности были пронумерованы по Кабат и идентифицированы соматические мутации в каркасе V-сегмента. В общей сложности 19034 последовательностей были аннотированы как IGKV1, из которых 3796 содержали по меньшей мере три каркасных участка и два HVR и были включены для генерации SHM-распределений.

Пример 9: Идентификация вариантов поверхностного заряда G6.31

Для выделения мутаций, которые можно было бы использовать для снижения pI G6.31, расположеннные на поверхности позиции были идентифицированы в вариабельных доменах с использованием структурной информации из кристаллической структуры G6. Позиции, для которых замещение глутаматом показало коэффициент обогащения 1 или более, основанный на пэннинге VEGF в библиотеках прохождения NNK VH и VL (пример 2), были выбраны для проверки их влияния на аффинность связывания VEGF с помощью одного цикла кинетического анализа с использованием BIACORE ® T200 системы и термостабильности (DSF) (таблица 3A). Варианты мутантов, содержащие замены к глутамату, а также другие заряженные остатки (например, аргинин, лизин), были получены, экспрессированы и очищены, как описано выше (см. Пример 2, «Материалы и способы»). Обратите внимание, что в некоторых случаях общий Kd, приведенный в таблице 3A для некоторых вариантов, слабее по сравнению с результатами в таблице 4 из-за различий в подгонке между одним циклом кинетического анализа (таблица 3A) и множественным циклом кинетического анализа (таблица 4). В таблице 3В показан выход, процент мономера (% мономера) и время элюирования для указанных вариантов.

Таблица 3A: Характеристика вариантов с расположенной на поверхности полярной аминокислотой

Вариант kon
(1/Mс)
koff
(1/с)
Kd
(M)
Кратность изменения
(относительно G6.31)
Tm
G6.31 (ДТ) 3,01E+05 5,13E-04 1,7E-09 -- 83,8
LC-S7E 3,56E+05 4,43E-04 1,24E-09 1,4 85,8
LC-S9E 1,24E+06 4,57E-04 3,68E-10 4,6 85,4
LC-S10E 2,63E+05 4,29E-04 1,63E-09 1,0 86
LC-S12E 2,01E+05 4,58E-04 2,27E-09 0,7 84
LC-A13E 4,83E+05 3,94E-04 8,17E-10 2,1 79,2
LC-T20E 2,46E+05 4,57E-04 1,86E-09 0,9 84,6
LC-Q27E 2,30E+05 4,50E-04 1,96E-09 0,9 84,6
LC-P40E 3,03E+04 5,41E-04 1,79E-08 0,1 83
LC-A51E 1,72E+05 4,62E-04 2,68E-09 0,6 76,8
LC-Y55E 4,53E+04 5,31E-04 1,17E-08 0,1 80,8
LC-G57E 4,29E+05 4,18E-04 9,74E-10 1,7 83
LC-P59E 2,84E+05 4,44E-04 1,56E-09 1,1 82,8
LC-S77E 7,11E+05 3,99E-04 5,62E-10 3,0 84,6
LC-Y92E 4,97E+05 1,03E-03 2,07E-09 0,8 80
LC-G93E 2,48E+05 1,49E-03 5,98E-09 0,3 76,2
LC-A13R 3,25E+05 4,58E-04 1,41E-09 1,2 81,6
LC-G16K 3,11E+05 4,46E-04 1,43E-09 1,2 79,6
LC-S50R 2,45E+05 4,64E-04 1,89E-09 0,9 84
LC-T31R 2,71E+05 4,89E-04 1,80E-09 0,9 84
LC-T72R 2,92E+05 4,46E-04 1,53E-09 1,1 84,4
HC-V2E 3,00E+05 3,95E-04 1,32E-09 1,3 83,4
HC-S5E 7,88E+05 4,54E-04 5,76E-10 3,0 84
HC-S7E 7,61E+05 3,81E-04 5,01E-10 3,4 85,2
HC-G8E 6,57E+05 4,55E-04 6,93E-10 2,5 83,4
HC-L11E 5,63E+05 5,07E-04 9,01E-10 1,9 82
HC-G16E 7,30E+05 4,54E-04 6,22E-10 2,7 83,2
HC-T28E 6,21E+05 3,52E-04 5,66E-10 3,0 85,2
HC-S30E 7,85E+04 5,58E-04 7,1E-09 0,2 84
HC-A40E 1,97E+05 5,17E-04 2,63E-09 0,6 83,8
HC-P41E 1,52E+05 5,48E-04 3,6E-09 0,5 84,4
HC-K43E 3,80E+05 4,82E-04 1,27E-09 1,3 84,2
HC-Y58E 8,20E+05 5,08E-04 6,2E-10 2,7 84
HC-A60E 5,24E+05 5,65E-04 1,08E-09 1,6 83,2
HC-K64E 5,52E+05 3,95E-04 7,15E-10 2,4 84
HC-G65E 3,02E+05 4,72E-04 1,56E-09 1,1 84,2
HC-T68E 2,15E+05 4,40E-04 2,05E-09 0,8 84,8
HC-A71E 2,57E+05 3,79E-04 1,48E-09 1,1 84,8
HC-T73E 5,50E+05 4,34E-04 7,88E-10 2,2 84,6
HC-S74E 2,36E+05 4,99E-04 2,11E-09 0,8 84,4
HC-K75E 2,17E+05 4,44E-04 2,04E-09 0,8 84,2
HC-N76E 2,71E+05 4,67E-04 1,72E-09 1,0 81,4
HC-T77E 2,48E+05 4,77E-04 1,93E-09 0,9 84,8
HC-Q81E 2,25E+05 4,95E-04 2,2E-09 0,8 85
HC-S82bE 4,37E+05 4,33E-04 9,91E-10 1,7 84,2
HC-Q105E 1,09E+05 4,63E-04 4,24E-09 0,4 84,6
HC-T107E 4,16E+05 5,94E-04 1,43E-09 1,2 85,8
HC-L11R 8,90E+05 4,35E-04 4,88E-10 3,5 81,4
HC-T28K 9,75E+05 4,10E-04 4,20E-10 4,0 85,4
HC-P41R 5,71E+05 5,54E-04 9,70E-10 1,8 84,6
HC-Y56K 7,24E+05 6,99E-04 9,65E-10 1,8 84,8
HC-T68K 3,97E+05 5,13E-04 1,29E-09 1,3 84,6
HC-T77K 2,03E+06 4,50E-04 2,22E-10 7,7 84

