Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1



Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
Комбинированная терапия на основе нацеленных на опухоль иммуноцитокинов, содержащих вариант il-2, и антител к человеческому pd-l1
C07K2317/52 - Пептиды (пептиды в пищевых составах A23, например получение белковых композиций для пищевых составов A23J, препараты для медицинских целей A61K; пептиды, содержащие бета-лактамовые кольца, C07D; циклические дипептиды, не содержащие в молекуле любого другого пептидного звена, кроме образующего их кольцо, например пиперазин-2,5-дионы, C07D; алкалоиды спорыньи циклического пептидного типа C07D519/02; высокомолекулярные соединения, содержащие статистически распределенные аминокислотные единицы в молекулах, т.е. при получении предусматривается не специфическая, а случайная последовательность аминокислотных единиц, гомополиамиды и блоксополиамиды, полученные из аминокислот, C08G 69/00; высокомолекулярные продукты, полученные из протеинов, C08H 1/00; получение

Владельцы патента RU 2710354:

Ф.ХОФФМАНН-ЛЯ РОШ АГ (CH)

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая применение нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для лечения рака или для предупреждения или лечения метастазов, применение комбинации нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для ингибирования роста злокачественной опухоли, которая экспрессирует мишень для иммуноцитокина, и/или повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую мишень для иммуноцитокина, применение комбинации нацеленного на карциноэмбриональный антиген (СЕА) иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим фибробластным активирующим белком (PD-L1), для ингибирования роста злокачественной опухоли, которая экспрессирует СЕА, и/или повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую СЕА, применение комбинации нацеленного на фибробластный активирующий белок (FAP) иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для ингибирования роста злокачественной опухоли, которая экспрессирует FAP, и/или повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую FAP, комбинацию нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для лечения рака, комбинацию нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, предназначенную для лечения пациента, имеющего экспрессирующую СЕА злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, имеющего экспрессирующую FAP злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или злокачественную опухоль, ассоциированную с экспрессией или сверхэкспрессией СЕА или FAP. Изобретение расширяет арсенал средств для лечения рака. 6 н. и 12 з.п. ф-лы, 8 ил., 11 табл., 6 пр.

 

Настоящее изобретение относится к комбинированной терапии на основе опухоль специфических нацеленных на опухоль иммуноцитокинов, содержащих вариант IL-2, в сочетании со специфическими антителами, которые связываются с человеческим PD-L1.

Предпосылки создания изобретения

Рак является основной причиной смерти в экономически развитых странах и второй по значимости причиной смерти в развивающихся странах. Несмотря на достигнутые в настоящее время успехи в области химиотерапии и создание агентов, которые целенаправленно воздействуют на молекулярном уровне на трансдукцию и регуляцию сигналов роста в раковых клетках, прогноз для пациентов с запущенным раком в целом остается неблагоприятным. Таким образом, в медицине существует постоянная и крайне необходимая потребность в создании новых терапий, не обладающих неприемлемой токсичностью, которыми можно дополнять существующие варианты лечения для повышения выживаемости.

IL-2 и нацеленные на опухоль иммуноцитокины на основе IL-2

Интерлейкин 2 (IL-2) представляет собой цитокин, который активирует лимфоциты и естественные клетки-киллеры (NK). Установлено, что IL-2 обладает противоопухолевой активностью; однако высокие уровни IL-2 обладают легочной токсичностью, и противоопухолевая активность IL-2 ограничена наличием ряда ингибирующих петель обратной связи.

С учетом его противоопухолевой эффективности лечение с применением высоко дозового IL-2 (альдеслейкин, поступает в продажу под товарным знаком Proleukin®) разрешено для пациентов с метастатической почечно-клеточной карциномой (RCC) и злокачественной меланомой в США и пациентов с метастатической RCC в Евросоюзе. Однако в результате механизма действия IL-2 системное и нецеленаправленное применение IL-2 может существенно подвергать риску противоопухолевый иммунитет посредством индукции Treg-клеток и AICD (индуцированная активацией смерть клеток). Дополнительной проблемой, связанной с системным лечением IL-2, являются серьезные побочные действия после внутривенного введения, которые включают серьезные случаи воздействия на сердечно-сосудистую систему, отек легких, воздействия на печень, желудочно-кишечный тракт (ЖКТ), нервную систему и кровь (Proleukin (aldesleukin) Summary of Product Characteristics [SmPC]: http://www.medicines.org.uk/emc/medicine/19322/SPC/ (информация доступна с 27 мая 2013 г.)). Проведено изучение на пациентах низкодозовых режимов IL-2, хотя и с получением субоптимальных терапевтических результатов. В целом, терапевтические подходы, основанные на применении IL-2, могут оказаться ценным для противораковой терапии, если удастся преодолеть препятствия, ассоциированные с его применением. Иммуноконъюгаты, содержащие нацеленный на опухоль антигенсвязывающий фрагмент и эффекторный фрагмент на основе IL-2, описаны, например, в WO 2012/146628 и WO 2012/107417.

PD-L1 и антитела к PD-L1

Костимуляция или передача двух различных сигналов к Т-клеткам представляет собой наиболее приемлемую модель активации лимфоцитов, таких как покоящиеся Т-лимфоциты, антигенпрезентующими клетками (АРС) (Lafferty и др., Aust. J. Exp. Biol. Med. Sci. 53, 1975, cc. 27-42).

Эта модель применяется также для отличия «своих» от «чужих» и для иммунной толерантности (Bretscher и др., Science 169, 1970, сс.1042-1049; Bretscher P.A., P.N.A.S. USA 96, 1999, сс.185-190; Jenkins и др., J. Exp. Med. 165, 1987, сс.302-319). Первичный сигнал или антигенспецифический сигнал трансдуцируется через Т-клеточный рецептор (TCR) после распознавания «чужого» антигенного пептида, презентируемого в контексте главного комплекса гистосовместимости (ГКГС). Второй или костимуляторный сигнал доставляется к Т-клеткам костимуляторными молекулами, которые экспрессируются на антигенпрезентующих клетках (АРС) и индуцируют усиление клональной экспансии, цитокиновой секреции и эффекторной функции Т-клеток (Lenschow и др., Ann. Rev. Immunol. 14, 1996, с.233). В отсутствии костимуляции Т-клетки могут оставаться устойчивыми к антигенной симуляции, не могут обеспечивать эффективный иммунный ответ, и это также может приводить к (иммунному) истощению или толерантности к «чужим» антигенам.

Простая модель на основе двух сигналов может являться слишком упрощенной, поскольку сила TCR-сигнала оказывает количественное воздействие на Т-клеточную активацию и дифференцировку (Viola и др., Science, 273, 1996, сс.104-106; Sloan-Lancaster, Nature, 363, 1993, сс.156-159). Кроме того, Т-клеточная активация может происходить даже в отсутствии костимуляторного сигнала, если сила TCR-сигнала является высокой. Более важным является то, что Т-клетки получают как положительные, так и отрицательные вторичные костимуляторные сигналы. Регуляция указанных положительных и отрицательных сигналов имеет решающее значение для получения максимальных защитных иммунных ответов хозяина, поддерживая при этом иммунную толерантность и предупреждая аутоиммунитет.

Отрицательные вторичные сигналы, вероятно, необходимы для индукции Т-клеточной толерантности, а положительные сигналы усиливают Т-клеточную активацию. Хотя простая модель на основе двух сигналов все еще остается обоснованной для наивных лимфоцитов, иммунный ответ хозяина представляет собой динамический процесс и костимуляторные сигналы могут поступать также и к экспонированным антигеном Т-клеткам.

Механизм костимуляции представляет терапевтический интерес, поскольку установлено, что манипуляция с костимуляторными сигналами является средством либо усиления, либо прекращения клеточного иммунного ответа. В последние годы установлено, что Т-клеточная дисфункция или анергия существует одновременно с индуцированной и сохраняющейся экспрессии ингибирующего рецептора, полипептида запрограммированной гибели клеток 1 (PD-1). Как следствие, терапевтические молекулы, мишенью которых является PD-1, и другие молекулы, которые передают сигналы посредством взаимодействия с PD-1, такие как лиганд (рецептора) запрограммированной гибели клеток 1 (PD-L1) и лиганд (рецептора) запрограммированной гибели клеток 2 (PD-L2), представляют собой большой интерес.Предполагается, что ингибирование пути передачи сигнала PD-L1 может являться средством усиления Т-клеточного иммунитета при лечении рака (например, противоопухолевого иммунитета) и инфекции, включая как острую, так и хроническую (например, персистентную) инфекцию. Однако, поскольку на рынке пока отсутствуют оптимальные терапевтические средства, нацеленные на мишени, которые находятся в указанном пути, в них существует настоятельная медицинская потребность. Антитела против PD-L1 описаны, например, в WO 2010/077634.

Краткое изложение сущности изобретения

В изобретении предложена комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предназначенная для применения для лечения рака или опухоли, для применения для предупреждения или лечения метастазов, для применения для лечения воспалительных заболеваний, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, например, противоопухолевого иммунитета, или для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность.

В изобретении предложено применение нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, для приготовления лекарственного средства, предназначенного для применения для лечения рака или опухоли, для применения для предупреждения или лечения метастазов, для применения для лечения воспалительных заболеваний, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, например, противоопухолевого иммунитета, или для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1.

В изобретении предложено применение антитела, которое связывается с человеческим PD-L1, для приготовления лекарственного средства, предназначенного для применения для лечения рака или опухоли, для применения для предупреждения или лечения метастазов, для применения для лечения воспалительных заболеваний, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, например, противоопухолевого иммунитета, или для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, в котором антитело, которое специфически связывается с человеческим PD-L1, вводят в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2.