Таблица 3B: Параметры очистки для вариантов с расположенной на поверхности полярной аминокислотой

Вариант Выход (мг) % Мономер Время элюирования (мин)
G6.31 (ДТ) 0,57 97,86 12,74
LC-S7E 0,24 77,02 12,39
LC-S9E 0,32 77,19 12,43
LC-S10E 0,05 54,64 12,44
LC-S12E 0,28 74,57 12,41
LC-A13E 0,31 67,58 12,4
LC-T20E 0,32 73,31 12,36
LC-Q27E 0,26 78,98 12,19
LC-P40E 0,34 67,56 12,43
LC-A51E 0,31 67,73 12,28
LC-Y55E 0,3 68,83 12,42
LC-G57E 0,3 67,9 12,28
LC-P59E 0,35 71,85 12,41
LC-S77E 0,36 73,49 12,37
LC-Y92E 0,31 100 12,2
LC-G93E 0,3 100 12,55
LC-A13R 0,35 70,15 12,41
LC-G16K 0,32 72,84 12,36
LC-S50R 0,33 100 12,13
LC-T31R 0,34 74,87 12,49
LC-T72R 0,28 72,31 12,41
HC-V2E 0,3 97,45 12,32
HC-S5E 0,36 97,14 12,44
HC-S7E 0,32 100 12,5
HC-G8E 0,33 100 12,36
HC-L11E 0,33 100 12,48
HC-G16E 0,36 100 12,46
HC-T28E 0,29 97,52 12,08
HC-S30E 0,36 94,81 11,9
HC-A40E 0,34 95,91 12,41
HC-P41E 0,38 100 12,62
HC-K43E 0,36 100 12,54
HC-Y58E 0,37 100 11,97
HC-A60E 0,27 97,58 12,39
HC-K64E 0,31 97,83 12,36
HC-G65E 0,32 98,01 12,41
HC-T68E 0,35 100 12,41
HC-A71E 0,42 100 12,53
HC-T73E 0,37 100 12,14
HC-S74E 0,36 100 12,36
HC-K75E 0,27 94,47 12,38
HC-N76E 0,37 95,68 12,02
HC-T77E 0,41 97,5 12,51
HC-Q81E 0,33 97,72 12,49
HC-S82bE 0,4 93,54 12,47
HC-Q105E 0,37 98,41 12,55
HC-T107E 0,32 98,04 12,23
HC-L11R 0,37 99,81 12,53
HC-T28K 0,39 97,98 12,43
HC-P41R 0,34 100 12,6
HC-Y56K 0,39 100 12,13
HC-T68K 0,42 100 12,39
HC-T77K 0,33 94,64 12,51

Как показано в таблице 3А, было идентифицировано несколько вариантов зарядов с поверхностным расположением, которые имели сопоставимую или улучшенную аффинность связывания с VEGF по сравнению с G6.31.

Пример 10: Генерация и характеристика комбинированных вариантов с улучшенной аффинностью связывания с VEGF и улучшенной стабильностью

A. Генерация вариантов с улучшенной аффинностью связывания с VEGF и улучшенной стабильностью

G6.31 содержит сайт саморасщепления в HVR-L3 (N94-P95), который может повлиять на его стабильность. Комбинации отдельных вариантов, описанных в примере 2 (см., например, таблица 2), объединяли для идентификации клонов с повышенной аффинностью связывания и повышенной стабильностью. Четыре мутации, в частности, были сосредоточены на: LC-F83A (обеспечивает улучшенную термостабильность и сродство), LC-N94A (удаляет сайт саморасщепления), HC-Y58R (улучшает аффинность) и HC-N82aR (улучшает аффинность). Было также проверено несколько других замещений в положении LC-N94, предназначенных для удаления сайта саморасщепления, для их влияния на аффинность связывания с VEGF с помощью нескольких циклов кинетического измерения, а также на стабильность с помощью DSF (таблица 4). Удаление сайта саморасщепления последовательно уменьшало фрагментацию, как оценивали по проценту объектов с низкой молекулярной массой, определяемым с использованием капиллярного электрофореза додецилсульфата натрия в невосстанавливающих условиях (CE-SDS) (Фиг.12).

Таблица 4. Аффинность и термостабильность вариантов сайта саморасщепления

Вариант kon (1/Mс) koff (1/с) Kd (нM) Tm(°C) Увеличение Tm
(относительно к ДТ)
G6.31 WT 7,54E+05 3,95E-04 0,525 84 --
LC-N94A 1,59E+06 1,69E-03 1,06 85,6
LC-N94Q 3,18E+05 3,62E-04 1,14 84,6
LC-N94R 1,94E+05 4,07E-04 2,09 85,2

Комбинация вариантов LC-F83A, LC-N94A, HC-Y58R и HC-N82aR в один клон («Y58R.N94A.N82aR.F83A», также называемый «G6.31 AARR») привела к значительно повышенной аффинности связывания для VEGF (Kd = 80 пМ), что в 6,6 раза выше по сравнению с G6.31. Y58R.N94A.N82aR.F83A также имел заметно улучшенную термостабильность по сравнению с G6.31 с увеличением Tm на 4,8 °C. (Таблица 5). Аминокислотная последовательность VH-домена Y58R.N94A.N82aR.F83A показана в SEQ ID NO: 11, и аминокислотная последовательность домена VL показана в SEQ ID NO: 12.