В изобретении предложен также способ лечения рака или опухоли, способ предупреждения или лечения метастазов, способ лечения воспалительных заболеваний, способ лечения или замедления прогрессирования иммунопатологического заболевания, например, противоопухолевого иммунитета, или способ стимуляции иммунного ответа или функции, такой как Т-клеточная активность, где способ заключается в том, что применяют комбинированную терапию на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1.

Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

антитело, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, или его антигенсвязывающий фрагмент,

мутант IL-2, прежде всего мутант человеческого IL-2, обладающий пониженной аффинностью связывания с α-субъединицей IL-2-рецептора (по сравнению с IL-2 дикого типа, например, человеческого IL-2, представленного в виде SEQ ID NO: 2), такой как IL-2, содержащий:

I) одну, две или три аминокислотную(ые) замену(ы) в одном, двух или трех положении(ях), выбранном(ых) из положений, соответствующих остаткам 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, три замены в трех положениях, например, конкретные аминокислотные замены F42A, Y45A и L72G; или

II) характеристики, указанные в подпункте I), плюс аминокислотную замену в положении, соответствующем остатку 3 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретную аминокислотную замену Т3А; или

III) четыре аминокислотные замены в положениях, соответствующих остаткам 3, 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретные аминокислотные замены Т3А, F42A, Y45A и L72G.

Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи и вариабельный домен легкой цепи антитела, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и Fc-домен, состоящий из двух субъединиц и содержащий модификацию, которая усиливает гетеродимеризацию двух неидентичных полипептидных цепей, и

мутант IL-2, прежде всего мутант человеческого IL-2, обладающий пониженной аффинностью связывания с α-субъединицей IL-2-рецептора (по сравнению с IL-2 дикого типа, например, человеческого IL-2, представленного в виде SEQ ID NO: 2), такой как IL-2, содержащий:

I) одну, две или три аминокислотную(ые) замену(ы) в одном, двух или трех положении(ях), выбранном(ых) из положений, соответствующих остаткам 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, три замены в трех положениях, например, конкретные аминокислотные замены F42A, Y45A и L72G; или

II) характеристики, указанные в подпункте I), плюс аминокислотную замену в положении, соответствующем остатку 3 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретную аминокислотную замену Т3А; или

III) четыре аминокислотные замены в положениях, соответствующих остаткам 3, 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретные аминокислотные замены Т3А, F42A, Y45A и L72G.

Антитело может связываться с карциноэмбриональным антигеном (СЕА) или фибробласт-активирующим белком (FAP) в качестве мишени антитела, в результате нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, представляет собой нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, или нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который имеет в качестве компонента иммуноцитокина антитело к СЕА или антитело к FAP.

Модификация Fc-домена, усиливающая гетеродимеризацию, может представлять собой модификацию «knob-into-hole» (модификация, приводящая к образованию «выступа»-«впадины»), которая содержит модификацию, приводящую к образованию «выступа», в одной из субъединиц Fc-домена и модификацию, приводящую к образованию «впадины», в другой одной из двух субъединиц Fc-домена, или модификацию, опосредующую определяемые электростатическими силами воздействия, которая включает замену одного или нескольких аминокислотных остатков в поверхности раздела двух полипептидных цепей на заряженные аминокислотные остатки, например мутацию DD (например, K392D, K409D; EU-нумерация) на одной субъединице и мутацию KK (например, D356K, D399K; EU-нумерация) на другой субъединице. Приведенная в качестве примера последовательность Fc-области человеческого IgG1 представлена в виде SEQ ID NO: 1.

Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, может представлять собой нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который может содержать

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110,

или нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126.

Применяемое в комбинированной терапии антитело, которое связывается с человеческим PD-L1, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В вариантах осуществления изобретения нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, представляет собой нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110,

или представляет собой нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

б) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

в) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В одном из вариантов осуществления изобретения нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, применяемый в комбинированной терапии, отличается тем, что содержит

а) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88;

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

В одном из вариантов осуществления изобретения нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, применяемый в комбинированной терапии, отличается тем, что содержит

а) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81;

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

В одном из вариантов осуществления изобретения описанная выше комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предназначена для применения для лечения рака или опухоли. Рак или опухоль могут презентировать антиген на опухолевой клетке или в окружении опухолевой клетки. Мишень комбинированной терапии может презентироваться на опухолевых клетках или в окружении опухолевых клеток. Рак или опухоль может экспрессировать или сверхэкспрессировать СЕА или FAP. Лечению можно подвергать солидную опухоль. Солидная опухоль может экспрессировать или сверхэкспрессировать СЕА или FAP. Лечению можно подвергать карциному. Карцинома может экспрессировать или сверхэкспрессировать СЕА или FAP. Рак можно выбирать из группы, состоящей из колоректального рака, рака головы и шеи, немелкоклеточного рака легкого, рака молочной железы, рака поджелудочной железы, рака печени и рака желудка. Рак можно выбирать из группы, состоящей из рака легкого, рака ободочной кишки, рака желудка, рака молочной железы, рака головы и шеи, рака кожи, рака печени, рака почки, рака предстательной железы, рака поджелудочной железы, рака головного мозга и рака скелетной мышцы.

В одном из вариантов осуществления изобретения описанная выше комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предназначена для применения для предупреждения или лечения метастазов.

В одном из вариантов осуществления изобретения описанная выше комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предназначена для применения для лечения воспалительных заболеваний.

В одном из вариантов осуществления изобретения описанная выше комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предназначена для применения для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет.

В одном из вариантов осуществления изобретения описанная выше комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предназначена для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность.

В изобретении предложен нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, где иммуноцитокин применяют в комбинации с антителом, которое связывается с человеческим PD-L1, описанным выше, для

I) ингибирования роста опухоли, которая экспрессирует мишень для иммуноцитокина;

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую мишень для иммуноцитокина,

где мишень может презентироваться опухолевой клеткой или в окружении опухолевой клетки.

В изобретении предложен нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, где иммуноцитокин применяют в комбинации с антителом, которое связывается с человеческим PD-L1, описанным выше, для

I) ингибирования роста опухолей, которые экспрессируют СЕА;

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую СЕА;

где нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, применяемый в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В изобретении предложен нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, где иммуноцитокин применяют в комбинации с антителом, которое связывается с человеческим PD-L1, описанным выше, для

I) ингибирования роста опухолей, которые экспрессируют FAP;

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую FAP;

где нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, применяемый в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

в) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID N0: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В изобретении предложен нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, предназначенный для применения для лечения пациента, который имеет экспрессирующую СЕА опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, который имеет экспрессирующую FAP или опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или который имеет опухоль, ассоциированную с экспрессией или сверхэкспрессией СЕА или FAP, и где иммуноцитокин вводят в комбинации с антителом, которое связывается с человеческим PD-L1,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3; или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полицептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В одном из вариантов осуществления изобретения компоненты иммуноцитокина, представляющего собой антитело, или антитела относятся к человеческому IgG1-подклассу или человеческому IgС4-подклассу.

В изобретении предложен:

А) Способ

I) ингибирования роста опухолей, которые экспрессируют СЕА или опухолей, который экспрессируют FAP;

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую СЕА, или опухоль, экспрессирующую FAP;

в котором нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, или нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, применяют в комбинации с антителом, которое связывается с человеческим PD-L1, или

Б) способ лечения пациента, имеющего экспресирующую СЕА опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, или экспрессирующую FAP опухоль, или опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, и в котором нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, или нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1,

в котором нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110,

или в котором нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

в) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

Комбинированные терапии на основе описанных выше нацеленных на опухоль иммуноцитокинов, содержащих вариант IL-2, и антител оказывают благоприятное действие на пациентов, которые нуждаются в терапии, нацеленной на антиген, презентируемый на опухолевой клетке или в окружении опухолевой клетки. Комбинированные терапии на основе описанных выше нацеленных на СЕА иммуноцитокинов, содержащих вариант IL-2, и антител оказывают благоприятное действие на пациентов, которые нуждаются в терапии, нацеленной на СЕА. Комбинированные терапии на основе описанных выше нацеленных на FAP иммуноцитокинов, содержащих вариант IL-2, и антител оказывают благоприятное действие на пациентов, которые нуждаются в терапии, нацеленной на FAP. Нацеленные на опухоль иммуноцитокины, содержащие вариант IL-2, обладают эффективностью, такой как ингибирующая рост опухолей активность в отношении опухолей, экспрессирующих мишени, и прежде всего их можно применять среди прочего для лечения рака и метастазов в комбинации с антителами к PD-L1, указанными в настоящем описании. Нацеленные на опухоль иммуноцитокины, содержащие вариант IL-2, предлагаемые в изобретении, обладают эффективностью в отношении повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую мишень, и прежде всего их можно применять среди прочего для лечения рака и метастазов в комбинации с антителами к PD-L1, указанными в настоящем описании. Специфические нацеленные на СЕА иммуноцитокины, содержащие вариант IL-2, предлагаемые в изобретении, обладают эффективностью, такой как ингибирующая рост опухолей активность, в отношении опухолей, экспрессирующих СЕА, и прежде всего их можно применять среди прочего для лечения рака и метастазов в комбинации со специфическим антителами к PD-L1, указанными в настоящем описании. Специфические нацеленные на СЕА иммуноцитокины, содержащие вариант IL-2, предлагаемые в изобретении, обладают эффективностью в отношении повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую СЕА, и прежде всего их можно применять среди прочего для лечения рака и метастазов в комбинации с антителами к PD-L1, указанными в настоящем описании. Специфические нацеленные на FAP иммуноцитокины, содержащие вариант IL-2, предлагаемые в изобретении, обладают эффективностью, такой как ингибирующая рост опухолей активность, в отношении опухолей, экспрессирующих FAP, и прежде всего их можно применять среди прочего для лечения рака и метастазов в комбинации со специфическим антителами к PD-L1, указанными в настоящем описании. Специфические нацеленные на FAP иммуноцитокины, содержащие вариант IL-2, предлагаемые в изобретении, обладают эффективностью в отношении повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую FAP, и прежде всего их можно применять среди прочего для лечения рака и метастазов в комбинации с антителами к PD-L1, указанными в настоящем описании. Специфические антитела, которые связываются с человеческим PD-L1, предлагаемые в изобретении, обладают эффективностью в отношении повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую СЕА, или опухоль, экспрессирующую FAP, и прежде всего их можно применять среди прочего для лечения рака и метастазов в комбинации со специфическим нацеленными на СЕА иммуноцитокинами, содержащими вариант IL-2, или нацеленными на FAP иммуноцитокинами, содержащими вариант IL-2, соответственно, которые указаны в настоящем описании.