Таблица 5: Комбинированный вариант Y58R.N94A.N82aR.F83A имеет улучшенную аффинность связывания с VEGF и улучшенную стабильность по сравнению с G6.31

Вариант kon (1/Mс) koff
(1/с)
Kd (нM) Улучшенное сворачивание (относительно ДТ) Tm (°C) Увеличение Tm (относительно к ДТ)
G6.31 ДТ 7,54E+05 3,95E-04 0,525 -- 84,0 --
LC-F83A 1,65E+06 2,18E-04 0,132 4,0 89,0
LC-N94A 1,59E+06 1,69E-03 1,06 0,5 85,6
HC-Y58R 2,42E+06 1,84E-04 0,076 6,9 83,2
HC-N82aR 1,62E+06 1,24E-04 0,077 6,8 84,0
Y58R.N94A.N82aR.F83A 4,00E+06 3,20E-04 0,080 6,6 88,8
Y58R.N94A.F83A 2,22E+06 3,01E-04 0,135 3,9 89,2

B. Генерация вариантов с расположенной на поверхности полярной аминокислотой с измененным pI

Для генерации вариантов с более низким pI, в последовательность G6.31 вводили несколько глутаматных замещений. На основе данных об единичной мутации варианта с расположенной на поверхности полярной аминокислотой (Таблицы 3A-3B) варианты, которые не оказали большого отрицательного влияния на связывание VEGF, были отобраны для дальнейшего конструирования. Уровень экспрессии (оцениваемый по урожайности) и уменьшенная агрегация (в соответствии с высоким % мономера) также учитывались при выборе мутаций. Изо-электростатическую поверхность G6.31 рассчитывали с использованием APBS (Baker et al. Proc Natl. Acad. Sci. USA 98(18):10037-10041 (2001)). Выбранные глутаматные мутации были отображены на электростатической поверхности, и были выбраны комбинации мутаций глутамата, которые (i) избегали мутаций, которые были расположены пространственно близко друг к другу, и (ii), которые благоприятствовали мутациям, которые находились в сильном положительно-заряженном пятне. Для дальнейшей характеристики были созданы два варианта комбинации тяжелых цепей (с R19E и без них) и пять вариантов комбинации легкой цепи (таблица 6). Все варианты комбинации легкой цепи содержали мутацию LC-N94A для удаления сайта саморасщепления и мутации LC-F83A для улучшения термостабильности антитела. Некоторые из вариантов показали улучшенную аффинность к VEGF (см. Таблицу 6, Таблицу 7 и Таблицу 9). Например, HCLC2 и HCLC5 показали улучшенную аффинность и заметно уменьшенный pI по сравнению с G6.31 (pI 5,3 и 5,6 соответственно, по сравнению с pI 8,9 для G6.31) (см. Таблицу 7 и Таблицу 9).

Таблица 6: Комбинация вариантов с расположенной на поверхности полярной аминокислотой

Вариант Тип SEQ ID NO: Мутации
HCcombo VH 33 V2E, S7E, R19E, T28E, A40E, G16E, K43E, T57E, K64E, K75E, S82BE, T107E
R19HCcombo VH 51 V2E, S7E, T28E, A40E, G16E, K43E, T57E, K64E, K75E, S82BE, T107E
LCcombo1 VL 34 S9E, R18E, F83A, N94A
LCcombo2 VL 35 R18E, K42E, S76E, F83A, N94A
LCcombo3 VL 36 S9E, R18E, K42E, F83A, N94A
LCcombo4 VL 37 R18E, F83A, N94A
LCcombo5 VL 12 F83A, N94A

Таблица 7: Кинетика связывания сочетания вариантов с расположенной на поверхности полярной аминокислотой с VEGF

Название антитела kon
(1/Mс)
koff
(1/с)
Kd
(M)
VH VL
HCcombo 2,05E+06 2,74E-04 1,34E-10 HCcombo G6.31 ДТ
HCLC2 2,12E+06 6,23E-04 2,93E-10 HCcombo LCcombo2
HCLC4 2,03E+06 6,08E-04 2,99E-10 HCcombo LCcombo4
HCLC5 1,81E+06 5,73E-04 3,16E-10 HCcombo LCcombo5
HCLC3 1,84E+06 6,08E-04 3,30E-10 HCcombo LCcombo3
HCLC1 1,37E+06 6,07E-04 4,42E-10 HCcombo LCcombo1
G6.31 WT 9,99E+05 5,99E-04 5,99E-10 G6.31 ДТ G6.31 ДТ
LCcombo2 5,99E+05 6,67E-04 1,11E-09 G6.31 ДТ LCcombo2
LCcombo3 5,74E+05 7,68E-04 1,34E-09 G6.31 ДТ LCcombo3
LCcombo5 5,37E+05 7,66E-04 1,43E-09 G6.31 ДТ LCcombo5
LCcombo4 4,63E+05 8,08E-04 1,75E-09 G6.31 ДТ LCcombo4
LCcombo1 4,47E+05 1,01E-03 2,27E-09 G6.31 ДТ LCcombo1
R19HCLC2 8,89E+05 4,67E-05 9,49E-11 R19HCcombo LCcombo2
R19HCLC4 2,84E+05 4,79E-05 1,69E-10 R19HCcombo LCcombo4
R19HCLC5 7,07E+05 4,41E-05 6,24E-11 R19HCcombo LCcombo5

Кроме того, было создано несколько других вариантов сочетания, которые включали выбранные поверхностно-расположенные замены глутамата и отдельные варианты, которые улучшали аффинность и/или стабильность (таблица 8).

Таблица 8: Кинетика связывания дополнительных вариантов сочетания

Варианты kon (1/Mс) koff (1/с) Kd (M)
HC-A40E, HC-T57E 2,96E+06 8,04E-04 2,72E-10
LC-F83A, LC-N94A 6,48E+05 1,11E-03 1,71E-9
LC-F83A, LC-N94A, LC-T22D 1,33E+06 7,44E-04 5,58E-10
HC-A40E, HC-T57E
LC-F83A, LC-N94A
1,27E+06 7,41E-04 5,84E-10
HC-A40E, HC-T57E, LC-F83A,
LC-N94A, LC-T22D
1,20E+06 7,18E-04 5,97E-10

Таблица 9 показывает резюме аффинности связывания, стабильности и данных pI для выбранных вариантов комбинации. Антитело pI рассчитывали с использованием собственной программы и путем запуска геля изоэлектрической фокусировки (IEF) со стандартным контролем pI. В таблице 10 приведены соответствующие аминокислотные последовательности VH и VL для этих антител. В таблице 11 показаны аминокислотные последовательности VL HVR для этих антител. В таблице 12 показаны аминокислотные последовательности VH HVR для этих антител.