Описание чертежей

На чертежах показано:

на фиг. 1 - результаты эксперимента на оценке эффективности CEA-IL2v и МАт к PD-L1, которые применяли индивидуально и в комбинации. В качестве трансфектанта инъецировали клеточную линию колоректальной карциномы МС38-СЕА в воротную вену мышей линии Black 6-huCEA-hu Fcγ RIII tg для изучения выживаемости на модели метастатического рака печени. Количество инъецируемых антител на мышь в мг/кг показано в надписях на чертеже;

на фиг. 2 - результаты эксперимента на оценке эффективности CEA-IL2v и МАт к PD-L1, которые применяли индивидуально и в комбинации. В качестве трансфектанта инъецировали подкожно клеточную линию колоректальной карциномы МС38-СЕА мышам линии Black 6-huCEA-huFcγ RIII tg для изучения ингибирования роста опухолей на подкожной модели, размер опухолей измеряли с помощью кронциркуля. Количество инъецируемых антител на мышь в мг/кг показано в надписях на чертеже;

на фиг. 3 - результаты эксперимента на оценке эффективности CEA-IL2v и МАт к PD-L1, которые применяли индивидуально и в комбинации. В качестве трансфектанта инъецировали клеточную линию карциномы поджелудочной железы Panc02-Н7-СЕА в поджелудочные железы мышей линии Black 6-huCEA-huFcγ RIII tg для изучения выживаемости на ортотопной сингенной модели рака поджелудочной железы. Количество инъецируемых антител на мышь в мг/кг показано в надписях на чертеже;

на фиг. 4 - (А) результаты эксперимента по оценке эффективности нацеленного на СЕА CEA-IL2v и МАт к PD-L1 или «ненацеленного» DP47-IL2v и МАт к PD-L1, которые применяли индивидуально и в комбинации. В качестве трансфектанта инъецировали клеточную линию карциномы поджелудочной железы Panc02-Н7-СЕА в поджелудочные железы мышей линии Black 6-huCEA-huFcγ RIII tg для изучения выживаемости на ортотропной сингенной модели рака поджелудочной железы. Количество инъецируемых антител на мышь в мг/кг показано в надписях на чертеже. (Б) - уровни в сыворотке IL2v после первого введения в различных экспериментальных группах;

на фиг. 5 - результаты опытов in vitro, демонстрирующие, что в совместных культурах человеческих РМВС и человеческой клеточной линии рака легкого А549 обработка CEA-IL2v индуцировала повышающую регуляцию PD-L1 на клетках А549 в зависимости от концентрации. Экспрессию PD-L1 на опухолевых клетках А549 анализировали с помощью проточной цитометрии после обработки 10 нМ или 100 нМ CEA-IL2v индивидуально (А) или в присутствии РВМС в соотношении Е:Т, составляющем 1:1 (Б) или 10:1 (В);

на фиг. 6 - результаты эксперимента на оценке эффективности FAP-IL2v и МАт к PD-L1, которые применяли индивидуально и в комбинации. В качестве трансфектанта инъецировали подкожно клеточную линию колоректальной карциномы MC38-FAP мышам линии Black 6 для изучения ингибирования роста опухолей на подкожной модели. (А) размер опухолей (измеренный с помощью кронциркуля); (Б) выживаемость, n=14.

Подробное описание изобретения

Путь IL-2

Способность IL-2 увеличивать количество и активировать популяции лимфоцитов и NK-клеток как in vitro, так и in vivo, обусловливает противоопухолевые действия IL-2. Однако в результате его регуляторного механизма, направленного на предупреждение избыточных иммунных ответов и потенциального аутоиммунитета, IL-2 приводит к индуцированной активацией смерти клеток (AICD) и придает активированным Т-клеткам чувствительность к опосредуемому Fas апоптозу.

Кроме того, IL-2 участвует в поддержании и размножении периферических CD4+CD25+reg-клеток (Fontenot J.D., Rasmussen J.P., Gavin M.A. и др. A function for interleukin 2 in Foxp3 expressing regulatory T cells. Nat Immunol. 6, 2005, cc. 1142-1151; D'Cruz L.M., Klein L. Development and function of agonist-induced CD25+Foxp3+ regulatory T cells in the absence of interleukin 2 signaling. Nat Immunol. 6, 2005, cc. 1152-1159; Maloy K.J., Powrie F. Fueling regulation: IL-2 keeps CD4+ Treg cells fit. Nat Immunol. 6, 2005, cc. 1071-1072). Указанные клетки подавляют разрушение самих себя или мишеней эффекторными Т-клетками либо через контакты по типу клетка-клетка, либо посредством высвобождения иммуносупрессорных цитокинов, таких как IL-10 или трансформирующий фактор роста (TGF)-β. Установлено, что истощение Тreg-клеток повышает индуцированный IL-2 противоопухолевый иммунитет (Imai Н., Saio М., Nonaka K. и др., Depletion of CD4+CD25+ regulatory T cells enhances interleukin-2-induced antitumor immunity in a mouse model of colon adenocarcinoma. Cancer Sci. 98, 2007, cc. 416-423).

IL-2 играет важную роль в дифференцировке СD8+-Т-клеток памяти в процессе первичной и вторичной экспансии СD8+-Т-клеток. IL-2, вероятно, ответствен за оптимальную экспансию и создание эффекторных функций после первичной антигенной стимуляции. Во время фазы снижения иммунного ответа, на которой большая часть антигенспецифических СD8+-Т-клеток исчезает в результате апоптоза, сигналы IL-2 обладают способностью спасать CD8+-T-клетки от клеточной смерти и обеспечивают длительное увеличение количества CD8+-T-клеток памяти. На стадии иммунологической памяти (запоминания контакта с антигеном) уровень CD8+-Т-клеток можно повышать путем введения экзогенного IL-2. Кроме того, только те СD8+-Т-клетки, которые получали сигналы IL-2 во время начального примирования, могут опосредовать эффективную вторичную экспансию после возобновляемой антигенной стимуляции. Таким образом, сигналы IL-2 во время различных фаз иммунного ответа имеют решающее значение для оптимизации функций СD8+-Т-клеток, влияя тем самым как на первичные, так и на вторичные ответы указанных Т-клеток (Boyman О., Cho J.H., Sprent J. The role of interleukin-2 in memory CD8 cell differentiation. Adv Exp Med Biol. 684, 2010, cc. 28-41.).

С учетом его противоопухолевой эффективности лечение с применением высокодозового IL-2 (альдеслейкин, поступает в продажу под товарным знаком Proleukin®) разрешено для пациентов с метастатической почечно-клеточной карциномой (RCC) и злокачественной меланомой в США и для пациентов с метастатической RCC в Евросоюзе. Однако в результате механизма действия IL-2 системное и нецеленаправленное применение IL-2 может существенно подвергать риску противоопухолевый иммунитет посредством индукции Treg-клеток и AICD. Дополнительной проблемой, связанной с системным лечением IL-2, являются серьезные побочные действия после внутривенного введения, которые включают серьезные случаи воздействия на сердечно-сосудистую систему, отек легких, воздействия на печень, желудочно-кишечный тракт (ЖКТ), нервную систему и кровь (Обобщение данных о характеристиках продукта (SmPC) пролейкина (альдеслейкина): http://www.medicines.org.uk/emc/medicine/19322/SPC/ (информация доступна с 27 мая 2013 г.)). Проведено изучение на пациентах низкодозовых режимов IL-2, хотя и с получением субоптимальных терапевтических результатов. В целом, терапевтические подходы, основанные на применении IL-2, могут оказаться ценным для противораковой терапии, если удастся преодолеть препятствия, ассоциированные с его применением.

Иммуноконъюгаты, которые содержат нацеленный на опухоль антигенсвязывающий фрагмент, например, направленный на антиген, презентируемый на опухолевой клетке или в окружении опухолевой клетки, включая карциноэмбриональный антиген (СЕА) и фибробласт-активирующий белок (FAP), и эффекторный фрагмент, основой которого является IL-2, например, включая мутант IL-2, описаны, например, в WO 2012/146628 и WO 2012/107417.

В частности, был создан мутант IL-2 (например, четверной мутант IL-2 (четырехмутантный IL-2), который обозначают как IL-2 qm) для преодоления ограничений, характерных для IL-2 дикого типа (например, альдеслейкина) или первого поколения иммуноцитокинов на основе IL-2, путем элиминации связывания с IL-2Rα-субъединицей (CD25). Указанный мутантный IL-2 qm сшивали с различными антителами, обеспечивающими нацеливание на опухоль, такими как гуманизированное антитело, направленное против СЕА, и антитело, направленное против FAP. Кроме того, Fc-область антитела модифицировали для предупреждения связывания с Fсγ-рецепторами и комплексом C1q. В доклинических экспериментах in vitro и in vivo установлено, что полученные нацеленные на опухоль иммуноцитокины на основе варианта IL-2 (например, нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, и нацеленный на FAP иммуноцитокин, содержащий вариант IL-2) могут элиминировать опухолевые клетки.