Таблица 9: Резюме выбранных вариантов сочетания

Название антитела kon
(1/Mс)
koff
(1/с)
Kd
(нM)
Fab Tm (°C) pI
G6.31 7,54E+05 3,95E-04 0,525 83,8 8,9
LC-N94A 1,56E+06 1,69E-03 1,060 85,8 8,9
LC-N94A.LC-F83A 6,48E+05 1,11E-03 1,710 88 8,9
LC-N94A.LC-F83A
HC-A40E.HC-T57E
(G6.31 AAEE)
1,27E+06 7,41E-04 0,580 88 8,5
N94A.F83A.N82aR.Y58R
(G6.31 AARR)
2,22E+06 3,01E-04 0,135 88,2 9,3
HCcombo 2,05E+06 2,74E-04 0,134 71,2 5,6
HCLC2 2,12E+06 6,23E-04 0,293 72,6 5,3
HCLC4 2,03E+06 6,08E-04 0,299 73,4 5,4
HCLC5 1,81E+06 5,73E-04 0,316 73,8 5,6
HCLC3 1,84E+06 6,08E-04 0,330 73,8 5,3
HCLC1 1,37E+06 6,07E-04 0,442 73,6 5,4
R19HCLC2 8,89E+05 4,67E-05 0,095 74,8 5,7
R19HCLC4 2,84E+05 4,79E-05 0,169 76,2 5,8
R19HCLC5 7,07E+05 4,41E-05 0,062 76,2 6

Таблица 10: VH и VL аминокислотные последовательности для антител из таблицы 9

Название антитела Вариант VH (SEQ ID NO) Вариант VL (SEQ ID NO)
G6.31 ДТ G6.31 ДТ (SEQ ID NO: 42) G6.31 ДТ (SEQ ID NO: 38)
LC-N94A G6.31 ДТ (SEQ ID NO: 42) N94A (SEQ ID NO: 41)
LC-N94A.LC-F83A G6.31 ДТ (SEQ ID NO: 42) N94A.F83A (SEQ ID NO: 12)
LC-N94A.LC-F83A
HC-A40E.HC-T57E
(G6.31 AAEE)
A40E.T57E (SEQ ID NO: 40) N94A.F83A (SEQ ID NO: 12)
N94A.F83A.N82aR.Y58R
(G6.31 AARR)
N82aR.Y58R (SEQ ID NO:11) N94A.F83A (SEQ ID NO: 12)
HCcombo HCcombo (SEQ ID NO: 33) G6.31 ДТ (SEQ ID NO: 38)
HCLC2 HCcombo (SEQ ID NO: 33) LCcombo2 (SEQ ID NO: 35)
HCLC4 HCcombo (SEQ ID NO: 33) LCcombo4 (SEQ ID NO: 37)
HCLC5 HCcombo (SEQ ID NO: 33) N94A.F83A (SEQ ID NO: 12)
HCLC3 HCcombo (SEQ ID NO: 33) LCcombo3 (SEQ ID NO: 36)
HCLC1 HCcombo (SEQ ID NO: 33) LCcombo1 (SEQ ID NO: 34)
R19HCcombo R19HCcombo (SEQ ID NO: 51) G6.31 ДТ (SEQ ID NO: 38)
R19HCLC2 R19HCcombo (SEQ ID NO: 51) LCcombo2 (SEQ ID NO: 35)
R19HCLC4 R19HCcombo (SEQ ID NO: 51) LCcombo4 (SEQ ID NO: 37)
R19HCLC5 R19HCcombo (SEQ ID NO: 51) N94A.F83A (SEQ ID NO: 12)

Таблица 11: Последовательности VL HVR для антител из таблицы 9

Название антитела HVR-L1 HVR-L2 HVR-L3
G6.31 ДТ RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGNPFT
(SEQ ID NO: 23)
LC-N94A RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
LC-N94A.LC-F83A RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
LC-N94A.LC-F83A
HC-A40E.HC-T57E
(G6.31 AAEE)
RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
N94A.F83A.N82aR.Y58R
(G6.31 AARR)
RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
HCcombo RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGNPFT
(SEQ ID NO: 23)
HCLC2 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
HCLC4 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
HCLC5 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
HCLC3 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
HCLC1 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
R19HCcombo RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGNPFT
(SEQ ID NO: 23)
R19HCLC2 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
R19HCLC4 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)
R19HCLC5 RASQDVSTAVA
(SEQ ID NO: 8)
SASFLYS
(SEQ ID NO: 9)
QQGYGAPFT
(SEQ ID NO: 10)

Таблица 12: Последовательности VH HVR для антител из таблицы 9

Название антитела HVR-H1 HVR-H2 HVR-H3
G6.31 ДТ DYWIH
(SEQ ID NO: 1)
GITPAGGYTYYADSVKG
(SEQ ID NO: 53)
FVFFLPYAMDY
(SEQ ID NO: 3)
LC-N94A DYWIH
(SEQ ID NO: 1)
GITPAGGYTYYADSVKG
(SEQ ID NO: 53)
FVFFLPYAMDY
(SEQ ID NO: 3)
LC-N94A.LC-F83A DYWIH
(SEQ ID NO: 1)
GITPAGGYTYYADSVKG
(SEQ ID NO: 53)
FVFFLPYAMDY
(SEQ ID NO: 3)
LC-N94A.LC-F83A
HC-A40E.HC-T57E
(G6.31 AAEE)
DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVKG (SEQ ID NO: 21) FVFFLPYAMDY
(SEQ ID NO: 3)
N94A.F83A.N82aR.Y58R
(G6.31 AARR)
DYWIH
(SEQ ID NO: 1)
GITPAGGYTRYADSVKG (SEQ ID NO: 7) FVFFLPYAMDY
(SEQ ID NO: 3)
HCcombo DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
HCLC2 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
HCLC4 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
HCLC5 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
HCLC3 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
HCLC1 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
R19HCcombo DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
R19HCLC2 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
R19HCLC4 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)
R19HCLC5 DYWIH
(SEQ ID NO: 1)
GITPAGGYEYYADSVEG
(SEQ ID NO: 22)
FVFFLPYAMDY
(SEQ ID NO: 3)

Верхний шарнирный участок тяжелой цепи Fab любого из перечисленных выше антител, например, G6.31 AARR, может быть мутирован для удаления реакционной способности с шарниром анти-IgG1 аутоантител, о которых сообщалось в литературе. См., например, Brezski et al., J. Immunol. 181:3183-3192, 2008 и Brezski et al., mAbs 2:3, 212-220, 2010. Таким образом, С-концевая аминокислота тяжелой цепи G6.31 AARR может быть либо Т (версия дикого типа (ДТ)), либо L (вариант, который не обладает реакционной способностью к Fab анти-человеческого IgG). Полноразмерная аминокислотная последовательность тяжелой цепи дикого типа G6.31 AARR представляет собой SEQ ID NO: 48. Полноразмерная аминокислотная последовательность тяжелой цепи версии варианта, которая не обладает реакционной способностью к Fab анти-человеческого IgG, представляет собой SEQ ID NO: 49. Полноразмерная аминокислотная последовательность легкой цепи как для G6.31 AARR, так и для версии варианта, который не обладает реакционной способностью к Fab анти-человеческого IgG, представляет собой SEQ ID NO: 50.