Таким образом, полученные иммуноцитокины представляют собой класс нацеленных на опухоль иммуноцитокинов на основе варианта IL-2, которые влияют на способности IL-2 путем элиминации связывания с IL-2Rα-субъединицей (CD25):

Свойства IL-2 дикого типа и варианта IL-2

Понятие «IL-2» или «человеческий IL-2» относится к человеческому белку IL-2 дикого типа и его вариантам, которые содержат одну или несколько мутаций в аминокислотной последовательности IL-2 дикого типа, например, как представлено в SEQ ID NO: 2, имеющей замену С125А, которая позволяет избегать образования связанных дисульфидным мостиком димеров IL-2. IL-2 можно также подвергать мутации для удаления сайтов N- и/или О-гликозилирования.

Понятие «СЕА» относится к карциноэмбриональному антигену, включающему его иммуногенные эпитопы САР-1 и САР-2, белку, для которого характерен высокий уровень экспрессии на клеточной поверхности различных типов опухолей.

Понятие «FAP» относится к фибробласт-активирующему белку, т.е. белку, который экспрессируется на клеточной поверхности и присутствует на опухолевых клетках различных типов опухолей или в окружении опухолевых клеток различных типов опухолей.

Путь PD-1/PD-L1/PD-L2

Важным отрицательным костимуляторным сигналом, регулирующим Т-клеточную активацию, является рецептор запрограммированной гибели клеток 1 (PD-1)(CD279) и его являющиеся партнерами по связыванию лиганды PD-L1 (В7-Н1, CD274; SEQ ID NO: 88) и PD-L2 (B7-DC, CD273). Роль PD-1 в качестве негативного регулятора подтверждена «выключением» PD-1 (Pdcd 1-/-), который связан с аутоиммунитетом (Nishimura и др., Immunity 11, 1999, сс.141-151; Nishimura и др., Science 291, 2001, сс.319-322). PD-1 родственен CD28 и CTLA-4, но лишен мембранного проксимального цистеина, который обеспечивает гомодимеризацию. Цитоплазматический домен PD-1 содержит иммунорецепторный тирозиновый ингибирующий мотив (ITIM, V/IxYxxL/V). PD-1 связывается только с PD-L1 и PD-L2 (Freeman и др., J. Exp.Med. 192, 2000, сс.1-9; Dong и др., Nature Med. 5, 1999, сс.1365-1369; Latchman и др., Nature Immunol. 2, 2001, сс.261-268; Tseng и др., J. Exp.Med. 193, 2001, сс.839-846).

PD-1 может экспрессироваться на Т-клетках, В-клетках, естественных клетках-киллерах, напоминающих Т-клетки, активированных моноцитах и дендритных клетках (ДК). PD-1 экспрессируется активированными, но нестимулированными человеческими CD4+- и СD8+-Т-клетками, В-клетками и миелоидными клетками. Это является его отличием от более ограниченно экспрессируемых CD28 и CTLA-4 (Nishimura и др., Int. Immunol. 8, 1996, сс.773-780; Boettler и др., J. Virol. 80, 2006, сс.3532-3540). Известно по меньшей мере 4 варианта PD-1, которые были клонированы из активированных человеческих Т-клеток, включая транскрипты, лишенные (I) экзона 2, (II) экзона 3, (III) экзонов 2 и 3 или (IV) экзонов 2-4 (Nielsen и др., Cell. Immunol. 235, 2005, сс.109-111). За исключением PD-1 Δех3, уровни экспрессии всех вариантов сходны с уровнем экспрессии полноразмерного PD-1 в покоящихся мононуклеарных клетках периферической крови (РВМС). Экспрессия всех вариантов существенно индуцируется при активации человеческих Т-клеток антителом к CD3 и антителом к CD28. Варианты PD-1 Δех3 лишены трансмембранного домена и напоминают растворимый CTLA-4, который играет важную роль в аутоиммунитете (Ueda и др., Nature 423, 2003, сс.506-511). Этим вариантом обогащены синовиальная жидкость и сыворотка пациентов, страдающих ревматоидным артритом (Wan и др., J. Immunol. 177, 2006, сс. 8844-8850).

Два лиганда PD-1 отличаются их схемами экспрессии. Для PD-L1 характерна конститутивная экспрессия на мышиных Т- и В-клетках, ДК, макрофагах, мезенхимальных стволовых клетках и происходящих из костного мозга тучных клетках (Yamazaki и др., J. Immunol. 169, 2002, сс.5538-5545). Для PD-L1 характерна экспрессия на широком разнообразии негематопоэтических клеток (например, клетках роговицы, легкого, сосудистого эпителия, непаренхимальных клетках печени, мезенхимальных стволовых клетках, клетках панкреатических островков, плацентарных синктиотрофобластах, кератиноцитах и др.) (Keir и др., Annu. Rev. Immunol. 26, 2008, сс.677-704) и повышающая регуляция на целом ряде клеточных типов после активации. Интерфероны (IFN) как типа I, так и типа II, осуществляют повышающую регуляцию PD-L1 (Eppihimer и др., Microcirculation 9, 2002, сс.133-145; Schreiner и др., J. Neuroimmunol. 155, 2004, сс.172-182). Экспрессия PD-L1 в клеточных линиях снижается, когда ингибируют MyD88, TRAF6 и МЕK (Liu и др., Blood 110, 2007, сс.296-304). В индукции PD-L1 участвует также JAK2 (Lee и др., FEBS Lett. 580, 2006, сс.755-762; Liu и др., Blood 110, 2007, сс.296-304). Утрата или ингибирование фосфатазы и гомолога тензина (PTEN), клеточной фосфатазы, которая модифицирует путь передачи сигналов фосфатидилинозит-3-киназы (PI3K) и Akt, повышала пост-траснкрипционную экспрессию PD-L1 при разных типах рака (Parsa и др., Nat. Med. 13, 2007, сс. 84-88).

Экспрессия PD-L2 является более ограниченной, чем экспрессия PD-L1. Для PD-L2 характерна индуцибельная экспрессия на ДК, макрофагах и происходящих из костного мозга тучных клетках. PD-L2 экспрессируется также на примерно от половины до двух третей покоящихся перитонеальных В1 -клетках, но не на обычных В-клетках В2 (Zhong и др., Eur. J. Immunol. 37, 2007, сс.2405-2410). PD-L2+-B1-клетки связывают фосфатидилхолин и могут быть важны для врожденных иммунных ответов против бактериальных антигенов. Индукция PD-L2 с помощью IFN-гамма частично зависит от NF-κВ (Liang и др., Eur. J. Immunol. 33, 2003, сс.2706-2716). PD-L2 может индуцироваться также на моноцитах и макрофагах GM-CF, IL-4 и IFN-гамма (Yamazaki и др., J. Immunol. 169, 2002, сс.5538-5545; Loke и др., PNAS 100, 2003, сс.5336-5341).

Передача сигналов PD-1, как правило, оказывает более значительное действие на производство цитокинов, чем на клеточную пролиферацию, при этом наибольшим воздействиям подвергается производство IFN-гамма, TNF-альфа и IL-2. Опосредуемая PD-1 передача ингибирующих сигналов зависит также от силы передачи сигналов TCR, при этом большие уровни ингибирования достигаются при низких уровнях стимуляции TCR. Указанное снижение можно преодолевать совместной стимуляцией через CD28 (Freeman и др., J. Exp. Med. 192, 2002, сс.1027-1034) или присутствием IL-2 (Carter и др., Eur. J. Immunol. 32, 2002, сс.634-643).

Подтверждено предположение о том, что передача сигналов через PD-L1 и PD-L2 может быть двунаправленной. Это означает, что помимо модификации передачи сигналов TCR или BCR передача сигналов может также быть направлена обратно на клетки, экпрессирующие PD-L1 и PD-L2. При обработке дендритных клеток встречающимся в естественных условиях антителом к PD-L2, выделенным из пациента с макроглобулинемией Вальденстрема, не обнаружено повышающей регуляции костимуляторных молекул ГКГС II или В7, указанные клетки продуцировали большие количества провоспалительных цитокинов, прежде всего TNF-альфа и IL-6, и стимулировали Т-клеточную пролиферацию (Nguyen и др., J. Exp. Med. 196, 2002, сс. 1393-1398). Обработка мышей указанным антителом, кроме того (1) повышала устойчивость к трансплантированной меланоме b16 и быстро индуцировала опухоль специфические CTL (Radhakrishnan и др., J. Immunol. 170, 2003, сс. 1830-1838; Radhakrishnan и др., Cancer Res. 64, 2004, сс. 4965-4972; Heckman и др., Eur. J. Immunol. 37, 2007, сс. 1827-1835; (2) блокировала развитие воспалительного заболевания дыхательных путей на мышиной модели аллергической астмы (Radhakrishnan и др., J. Immunol. 173, 2004, сс. 1360-1365; Radhakrishnan и др., J. Allergy Clin. Immunol. 116, 2005, сс. 668-674).

Дополнительное подтверждение обратимой передачи сигналов в дендритных клетках («ДК») получено в опытах, в которых происходящие из костного мозга ДК культивировали с растворимым PD-1 (ЕС-домен PD-1, слитый с константной областью Ig - «s-PD-1») (Kuipers и др., Eur. J. Immunol. 36, 2006, сс. 2472-2482). Ингибирование указанным sPD-1 активации ДК и повышение производства IL-10, можно было обращать путем введения антитела к PD-1.