Таким образом, комбинации вариантов, идентифицированных методом глубокого сканирующего мутагенеза, приводили к антителам с улучшенными свойствами. В некоторых случаях антитела имели улучшенную аффинность связывания с VEGF, а также улучшенную стабильность (о чем можно судить по заметно увеличенному Tm) по сравнению с G6.31. Некоторые из вариантов (например, антитела HCcombo, HCLC1, HCLC2, HCLC3, HCLC4 и HCLC5) имели как улучшенную аффинность связывания с VEGF, так и заметно уменьшенную pI. Для вариантов с уменьшенной pI, возвращение мутации R19E в тяжелой цепи обратно к исходному аргинину в положении 19 (например, как в R19HCcombo, R19HCLC2, R19HCLC4 и R19HCLC5), приводило к вариантам с последующим улучшением аффинности и увеличением Tm (на около 2,2-2,8 °С).

Пример 11: Окулярная и системная фармакокинетика вариантов G6.31 после интравитреального введения у кроликов

Для оценки фармакокинетических (ФК) свойств вариантов G6.31 in vivo был проведен следующий эксперимент с использованием новозеландских белых (NZW) кроликов. Период окулярного полувыведения определяли для двух разных вариантов G6.31, G6.31 AAEE (LC-N94A.LC-F83A.HC-A40E.HC-T57E) и G6.31 AARR (Y58R.N94A.N82aR.F83A), а также родительского G6.31 ДТ. В каждом случае Fab каждого из антител составляли в PBS в концентрации 10 мг/мл. 50 мкл (0,5 мг) инъектировали внутривенно анестезированным кроликам. Кролики (в группах по 10) дозировались один раз/глаз. Группе 1 вводили G6.31 AAEE, группе 2 вводили G6.31 ДТ, а группе 3 вводили G6.31 AARR. Ткани (стекловидное тело, внутриглазная жидкость и сыворотка) собирали перед введением дозы, через 2 часа, 6 часов, 1 день, 2 дня, 4 дня, 8 дней, 15 дней и 21 день после приема. Образцы анализировали на уровне анти-VEGF с использованием Общего ИФА Fab, описанного ниже.

Результаты фармакокинетического анализа каждого варианта и ДТ в каждом из стекловидного тела и внутриглазной жидкости представлены на Фиг.11А. Результаты показывают, что ФК G6.31 AAEE и G6.31 AARR по существу такие же, как ФK для ДТ G6.31 как в стекловидном теле, так и во внутриглазной жидкости. Были рассчитаны стекловидный и жидкостный периоды полувыведения, и эти результаты представлены в таблице 13 ниже. Период полувыведения варианта G6.31 Fab был похож с ДТ, а также соответствовал периоду окулярной полужизни Fab, о котором сообщалось в литературе.

Таблица 13: Период полувыведения вариантов G6.31 и G6.31 ДТ

Антитело Стекловидный период полувыведения (дни) Жидкостный период полувыведения (дни)
G6.31 AAEE 3,13 3,02
G6.31 ДТ 3,23 3,03
G6.31 AARR 3,1 2,81

Системное воздействие Fab после интравитреальной инъекции оценивали путем измерения уровней анти-VEGF в сыворотке. Образцы сыворотки анализировали для анти-VEGF. Результаты показаны на Фиг.11В. Клиренс был вычислен (мл/кг/день), и эти результаты показаны в таблице 14 ниже. Сыворотку также анализировали на антитерапевтические антитела (ATA). ATA присутствовал у всех животных с 14-го дня.

Таблица 14. Клиренс вариантов G6.31 и G6.31 ДТ

Антитело Клиренс
(мл/кг/день)
G6.31 AAEE 733
G6.31 ДТ 1238
G6.31 AARR 2133

Как показывают результаты, показанные в таблице 14, если все три Fab имеют одинаковую биодоступность, то G6.31 AARR имел самый быстрый клиренс, что указывает на более низкое системное воздействие по сравнению с G6.31 ДТ и G6.31 AAEE. Такое более низкое системное воздействие может привести к лучшему профилю безопасности для G6.31 AARR по сравнению с G6.31 ДТ и GG6.31 AAEE.

Материалы и способы

A. ИФА общего Fab

Планшеты ИФА покрывали AffinePure F(ab')2 фрагментом козьего анти-человеческого IgG в течение ночи при 4 °C. Затем планшеты промывали 3 раза перед инкубацией с блокирующим буфером (PBS pH 7,4, 0,5% BSA и 15 ppm PROCLIN™). После 3 промывок, жидкостные и стекловидные образцы, собранные у кроликов NZW, которым ввели ДТ G6.31, G6.31 AARR или G6.31 AAEE, инкубировали в планшетах в течение 2 ч при комнатной температуре при осторожном перемешивании. Затем молекулы G6.31, связанные с покрывающими антителами, были затем обнаружены с конъюгированным F(ab')2 пероксидазой козьим анти-человеческим IgG в течение 1 часа при комнатной температуре. После 3 промывок раствор субстрата TMBE-1000 добавляли к планшетам в течение 30 мин и реакцию останавливали с использованием 1 М H3PO4. Сигнал регистрировался при 450/620 нм.

Концентрации молекул G6.31 определяли с использованием стандартной кривой.