Кроме того, в нескольких исследованиях описан рецептор для PD-L1 или PD-L2, который не зависит от PD-1. В качестве партнера по связыванию с PD-L1 уже идентифицирован В7.1 (Butte и др., Immunity 27, 2007, сс.111-122). Опыты по химическому перекрестному сшиванию позволили предположить, что PD-L1 и В7.1 могут взаимодействовать через их IgV-подобные домены. Взаимодействия B7.1:PD-L1 могут индуцировать ингибирующий сигнал в Т-клетках. Лигирование PD-L1 на СD4+-Т-клетках с помощью В7.1 или лигирование В7.1 на СD4+-Т-клетках с помощью PD-L1 приводит к передаче ингибирующего сигнала. У Т-клеток, лишенных CD28 и CTLA-4, обнаружены пониженная пролиферация и производство цитокинов, когда их стимулировали гранулами, покрытыми антителом к CD3 плюс В7.1. В Т-клетках, лишенных всех рецепторов для В7.1 (т.е. CD28, CTLA-4 и PD-L1), Т-клеточная пролиферация и производство цитокинов больше не ингибировались гранулами, покрытыми антителом к CD3 плюс В7.1. Эти данные свидетельствуют о том, что В7.1 действует специфически через PD-L1 на Т-клетке в отсутствии CD28 и CTLA-4. Аналогично этому, у Т-клеток, лишенных PD-1, обнаружены пониженные пролиферация и производство цитокинов, когда их стимулировали в присутствии гранул, покрытых антителом к CD3 плюс PD-L1, что демонстрирует ингибирующее действие лигирования PD-L1 с В7.1 на Т-клетках. Когда Т-клетки лишены всех известных рецепторов для PD-L1 (т.е. у них отсутствуют PD-1 и В7.1), то Т-клеточная пролиферация больше не нарушалась гранулами, покрытыми антителом к CD3 плюс PD-L1. Таким образом, PD-L1 может оказывать ингибирующее действие на Т-клетки либо через В7.1, либо через PD-1.

Наличие непосредственного взаимодействия между В7.1 и PD-L1 позволяет предположить, что современные сведения о костимуляции являются неполными и подчеркивает важность экспрессии указанных молекул на Т-клетках. Исследование PD-L1-/-Т-клеток свидетельствует о том, что PD-L1 на Т-клетках может осуществлять понижающую регуляцию производства цитокинов Т-клетками (Latchman и др., Proc. Natl. Acad. Sci. USA 101, 2004, cc. 10691-10696). Поскольку и PD-L1, и B7.1 экспрессируются на Т-клетках, В-клетках, ДК и макрофагах, существует возможность направленных взаимодействий между В7.1 и PD-L1 на указанных типах клеток. Кроме того, PD-L1 на негематопоэтических клетках может взаимодействовать с В7.1, также как PD-1 на Т-клетках, это вызывает вопрос о том, участвует ли PD-L1 в указанной регуляции. Одним из возможных объяснений ингибирующего эффекта взаимодействия B7.1:PD-L1 является то, что Т-клеточный PD-L1 может улавливать или препятствовать взаимодействию АРС В7.1 с CD28.

В результате этого антагонизм передачи сигналов через PD-L1, включая блокаду взаимодействия PD-L1 либо с PD-1, либо с В7.1, либо с ними обоими, что препятствует передаче PD-L1 отрицательного костимуляторного сигнала к Т-клеткам и другим антигенпрезентирующим клеткам, по-видимому, повышает иммунитет в ответ на инфекцию (например, острую и хроническую) и противоопухолевый иммунитет. Кроме того, антитела к PD-L1, предлагаемые в настоящем изобретении, можно объединять с антагонистами других компонентов передачи сигналов PD-1:PD-L1, например, с антагонистическими антителами к PD-1 и PD-L2.

Понятие «человеческий PD-L1» относится к человеческому белку PD-L1 (SEQ ID NO: 88, как правило, участвует в передаче сигналов PD-1). В контексте настоящего описания понятие «связывающееся с человеческим PD-L1» или «специфически связывающееся с человеческим PD-L1», или «которое связывается с человеческим PD-L1», или «антитело к PD-L1» относится к антителу, которое специфически связывается с антигеном человеческого PD-L1, аффинность связывания которого характеризуется величиной KD, составляющей 1,0×10-8 моля/л или ниже, в одном из вариантов осуществления изобретения величиной KD, составляющей 1,0×10-9 моля/л или ниже. Аффинность связывания определяют с помощью стандартного анализа связывания, такого как поверхностный плазмонный резонанс (SPR) (Biacore®, фирма GE-Healthcare Уппсала, Швеция). Таким образом, в контексте настоящего описания «антитело, связывающееся с человеческим PD-L1» относится к антителу, которое специфически связывается с антигеном человеческого PD-L1, аффинность связывания которого характеризуется величиной KD, составляющей 1,0×10-8 моля/л или ниже (в одном из вариантов осуществления изобретения 1,0×10-8 - 1,0×10-13 моля/л), в одном из вариантов осуществления изобретения величиной KD, составляющей 1,0×10-9 моля/л или ниже (в одном из вариантов осуществления изобретения 1,0×10-9 - 1,0×10-13 моля/л).

Как подробно указано в настоящем описании, при создании изобретения было установлено, что нацеленный на опухоль мутант IL-2 обладает улучшенными терапевтическими действиями in vivo при применении в комбинации с антагонистами пути PD-1/PD-L1. В частности, при создании изобретения установлено, что нацеленный на опухоль мутант IL-2, такой как нацеленный на СЕА содержащий вариант IL-2 иммуноцитокин (обозначенный как CEA-IL2v или нацеленный на СЕА IgG-IL-2 qm) или нацеленный на FAP содержащий вариант IL-2 иммуноцитокин (обозначенный как FAP-IL2v или нацеленный на FAP IgG-IL-2 qm), обладает улучшенными терапевтическими действиями in vivo при применении в комбинации в антителом, которое связывается с человеческим PD-L1.

Способность IL-2 воздействовать на увеличение количества и активировать лимфоциты и естественные клетки-киллеры (NK) лежит в основе противоопухолевой активности IL-2. Мутанты IL-2, созданные для элиминации связывания IL-2 с IL-2α-субъединицей (CD25), позволяют преодолевать ограничения, связанные с IL-2, и, как установлено, в качестве компонента нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, такого как нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, или нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, обладают способностью элиминировать опухолевые клетки.

При создании изобретения было установлено, как представлено в настоящем описании, что обработка in vitro нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, индуцирует повышающую регуляцию PD-L1 на опухолевых клетках. Например, с использованием совместных культур человеческих РВМС и клеточной линии человеческого рака легкого А549 установлено, что нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, индуцирует повышающую регуляцию PD-L1 на А549-клетках в зависимости от концентрации, наиболее вероятно опосредуемую высвобождением IFNγ. С использованием нацеленного на СЕА иммуноцитокина, содержащего вариант IL-2, обозначенного как «CEA-IL2v» (соответствует нацеленному на СЕА слитому белку IgG-IL-2 qm на основе антитела к СЕА СН1А1А 98/99 2F1 и четверного мутанта IL-2 (IL-2 qm, SEQ ID NO: 3), который имеет последовательности, представленные в виде SEQ ID NO: 84, 86 и 88, описанные в WO 2012/146628, примеры 1 и 2), CEA-IL2v при его индивидуальном применении не обладает способностью индуцировать PD-L1 на опухолевых клетках линии А549 (фиг. 4). Однако в присутствии РВМС имела место повышающая регуляция PD-L1 на А549-клетках, свидетельствуя о том, что действие опосредовалось через иммунные клетки, наиболее вероятно опосредовалось высвобождением IFNγ. Уровень экспрессии PD-L1 возрастал с повышением концентрации CEA-IL2v, а также с увеличением соотношения Е:Т. Известно, что повышающая регуляция PD-L1 отрицательно влияет на активность NK и Т-клеток путем взаимодействия с PD-1. Таким образом, указанную отрицательную петлю обратной связи можно аннулировать путем добавления блокирующего PD-L1 антитела.

При создании изобретения также было установлено, как представлено в настоящем описании, что обработка in vivo нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, и ингибитором PD-L1 приводила к I) повышенному ингибированию роста опухолей по сравнению с соответствующими терапиями на основе индивидуальных агентов на сингенных моделях мышиных опухолевых линий и II) повышенной объединенной медианной и/или общей выживаемости на сингенных моделях мышиных опухолевых линий, в частности, при одновременном применении. Начато несколько доклинических исследований для оценки противоопухолевой эффективности in vivo комбинации мышинизированной суррогатной молекулы нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с суррогатным антителом к мышиному PD-L1. Например, начаты доклинические исследования для оценки противоопухолевой эффективности in vivo комбинации мышинизированной суррогатной молекулы нацеленного на СЕА иммуноцитокина, содержащего вариант IL-2, CEA-IL2v (обозначенного как muCEA-muIL2v), мышинизированной суррогатной молекулы нацеленного на FAP иммуноцитокина, содержащего вариант IL-2, FAP-IL2v (обозначенного как muFAP-muIL2v), в сочетании с суррогатным антителом к мышиному PD-L1 (например, антитело YW243.55.S70 PD-L1 muIgG1, описанное в WO 2010/077634, последовательности которого представлены на фиг. 11, содержащего мутацию DAPG, которая элиминирует взаимодействие с FcγR, или кроссреактивное человеческое/мышиное антитело к человеческому PD-L1).

Иммуноцитокины и антитела

Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, содержит

антитело, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, или его антигенсвязывающий фрагмент и

мутант IL-2, прежде всего мутант человеческого IL-2, который обладает пониженной аффинностью связывания с α-субъединицей IL-2-рецептора (по сравнению с IL-2 дикого типа, например, человеческого IL-2, представленного в виде SEQ ID NO: 2), такой как IL-2, содержащий:

IV) одну, две или три аминокислотную(ые) замену(ы) в одном, двух или трех положении(ях), выбранном(ых) из положений, соответствующих остаткам 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, три замены в трех положениях, например, конкретные аминокислотные замены F42A, Y45A и L72G; или

V) характеристики, указанные в подпункте I), плюс аминокислотную замену в положении, соответствующем остатку 3 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретную аминокислотную замену Т3А; или

VI) четыре аминокислотные замены в положениях, соответствующих остаткам 3, 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретные аминокислотные замены Т3А, F42A, Y45A и L72G.

Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, может содержать

вариабельный домен тяжелой цепи и вариабельный домен легкой цепи антитела, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и Fc-домен, состоящий из двух субъединиц и содержащий модификацию, которая усиливает гетеродимеризацию двух неидентичных полипептидных цепей, и

мутант IL-2, прежде всего мутант человеческого IL-2, который обладает пониженной аффинностью связывания с α-субъединицей IL-2-рецептора (по сравнению с IL-2 дикого типа, например, человеческого IL-2, представленного в виде SEQ ID NO: 2), такой как IL-2, содержащий:

IV) одну, две или три аминокислотную(ые) замену(ы) в одном, двух или трех положении(ях), выбранном(ых) из положений, соответствующих остаткам 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, три замены в трех положениях, например, конкретные аминокислотные замены F42A, Y45A и L72G; или

V) характеристики, указанные в подпункте I), плюс аминокислотную замену в положении, соответствующем остатку 3 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретную аминокислотную замену Т3А; или

VI) четыре аминокислотные замены в положениях, соответствующих остаткам 3, 42, 45 и 72 человеческого IL-2, представленного в виде SEQ ID NO: 2, например, конкретные аминокислотные замены Т3А, F42A, Y45A и L72G.

Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, может содержать

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110.

В некоторых вариантах осуществления изобретения нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, содержит полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88.

Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, может содержать

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

в) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126.

В некоторых вариантах осуществления изобретения нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, содержит полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81.

Указанные нацеленные на опухоль иммуноцитокины, содержащие вариант IL-2, наряду с участками их компонентов, таких как антигенсвязывающие молекулы, Fc-домены и эффекторные фрагменты, описаны в качестве примеров иммуноконъюгатов в WO 2012/146628 и WO 2012/107417. Например, конкретные иммуноцитокины «нацеленный на СЕА слитый белок IgG-IL-2 qm» на основе антитела к СЕА СН1А1А 98/99 2F1 и четверного мутанта IL-2 (qm) (SEQ ID NO: 3), которые имеют последовательности, представленные в виде SEQ ID NO: 84 и 86, и 88, описаны, например, в примерах 1 и 2 WO 2012/146628. Например, конкретные иммуноцитокины «нацеленный на FAP слитый белок IgG-IL-2 qm» на основе антитела к FAP 4 В9 и четверного мутанта IL-2 (qm) (SEQ ID NO: 3), которые имеют последовательности, представленные в виде SEQ ID NO: 79 и 80, и 81, описаны, например, в примерах 1 и 2 WO 2012/146628 и в примере 1 WO 2012/107417.

Конкретный нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который описан в WO 2012/146628, отличается тем, что содержит следующие полипептидные последовательности, указанные в настоящем описании:

Конкретные нацеленные на FAP иммуноцитокины, содержащие вариант IL-2, которые описаны в WO 2012/146628 и WO 2012/107417, отличаются тем, что содержат следующие полипептидные последовательности, указанные в настоящем описании:

Как описано в WO 2012/146628, мутант IL-2 обладает пониженной аффинностью связывания с α-субъединицей IL-2-рецептора. В сочетании с β- и γ-субъединицами (которые известны также как CD 122 и CD 132 соответственно) α-субъединица (известная также как CD25) образует гетеротримерный высокоаффинный IL-2-рецептор, в то время как димерный рецептор, состоящий только из β- и γ-субъединиц, обозначают как IL-2-рецептор с промежуточной аффинностью. Как описано в WO 2012/146628, мутантный полипептид IL-2, обладающий пониженной способностью связываться с α-субъединицей IL-2-рецептора, обладает пониженной способностью индуцировать передачу сигналов IL-2 в регуляторных Т-клетках, индуцирует пониженную индуцированную активацией смерть клеток (AICD) у Т-клеток и обладает пониженным профилем токсичности in vivo по сравнению с полипептидом IL-2 дикого типа. Применение такого мутанта IL-2, обладающего пониженной токсичностью, наиболее целесообразно в нацеленных на опухоль иммуноцитокинах, содержащих вариант IL-2, которые обладают продолжительным временем полужизни в сыворотке из-за присутствия Fc-домена. Мутант IL-2 может содержать по меньшей мере одну аминокислотную мутацию, которая снижает или элиминирует аффинность мутанта IL-2 к α-субъединице IL-2-рецептора (CD25), но сохраняет аффинность мутанта IL-2 к IL-2-рецептору с промежуточной аффинностью (который состоит из β- и γ-субъединиц IL-2-рецептора) по сравнению с IL-2 дикого типа. Одна или несколько аминокислотных мутаций могут представлять собой аминокислотные замены. Мутант IL-2 может содержать одну, две или три аминокислотную(ые) замену(ы) в одном, двух или трех положении(ях), выбранном(ых) из остатков, соответствующих 42, 45 и 72 человеческого IL-2 (представленного в виде SEQ ID NO: 2). Мутант IL-2 может содержать три аминокислотные замены в положениях, соответствующих остатку 42, 45 и 72 человеческого IL-2. Мутант IL-2 может представлять собой мутант человеческого IL-2. Мутант IL-2 может представлять собой человеческий IL-2, которые содержит аминокислотные замены F42A, Y45A и L72G. Мутант IL-2 может содержать дополнительно аминокислотную мутацию в положении, соответствующем положению 3 человеческого IL-2, которая приводит к элиминации сайта О-гликозилирования в IL-2. В частности, указанная дополнительная аминокислотная мутация представляет собой аминокислотную замену остатка треонина на остаток аланина. Конкретный мутант IL-2, который можно применять в изобретении, содержит четыре аминокислотные замены в положениях, соответствующих остаткам 3, 42, 45 и 72 человеческого IL-2 (представлен в виде SEQ ID NO: 2). Конкретные аминокислотные замены представляют собой Т3А, F42A, Y45A и L72G. Как продемонстрировано в примерах в WO 2012/146628, указанный четверной мутантный полипептид IL-2 (IL-2 qm) не обладает выявляемой способностью к связыванию с CD25, обладает пониженной способностью индуцировать апоптоз Т-клеток, пониженной способностью индуцировать передачу сигналов IL-2 в Тreg-клетках и пониженным профилем токсичности in vivo. Однако он сохраняет способность активировать передачу сигналов IL-2 в эффекторных клетках, индуцировать пролиферацию эффекторных клеток и создание NK-клетками IFN-γ в качестве вторичного цитокина. Мутант IL-2, указанный в одном из представленных выше описаний, может содержать дополнительные мутации, которые обеспечивают дополнительные преимущества, такие как такие как повышенный уровень экспрессии или повышенная стабильность. Например, цистеин в положении 125 можно заменять на нейтральную аминокислоту, такую как аланин, что позволяет избегать образования связанных дисульфидными мостиками димеров IL-2. Таким образом, мутант IL-2 может содержать дополнительную аминокислотную мутацию в положении, соответствующем остатку 125 человеческого IL-2. Указанная дополнительная аминокислотная мутация может представлять собой аминокислотную замену С125А. Мутант IL-2 может содержать полипептидную последовательность SEQ ID NO: 3.

Как описано в WO 2012/146628 и WO 2012/107417, таргетинг опухоли нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, может быть достигнут путем таргетинга антигена, презентируемого на опухолевой клетке или в окружении опухолевой клетки. Таким образом, иммуноцитокин имеет антигенсвязывающий фрагмент. Антигенсвязывающий фрагмент, как правило, представляет собой полипептидную молекулу, которая связывается со специфической антигенной детерминантой и обладает способностью направлять субстанцию, с которой она связана (например, эффекторный фрагмент и Fc-домен) к сайту-мишени, например, к специфическому типу опухолевой клетки или стромы опухоли, которая несет антигенную детерминанту. Иммуноцитокин может связываться с антигенной детерминантой, например, присутствующей на поверхности опухолевых клеток, на поверхности других больных клеток, находящейся в свободном состоянии в сыворотке крови и/или во внеклеточном матриксе (ЕСМ). Антигенсвязывающий фрагмент может быть направлен к антигену, ассоциированному с патологическим состоянием, такому как антиген, презентируемый на опухолевой клетке или в окружении опухолевой клетки или в области воспаления.

Примерами опухолевых антигенов являются (но не ограничиваясь только ими) MAGE, MART-1/Melan-A, gp100, дипептидилпептидаза IV (DPPIV), белок, связывающий аденозиндеаминазу (ADAbp), циклофилин b, антиген, ассоциированный с колоректальным раком (CRC)-C017-1A/GA733, карциноэмбриональный антиген (СЕА) и его иммуногенные эпитопы САР-1 и САР-2, etv6, amll, простатический антиген (PSA) и его иммуногенные эпитопы PSA-1, PSA-2 и PSA-3, простатический специфический мембранный антиген (PSMA), антиген стволовых клеток предстательной железы (PSCA), MAGE-семейство опухолевых антигенов (например, MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-A10, MAGE-A11, MAGE-A12, MAGE-Xp2 (MAGE-B2), MAGE-Хр3 (MAGE-B3), MAGE-Xp4 (MAGE-B4), MAGE-C1, MAGE-C2, MAGE-C3, MAGE-C4, MAGE-C5), GAGE-семейство опухолевых антигенов (например, GAGE-1, GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7, GAGE-8, GAGE-9), BAGE, RAGE, LAGE-1, NAG, GnT-V, MUM-1, CDK4, тирозиназа, p53, MUC-семейство, HER2/neu, p21ras, RCAS1, α-фетопротеин, Е-кадхерин, α-катенин, β-катенин и γ-катенин, p120ctn, gp100 Pmel117, PRAME, NY-ESO-1, cdc27, белок аденоматозного полипоза coli (АРС), фодрин, коннексин 37, Ig-идиотип, р15, gp75, ганглиозиды GM2 и GD2, вирусные продукты, такие как белки человеческого вируса папилломы, семейство Smad опухолевых антигенов, lmp-1, P1А, кодируемый EBV ядерный антиген (EBNA)-1, гликогенфосфолипаза головного мозга, SSX-1, SSX-2 (HOM-MEL-40), SSX-1, SSX-4, SSX-5, SCP-1 и СТ-7 и c-erbВ-2. Примерами антигенов ЕСМ являются (но не ограничиваясь только ими) синдекан, гепараназа, интегрины, остеопонтин, белки семейства link, кадхерины, ламинин, ламинин типа EGF, лектин, фибронектин, белки семейства notch, тенасцин и матриксин.