Пример 12: VEGF-индуцированные анализы миграции HUVEC

Варианты G6.31 были протестированы на способность ингибировать миграцию HUVEC, индуцированную VEGF. Анализы миграции HUVEC вариантов, указанных в таблице 15, были выполнены с использованием 24-многолуночных систем вставки Falcon (BD Biosciences кат. 351184). Вставки предварительно покрывали 8 мг/мл мышиного ламинина (LifeTechnologies 23017-015) в течение ночи. HUVEC голодали в течение ночи, собирали и ресуспендировали в аналитической среде (EBM-2, 0,1 % BSA). Клетки (5х104) добавляли в верхнюю камеру и 20 нг/мл VEGF добавляли в нижнюю камеру для стимуляции миграции в присутствии или в отсутствие различных уровней дозы блокирующих антител в течение 16 часов. После фиксации и скребков с верхней стороны мембраны, клетки на нижней поверхности фиксировали метанолом и окрашивали с помощью SYTOX® зеленого (LifeTechnologies S7020). Изображения были получены с использованием инвертированного флуоресцентного микроскопа, а число клеток было проанализировано с использованием программного обеспечения ImageJ.

На Фиг.13 показан график ингибирования миграции HUVEC, индуцированной VEGF, с помощью G6.31 LC-N94A по сравнению с исходным G6.31 при различных концентрациях Fab.

Как можно видеть из Фиг.13, одиночная мутация LC-N94A была значительно менее эффективной, с помощью около в пять раз, в анализе HUVEC миграции, индуцированной VEGF, по сравнению с исходным ДТ G6.31. Как показано в таблице 15, двойной мутант LC-N94A.LC-F83A также был около в пять раз менее сильным в этом анализе по сравнению с исходным ДТ G6.31. Четырехкратный мутант LC-N94A.LC-F83A.HC-A40E.HC-T57E (G6.31 AAEE) восстанавливал и немного улучшал специфическую активность (Таблица 15). Удивительно, что четырехкратный мутант N94A.F83A.N82aR.Y58R (G6.31 AARR) значительно повышал специфическую активность около в два раза по сравнению с исходным ДТ G6.31 (таблица 15).

Таблица 15. Специфическая активность клеток вариантов G6.31, определенных с помощью IC50 в анализе миграции HUVEC

Fab IC50 относительно G6.31
G6.31 1
LC-N94A 5,2
LC-N94A.LC-F83A (AA) 5,1
LC-N94A.LC-F83A
HC-A40E.HC-T57E
(G6.31 AAEE)
0,9
N94A.F83A.N82aR.Y58R
(G6.31 AARR)
0,5
ранибизумаб 0,9

Пример 13: Конъюгация гиалуроновой кислоты (HA) к G6.31 AARR и других антител

Современные подходы к лечению окулярных нарушений, связанных с патологическим ангиогенезом (например, AMD (например, влажной AMD), DME, DR или RVO), обычно включают интравитреальную инъекцию антагонистов VEGF (например, анти-VEGF Fab ранизумаб). Поскольку сайт действия анти-VEGF Fab находится в задней части глаза в сетчатке, а также потому, что Fab может иметь относительно короткое время пребывания в глазу, максимальная польза для пациентов от анти-VEGF Fab обычно достигается с помощью относительно частых доз (например, Q4W) с помощью интравитреальной инъекции. Желательно, чтобы длительные действия анти-VEGF антител или фрагментов антител (например, Fab) для окулярных нарушений были желательными, по меньшей мере частично, для уменьшения частоты дозирования, что привело к улучшению удобства и комплаенса пациента. В этом примере оценивали влияние конъюгирующей линейной, несшитой гиалуроновой кислоты (HA) на G6.31 вариант G6.31 AARR. Проанализированы молекулярные свойства конъюгатов, фармакокинетические параметры (например, жизненный цикл и клиренс), термодинамическая стабильность и ингибирующая активность VEGF.

Модельный кроличий Fab (rabFab; Shatz et al., Mol. Pharmaceutics 2016; идентификатор PubMed (PMID) 27244474) был использован в рамках этого анализа. Разработка технологий доставки для терапии белками обычно включает тестирование на соответствующих моделях животных для демонстрации полезности in vivo. Кроличьи модели обычно используются во время ранних исследований окулярной фармакокинетики. К сожалению, большинство человеческих и гуманизированных антител являются иммуногенными у кроликов, исключая оценку ключевых фармакокинетических параметров с использованием технологий доставки длительного действия. Для решения этой проблемы был разработан суррогатный состав, который представляет собой сходный с кроличьим Fab («rabFab»), который полезен для оценки технологий доставки в кроличьих моделях. rabFab, описанный в данном документе, был получен из моноклонального антитела кролика, которое связывается с фосфо-с-Met человека. Способы получения кроличьих антител, включая моноклональные антитела кролика, хорошо известны в данной области. См., например, патенты США № 5675063 и/или 7429487. Иллюстративное моноклональное антитело кролика, которое связывается с человеческим фосфо-c-Met, коммерчески доступным от Abcam (Кэмбридж, Mассачусетс, США), номер продукта ab68141.

В настоящих экспериментах, молекулы G6.31 AARR или rabFab Fab-C конъюгировали с линейными несшитыми HA различных среднемассовых молярных масс (Mв), включая 40 кДа (HA40K-), 100 кДа (HA100K-), 200 кДа (HA200K-) и 600 кДа (HA600K-). Fab-C молекулы представляют собой Fab молекулы, которые экспрессируются таким образом, что последовательность усекается при первом шарнире цистеина, в результате чего Fab со свободным цистеином непосредственно из экспрессии. Могут также использоваться молекулы Fab', которые представляют собой Fab-молекулы со свободным цистеином, образующиеся при переваривании полноразмерного моноклонального антитела. Для конъюгатов НА, описанных в этом примере, молекулы Fab-C ковалентно присоединены к группам карбоновой кислоты на сахаридных единицах глюкуроновой кислоты НА. На первой стадии синтеза определенный процент этих кислотных групп на НА превращали в малеимиды (обычно 2-10 % кислотных групп превращали). Затем молекулы Fab-C конъюгировали с малеимидными группами через свободный цистеин на молекуле Fab-C. Однако небольшие модификации химии конъюгации могут быть использованы для конъюгации молекул Fab или других форматов антител с HA.

Комбинация гель-проникающей хроматографии (SEC), многоуглового светорассеяния показателя преломления (RI) (MALS) и квазиупругого рассеяния света (QELS) (также называемого SEC-RI-MALS-QELS) использовалась для оценки HA Mв, конъюгата Mв, процентной загрузки Fab (определяемая как процент групп карбоновых кислот HA, которые заняты ковалентно присоединенной Fab-молекулой), гидродинамический радиус (Rh), свободный Fab (определенный как процент молекул Fab, которые являются свободными в растворе, а не ковалентно присоединены к молекуле НА) и фракции массы белка (масса белка/(масса белка + масса HA) выбранных конъюгатов HA-Fab (таблица 16). На Фиг.14 показаны иллюстративные результаты SEC-RI-MALS-QELS для оценки среднемассовой молярной массы (Mв) HA40K-rabFab, HA200K-rabFab и HA600K-rabFab (обратите внимание, что данные QELS не показаны на Фиг. 14).