Примерами антигенов клеточной поверхности являются (но не ограничиваясь только ими): FAP, Her2, EGFR, IGF-1R, CD22 (В-клеточный рецептор), CD23 (низкоаффинный IgE-рецептор), CD30 (цитокиновый рецептор), CD33 (поверхностный антиген клеток миелоидного ряда), CD40 (рецептор фактора некроза опухолей), IL-6R (IL6-рецептор), CD20, MCSP и PDGFβR (рецептор тромбоцитарного фактора роста β). В конкретных вариантах осуществления изобретения антиген представляет собой человеческий антиген.

В некоторых вариантах осуществления изобретения антигенсвязывающий фрагмент направлен к антигену, презентируемому на опухолевой клетке или в окружении опухолевой клетки. В других вариантах осуществления изобретения антигенсвязывающий фрагмент направлен к антигену, выбранному из группы, включающей фибробласт-активирующий белок (FAP) и карциноэмбриональный антиген (СЕА). Иммуноцитокин может содержать два или большее количество антигенсвязывающих фрагментов, при этом каждый из указанных антигенсвязывающих фрагментов специфически связывается с одной и той же антигенной детерминантой.

Антигенсвязывающий фрагмент может представлять собой антитело любого типа или его фрагмент, который сохраняет специфичность связывания с антигенной детерминантой. Фрагменты антитела включают (но не ограничиваясь только ими) VH-фрагменты, VL-фрагменты, Fab-фрагменты, F(ab')2-фрагменты, scFv-фрагменты, Fv-фрагменты, минитела (минибоди), димерные антитела, тримерные антитела и тетрамерные антитела (см., например, Hudson и Souriau, Nature Med 9, 2003, сс. 129-134). В конкретном варианте осуществления изобретения антигенсвязывающий фрагмент представляет собой молекулу Fab. В одном из вариантов осуществления изобретения указанная молекула Fab является человеческой. В другом варианте осуществления изобретения указанная молекула Fab является гуманизированной. В следующем варианте осуществления изобретения указанная молекула Fab содержит константные области человеческой тяжелой и легкой цепей.

В предпочтительных вариантах осуществления изобретения таргетинг опухоли нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, может быть достигнут путем таргетинга карциноэмбрионального антигена (СЕА), что описано в WO 2012/146628. Для достижения СЕА-таргетинга можно применять антитело к СЕА или его антигенсвязывающий фрагмент. Антитело к СЕА может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 66 или SEQ ID NO: 68, или ее вариант, который сохраняет функциональность. Антитело к СЕА может содержать последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 65 или SEQ ID NO: 67, или ее вариант, который сохраняет функциональность. Антитело к СЕА может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 66, или ее вариант, который сохраняет функциональность, и последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 65, или ее вариант, который сохраняет функциональность. Антитело к СЕА может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 68, или ее вариант, который сохраняет функциональность, и последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 67, или ее вариант, который сохраняет функциональность. Антитело к СЕА может содержать последовательность вариабельной области тяжелой цепи SEQ ID NO: 66 и последовательность вариабельной области легкой цепи SEQ ID NO: 65. Антитело к СЕА может содержать последовательность вариабельной области тяжелой цепи SEQ ID NO: 68 и последовательность вариабельной области легкой цепи SEQ ID NO: 67.

Как описано в WO 2012/146628, нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность, в которой тяжелая цепь Fab, специфического в отношении СЕА, объединена карбоксиконцевой пептидной связью с субъединицей Fc-домена, которая содержит модификацию, приводящую к образованию «выступа», которая в свою очередь объединена карбоксиконцевой пептидной связью с полипептидом IL-2. Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность, выбранную из группы, состоящей из SEQ ID NO: 82, SEQ ID NO: 83 и SEQ ID NO: 84, или ее вариант, который сохраняет функциональность. Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность, в которой тяжелая цепь Fab, специфического в отношении СЕА, объединена карбоксиконцевой пептидной связью с субъединицей Fc-домена, которая содержит модификацию, приводящую к образованию «впадины». Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность SEQ ID NO: 85 или SEQ ID NO: 86 или ее вариант, который сохраняет функциональность. Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать легкую цепь Fab, специфического для СЕА. Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность SEQ ID NO: 87 или SEQ ID NO: 88 или ее вариант, который сохраняет функциональность. Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать может содержать полипептидные последовательности SEQ ID NO: 85, SEQ ID NO: 82 и SEQ ID NO: 87 или их варианты, которые сохраняют функциональность. Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может содержать полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88 или их варианты, которые сохраняют функциональность. Полипептиды могут быть ковалентно связаны, например, с помощью дисульфидной связи. Fc-домен полипептидных цепей может содержать аминокислотные замены L234A, L235A и P329G (которые можно обозначать как LALA P329G).

Как описано в WO 2012/146628, нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, может представлять собой нацеленный на СЕА слитый белок IgG-IL-2 qm на основе антитела к СЕА СН1А1А 98/99 2F1 и четверного мутанта IL-2 (IL-2 qm, SEQ ID NO: 3), который имеет последовательности, представленные в виде SEQ ID NO: 84, 86 и 88 (которые описаны, например, в примерах 1 и 2 WO 2012/146628). Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который имеет последовательности, представленные в виде SEQ ID NO: 84, 86 и 88, обозначен в контексте настоящего описания как «CEA-IL2v».

В предпочтительных вариантах осуществления изобретения таргетинг опухоли нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, может быть достигнут путем таргетинга фибробласт-активирующего белка (FAP), что описано в WO 2012/146628 и WO 2012/107417. Для достижения FAP-таргетинга можно применять антитело к FAP или его антигенсвязывающий фрагмент. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности, выбранной из группы, состоящей из SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 24, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 44, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 50, SEQ ID NO: 52, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 58, SEQ ID NO: 60, SEQ ID NO: 62 и SEQ ID NO: 64, или их вариантов, которые сохраняют функциональность. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности, выбранной из группы, состоящей из: SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61 и SEQ ID NO: 63, или их вариантов, которые сохраняют функциональность. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности, выбранной из группы, состоящей из SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 24, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 44, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 50, SEQ ID NO: 52, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 58, SEQ ID NO: 60, SEQ ID NO: 62 и SEQ ID NO: 64 или их вариантов, которые сохраняют функциональность, и последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности, выбранной из группы, состоящей из: SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61 и SEQ ID NO: 63, или их вариантов, которые сохраняют функциональность. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 42, и последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 41. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 58, и последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 57. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 12, и последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 11. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 7, и последовательность вариабельной области легкой цепи, которая по меньшей мере примерно на 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% или 100% идентична последовательности SEQ ID NO: 6. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи SEQ ID NO: 42 и последовательность вариабельной области легкой цепи SEQ ID NO: 41. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи SEQ ID NO: 58 и последовательность вариабельной области легкой цепи SEQ ID NO: 57. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи SEQ ID NO: 12 и последовательность вариабельной области легкой цепи SEQ ID NO: 11. Антитело к FAP может содержать последовательность вариабельной области тяжелой цепи SEQ ID NO: 7 и последовательность вариабельной области легкой цепи SEQ ID NO: 6.

Как описано в WO 2012/146628 и WO 2012/107417 нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность, в которой тяжелая цепь Fab, специфического в отношении FAP, объединена карбоксиконцевой пептидной связью с субъединицей Fc-домена, которая содержит модификацию, приводящую к образованию «выступа», которая в свою очередь объединена карбоксиконцевой пептидной связью с полипептидом IL-2. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность, выбранную из группы, состоящей из SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72 и SEQ ID NO: 73, или их вариантов, которые сохраняют функциональность. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность, в которой тяжелая цепь Fab, специфического в отношении FAP, объединена карбоксиконцевой пептидной связью с субъединицей Fc-домена, которая содержит модификацию, приводящую к образованию «впадины». Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность, выбранную из группы, состоящей из SEQ ID NO: 74, SEQ ID NO: 75 и SEQ ID NO: 76 или их вариантов, которые сохраняют функциональность. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать легкую цепь Fab, специфического в отношении FAP. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность SEQ ID NO: 77 или SEQ ID NO: 78 или ее вариант, который сохраняют функциональность. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидную последовательность SEQ ID NO: 77, полипептидную последовательность SEQ ID NO: 74 и полипептидную последовательность, выбранную из группы, состоящей из SEQ ID NO: 69 и SEQ ID NO: 72, или вариантов, которые сохраняют функциональность. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидные последовательности SEQ ID NO: 75, SEQ ID NO: 70 и SEQ ID NO: 77 или их варианты, которые сохраняют функциональность. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидные последовательности SEQ ID NO: 76, SEQ ID NO: 77 и SEQ ID NO: 78 или их варианты, которые сохраняют функциональность. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидные последовательности SEQ ID NO: 77, SEQ ID NO: 74 и SEQ ID NO: 72 или их варианты, которые сохраняют функциональность. Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может содержать полипептидные последовательности SEQ ID NO: 78, SEQ ID NO: 76 и SEQ ID NO: 73 или их варианты, которые сохраняют функциональность. Полипептиды ковалентно связывают, например, с помощью дисульфидной связи. Каждая из субъединиц Fc-домена может содержать аминокислотные замены L234A, L235A и P329G (которые можно обозначать как LALA P329G).