Таблица 16. Свойства выбранных конъюгатов HA-Fab, оцененных с помощью SEC-RI-MALS-QELS

Образец HA Mв (кДа) Конъюгат Mw (кДа) % Загрузки Fab Rh (нм) Свободный Fab Массовая доля белка
HA40K-rabFab 45,3 636,2 7,4 ~ 10* 0,45 % 0,929
HA100K-rabFab** 110,0 679,3 5,9 17,3 3,71 % 0,838
HA200K-rabFab 204,3 1805,3 8,6 ~ 30* 0,55 % 0,887
HA600K-rabFab 619,8 2569,2 3,2 ~ 50* 1,87 % 0,759
HA200K-G6.31 AARR 204,3 2478,0 11,0 27,7 0,63 % 0,918

* Приблизительные значения Rh;

** Образец, исследованный в исследовании ФK кролика (см., например, Фиг.16 и ниже).

Для лечения окулярных нарушений, таких как AMD, может потребоваться длительный период полувыведения из глаз, но короткий системный период полувыведения, например, для минимизации системного воздействия против VEGF. Клиренс HA от системной циркуляции опосредуется гиалуронидазой, несущей печеночные клетки. Предыдущие сообщения показывают, что активность гиалуронидазы на нативной НА включает в себя узнавание через группы карбоновой кислоты глюкуроновой кислоты. Поскольку эти карбоксильные группы были модифицированы для присоединения к молекулам Fab-C, была оценена способность конъюгированного НА к ферментативному перевариванию гиалуронидазой. HA-конъюгированный rabFab сохранил ферментативную восприимчивость к перевариванию гиалуронидазой-2 (HYAL2), как оценивается анализом SEC-MALS с HYAL2-инкубацией HA и HA100K-rabFab (Фиг.15).

Определяли влияние HA-конъюгации Fab-фрагментов на окулярные фармакокинетические параметры (например, период полувыведения и клиренса) в стекловидное тело кролика после интравитреального введения. Конъюгация rabFab с HA100K (HA100K-I125-rabFab) приводила к значительному уменьшению клиренса и значительному увеличению витреального периода полувыведения по сравнению с неконъюгированным rabFab или ранибизумабом (Фиг.16 и таблица 17). HA100K-конъюгированный rabFab имел приблизительно четырехкратное увеличение периода витреального полувыведения (t1/2) по сравнению с неконъюгированным rabFab по историческим данным (11,9 дня против 3,2 дня соответственно) (Фиг.16 и таблица 17). В Таблице 17 также показаны Rh для rabFab и HA100K-I125-rabFab. Эти данные указывают на то, что конъюгация HA увеличивала гидродинамический радиус Fab и приводила к замедлению витреального клиренса и увеличению периода витреальной полужизни.

Таблица 17. Клиренс rabFab и HA100K-125I-rabFab из кроличьего стекловидного тела после интравитреального введения

Опытный образец Rh (нм) t 1/2 (дней) CL (мл/день)
HA100K-I125-rabFab 17,3 11,9 0,076
rabFab (исторический) 2,5 3,2 0,32

Линейная корреляция между гидродинамическим размером (например, с точки зрения гидродинамического радиуса) и витреальным временем жизни (например, с точки зрения полувыведения), а также исторические данные для rabFab, rabFab, конъюгированного с полиэтиленгликолем 20 кДа (ПЭГ) (rabFab-20 кДа ПЭГ), и rabFab, конъюгированный с ПЭГ 40 кДа (rabPab-40 кДа ПЭГ) (Shatz et al., выше), в сочетании с данными, описанными выше для HA100K-rabFab, позволил предсказать витреальный период полувыведения G6.31, конъюгированного с HA100K или HA200K и G6.31, конъюгированного с HA300K (Фиг.17). HA100K-G6.31 имеет предсказанный витреальный период полувыведения приблизительно 11 дней, в то время как HA200K-G6.31 имеет еще больший предсказанный витреальный период полувыведения приблизительно 17 дней (Фиг.17). HA300K-G6.31 имеет предсказанный витреальный период полувыведения приблизительно 19 дней (Фиг.17). Эти результаты дают еще одно доказательство того, что конъюгация G6.31 AARR или других вариантов G6.31, описанных в данных документах, с линейным несшитым HA приводит к увеличению окулярного времени пребывания (например, периоду полувыведения) и уменьшению клиренса после интравитреальной инъекции.

Был также оценен эффект конъюгации HA на термодинамическую стабильность Fab (таблица 18). Ковалентное присоединение rabFab к HA трех разных молярных масс не изменяло термодинамическую стабильность Fab, что подтверждается аналогичным началом Tm и пиком Tm для конъюгатов по сравнению с исходной Fab (таблица 18).

Таблица 18. Конъюгация Fab к HA существенно не изменяет термодинамическую стабильность Fab

Образец Tm Начало, °C Tm, °C
rabFab 66,8 85,6
HA39K-rabFab 69,5 84,1
HA100K-rabFab 69,8 84,0
HA300K-rabFab 69,7 83,8

Наконец, оценивали влияние конъюгации HA на специфическую активность ингибирования VEGF G6.31 AARR. Неожиданно было обнаружено, что конъюгация AARR G6.31 с линейным несшитым HA приводила к значительному повышению активности по сравнению с исходным Fab при сравнении в pKDR-анализе для ингибирования VEGF (таблица 19). Значения qAC50 в таблице 19 указывают концентрацию, необходимую для получения 50 % отклика в формате анализа активности. Значения qAC50 эквивалентны значениям IC50. HA-конъюгированный G6.31 AARR имел приблизительно 7-кратное увеличение способности по сравнению с неконъюгированным родительским Fab (таблица 19). Следовательно, конъюгация G6.31 AARR и других вариантов G6.31, описанных в данном документе, может быть полезна как для улучшения витреальных фармакокинетических параметров (включая период полувыведения и клиренса), так и ингибирующую способность VEGF.

Таблица 19. Конъюгация G6.31 AARR к HA приводит к улучшенной ингибирующей способности VEGF

Опытный образец qAC50, нM
G6.31.AARR 0,9325
HA100K-G6.31 AARR 0,1346

Исходя из вышеприведенных экспериментальных данных, HA-конъюгированные молекулы AARR G6.31 имеют значительно улучшенные характеристики для лечения окулярных нарушений, в том числе AMD (например, влажная AMD), DME, DR и RVO. Эти улучшенные характеристики включают повышенную способность и возможность для менее частого дозирования из-за увеличения времени витреального пребывания.

Материалы и способы

A. Синтез функционализированной малеимидом HA (HA-mal)

Линейные, несшитые HA-полимеры с различными молярными массами получали из Lifecore Biomedical. HA модифицировали малеинимидными группами с использованием водной реакции с реагентом связывания 4-(4,6-диметокси-1,3,5-триазин-2-ил)-4-метилморфолиния хлорида (DMTMM) и линкером N-(2-аминоэтил)малеимида соли трифторацетата (AEM). HA растворяли в 100 мМ 2-(N-морфолино)этансульфоновой кислоте с рН 5,5 при 2,5 мг/мл и к этому раствору добавляли 1,5 молярного избытка DMTMM и 3,75 молярного избытка AEM (молярные избытки рассчитывали на основе молей карбоновой кислоты в HA) при перемешивании. Раствор нагревали до 70 °С в течение 2 часов.

Избыток AEM и DMTMM удаляли из реакции через процедуру обессоливания. Насосная колонна HiPrep™ 26/10 была смонтирована на системе очистки ÄKTA™ и уравновешена с 10 мМ ацетата натрия, pH 4,0 150 мМ NaCl. Реакцию инъецировали аккуратно в колонку и пик HA-mal собирали в соответствии с абсорбцией при 302 нм и концентрировали до более чем 5 мг/мл с использованием центробежных ультрафильтрационных устройств. Малеимидную концентрацию в исходном растворе HA-mal измеряли поглощением при 302 нм с использованием ультрафиолетового видимого спектрофотометра, а молярное отношение малеимидных групп на цепь HA оценивали с помощью гель-фильтрационной хроматографии по размеру с многоугловым светорассеянием (SEC-MALS).

B. Конъюгация Fab-C с HA-mal

Раствор Fab-C доводили до 6,5 с использованием 1 М фосфата pH 6,5 до конечной концентрации фосфата 50 мМ. Этилендиаминтетрауксусную кислоту (ЭДТА) высушивали в растворе до конечной концентрации 2,5 мМ. Раствор Fab-C перемешивали и к нему добавляли HA-mal, разбавленный в реакционный буфер (10 мМ фосфата 150 мМ NaCl 2,5 мМ ЭДТА (рН 6,5)). Стехиометрию устанавливали на 1,2 моль Fab-C на моль малеимида в конечной реакции, и объем устанавливали для получения конечной концентрации белка 1 мг/мл. Реакцию конъюгирования проводили при комнатной температуре при перемешивании. Через 3 часа меркаптоэтанол добавляли при 2 молях на моль малеимида для покрытия непрореагировавших малеимидных групп. Через 30 минут после добавления меркаптоэтанола реакционную смесь разбавляли до менее чем 50 мМ NaCl с 10 мМ фосфатом (рН 6,5) для очистки.

Очистку проводили с использованием анионообменной хроматографии для отделения свободного димера Fab-C и Fab от конъюгата. Колонку HiTrap™ Q FF 5 мл устанавливали на системе очистки ÄKTA™ и уравновешивали с 10 мМ HisHCl (pH 5,5). Разбавленную реакцию пропускали через колонку, захватывая конъюгат HA-Fab и одновременно элюируя свободный Fab-C и димер. После промывки с 10 мМ HisHCl (pH 5,5) 100 мМ NaCl конъюгат элюировали ступенчатым градиентом до 10 мМ HisHCl (pH 5,5) 500 мМ NaCl. Элюированный конъюгат объединяли и разбавляли с 10 мМ HisHCl (pH 5,5) до конечной композиции 10 мМ HisHCl (pH 5,5) 150 мМ NaCl. Конъюгат состава концентрировали центробежной ультрафильтрацией.

C. Анализ конъюгатов HA-Fab

Остаточное свободное Fab-содержание, общая молярная масса конъюгата и массовая доля белка оценивались комбинацией гель-фильтрационной хроматографии (SEC) с многоугловым светорассеянием показателя преломления (RI) (MALS) и квазиупругого рассеяния света (QELS) (также называемый SEC-RI-MALS-QELS) на высокоэффективной жидкостной хроматографии Agilent 1200 (ВЭЖХ) с детектором WIAT Optilab T-rEX RI и детектором WALET HELEOS-II MALS in-line. Колонка Tosoh G6000 PWxl использовался для анализа с PBS (pH 7,4) в качестве рабочего буфера. Контроль BSA использовался для нормализации детектора MALS и исправления для расширения зон между детекторами. Содержание свободного Fab измеряли путем интеграции пиков УФ-A280, соответствующих конъюгату Fab и HA-Fab. Молекулярную массу конъюгата принимали в виде среднемассовой молекулярной массы (Mw) (также называемой среднемассовой молярной массой) конъюгатного пика. Массовая доля белка рассчитывалась с использованием анализа белкового конъюгата с использованием дифференциальных RI (dRI) и UV A280 сигналов.

D. Динамическая сканирующая калориметрия (DSC) Исследования конъюгатов HA-rabFab

Растворы rabFab, rabFab, конъюгированные с HA, имеющие средневзвешенную молярную массу (Mв) 39 кДа (HA39K-rabFab), rabFab, конъюгированную с HA, имеющую Mв 100 кДа (HA100K-rabFab) и rabFab, конъюгированные с HA, имеющие Mв 300 кДа (HA300K-rabFab) получали при концентрации 0,5 мг/мл (концентрация приведена на белковой основе) в 10 мМ HisHCl (pH 5,5) 150 мМ NaCl. Исследования DSC проводились на микрокалориметре VP-DSC (MicroCal, Inc.) от 15 до 105 °C со скоростью 1 °C/мин. Исходное сканирование только одног