Как описано в WO 2012/146628 и WO 2012/107417, нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, может представлять собой нацеленный на FAP слитый белок IgG-IL-2 qm на основе антитела к FAP 4 В9 и четверного мутанта IL-2 (IL-2 qm, SEQ ID NO: 3), который имеет последовательности, представленные в виде SEQ ID NO: 79, 80 и 81 (описанные, например, в примерах 1 и 2 WO 2012/146628 и примере 1 WO 2012/107417). Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который имеет последовательности, представленные в виде SEQ ID NO: 79, 80 и 81, обозначен в контексте настоящего описания как «FAP-IL2v».

Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, может содержать антитело, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и мутант IL-2, который обладает пониженной аффинностью связывания с субъединицей IL-2-рецептора. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, может практически состоять из антитела, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и мутанта IL-2, который обладает пониженной аффинностью связывания с субъединицей IL-2-рецептора. Антитело может представлять собой антитело в виде IgG, прежде всего антитело в виде IgG1. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, может содержать единственный мутант IL-2, который обладает пониженной аффинностью связывания с субъединицей IL-2-рецептора (т.е. присутствует не более одного компонента, представляющего собой мутант IL-2).

Как указано в настоящем описании, нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, может содержать вариабельный домен тяжелой цепи и вариабельный домен легкой цепи антитела, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и Fc-домен, состоящий из двух субъединиц и содержащий модификацию, которая усиливает гетеродимеризацию двух неидентичных полипептидных цепей. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, может содержать вариабельный домен тяжелой цепи антитела, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и субъединицу Fc-домена, которая содержит модификацию, приводящую к образованию «выступа», вариабельный домен тяжелой цепи антитела, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и субъединицу Fc-домена, которая содержит модификацию, приводящую к образованию «впадины», и вариабельный домен легкой цепи антитела, которое связывается с антигеном, презентируемым на опухолевой клетке или в окружении опухолевой клетки, и мутант IL-2, который обладает пониженной аффинностью связывания с субъединицей IL-2-рецептора. Таким образом, иммуноцитокин может содержать Fc-домен, который содержит модификацию, усиливающую гетеродимеризацию двух неидентичных полипептидных цепей. «Модификация, усиливающая гетеродимеризацию» представляет собой манипуляцию с пептидным каркасом или пост-трансляционные модификации полипептида, которые уменьшают или препятствуют ассоциации полипептида с идентичным полипептидом с образованием гомодимера. В контексте настоящего описания модификация, усиливающая гетеродимеризацию, включает, прежде всего, различные модификации, осуществляемые с каждым из двух полипептидов, которые требуются для образования димера, при этом, модификации дополняют друг друга таким образом, чтобы усиливать ассоциацию двух полипептидов. Например, модификация, усиливающая гетеродимеризацию, может изменять структуру или заряд одного или обоих полипептидов, требуемых для образования димера, таким образом, чтобы улучшать их ассоциацию стерически или электростатически соответственно. Гетеродимеризация имеет место между двумя неидентичными полипептидами, такими как две субъединицы Fc-домена, при этом дополнительные компоненты иммуноконъюгата слитых друг с другом субъединиц (например, антигенсвязывающего фрагмента, эффекторного фрагмента) не являются одинаковыми. В иммуноконъюгатах, предлагаемых в настоящем изобретении, модификация, усиливающая гетеродимеризацию, затрагивает Fc-домен. В некоторых вариантах осуществления изобретения модификация, усиливающая гетеродимеризацию, представляет собой аминокислотную мутацию, в частности, аминокислотную замену. В конкретном варианте осуществления изобретения модификация, усиливающая гетеродимеризацию, представляет собой индивидуальную аминокислотную мутацию, в частности, аминокислотную замену, в каждой из двух субъединиц Fc-домена. Сайт наиболее сильного белок-белкового взаимодействия двух полипептидных цепей Fc-домена человеческого IgG находится в СН3-домене Fc-домена. Таким образом, в одном из вариантов осуществления изобретения указанная модификация находится в СН3-домене Fc-домена. В конкретном варианте осуществления изобретения указанная модификация представляет собой модификацию типа «knob-in-hole», которая включает модификацию, приводящую к образованию «выступа» в одной из двух субъединиц Fc-домена и к образованию «впадины» в другой одной из двух субъединиц Fc-домена.

Технология «knob-into-hole» описана, например, в US 5731168; US 7695936; у Ridgway и др., Prot Eng 9, 1996, сс.617-621 и Carter, J Immunol Meth 248, 2001, сс. 7-15). В целом, метод включает интродукцию выпуклости («выступ») на поверхности раздела первого полипептида и соответствующей полости («впадина») в поверхности раздела второго полипептида, в результате выпуклость может помещаться в полость, усиливая тем самым образование гетеродимера и препятствуя образованию гомодимера. Выпуклости конструируют путем замены аминокислот с небольшими боковыми цепями в поверхности раздела первого полипептида на аминокислоты с более крупными боковыми цепями (например, на тирозин или триптофан). Компенсирующие полости идентичного или сходного размера с выпуклостями конструируют в поверхности раздела второго полипептида путем замены аминокислот с крупными боковыми цепями на аминокислоты с менее крупными боковыми цепями (например, аланин или треонин). Выпуклость и полость можно создавать путем изменения нуклеиновой кислоты, кодирующей полипептиды, например, с помощью сайтнаправленного мутагенеза, или посредством синтеза пептидов. В конкретном варианте осуществления изобретения модификация, приводящая к образованию «выступа», представляет собой аминокислотную замену T366W в одной из двух субъединиц Fc-домена, а модификация, приводящая к образованию «впадины», представляет собой аминокислотные замены T366S, L368A и Y407V в другой одной из двух субъединиц Fc-домена. В более конкретном варианте осуществления изобретения субъединица Fc-домена, содержащая модификацию, приводящую к получению «выступа», дополнительно содержит аминокислотную замену S354C, а субъединица Fc-домена, содержащая модификацию, приводящую к получению «впадины», дополнительно содержит аминокислотную замену Y349C. Интродукция этих двух остатков цистеина приводит к образованию дисульфидного мостика между двумя субъединицами Fc-домена, дополнительно стабилизирующего димер (Carter, J Immunol Methods 248, 2001, cc. 7-15). Нумерация аминокислотных остатков в Fc-области или константном участке соответствует системе EU-нумерации, которую называют также EU-индекс, описанной у Kabat и до., Sequences of Proteins of Immunological Interest, 5-ое изд., изд-во Public Health Service, National Institutes of Health, Bethesda, MD, 1991. Понятие «субъединица» Fc-домена в контексте настоящего описания относится к одному из двух полипептидов, образующих димерный Fc-домен, т.е. к полипептиду, который содержит С-концевые константные области тяжелой цепи иммуноглобулина, обладающие способностью к стабильной самоассоциации. Например, субъединица Fc-домена IgG содержит константные домены СН2 IgG и СН3 IgG.

В альтернативном варианте осуществления изобретения модификация, усиливающая гетеродимеризацию двух неидентичных полипептидных цепей, представляет собой модификацию, опосредующую определяемые электростатическими силами воздействия, например, описанные в WO 2009/089004. В целом, указанный метод включает замену одного или нескольких аминокислотных остатков на поверхности раздела двух полипептидных цепей на заряженные аминокислотные остатки, в результате чего образование гомодимера становится электростатически невыгодным, а гетеродимеризация становится электростатически выгодной.

Мутант IL-2, обладающий пониженной аффинностью связывания с субъединицей IL-2-рецептора, может быть слит с карбоксиконцевой аминокислотой субъединицы Fc-домена, которая содержит модификацию, приводящую к образования «выступа». Не вдаваясь в какую-либо теорию, слияние мутанта IL-2 с содержащей «выступ» субъединицей Fc-домена должно дополнительно минимизировать образование гомодимерных иммуноконъюгатов, содержащих два мутантных полипептида IL-2 (стерическое «столкновение» двух содержащих «выступ» полипептидов).

Можно создавать Fc-домен иммуноцитокина, который обладает измененной аффинностью связывания с Fc-рецептором, в частности, измененной аффинностью связывания с Fcγ-рецептором, по сравнению с не подвергнутым инженерии Fc-доменом, согласно методу, описанному в WO 2012/146628. Можно изменять связывание Fc-домена с компонентом системы комплемента, в частности, C1q, согласно методу, описанному в WO 2012/146628. Fc-домен придает иммуноконъюгату предпочтительные фармакокинетические свойства, включая продолжительное время полужизни в сыворотке, что обеспечивает хорошее накопление в ткани-мишени и предпочтительное соотношение распределений в ткани-крови. Однако в то же время он может приводить к нежелательному таргетингу иммуноконъюгата к клеткам, которые экспрессируют Fc-рецепторы, а не предпочтительным несущим антиген клеткам. Кроме того, совместная активация путей передачи сигналов Fc-рецептора может приводить к высвобождению цитокинов, что в сочетании с эффекторным фрагментом и продолжительным временем полужизни иммуноконъюгата, приводит к избыточной активации цитокиновых рецепторов и серьезным побочным действиям при системном введении. В соответствии с этим описано, что с иммуноконъюгатами, содержащими канонический IgG-IL-2, связаны реакции на инфузию (см., например, King и др., J Clin Oncol 22, 2004, сс. 4463-4473).

Таким образом, можно создавать Fc-домен иммуноцитокина, который обладает пониженной аффинностью связывания с Fc-рецептором. В одном из таких вариантов осуществления изобретения Fc-домен содержит одну или несколько аминокислотных мутаций, которые снижают аффинность связывания Fc-домена с Fc-рецептором. Как правило, одна или несколько одинаковых аминокислотных мутаций присутствует(ют) в каждой из двух субъединиц Fc-домена. В одном из вариантов осуществления изобретения указанная аминокислотная мутация снижает аффинность связывания Fc-домена с Fc-рецептором по меньшей мере в 2 раза, по меньшей мере в 5 раз или по меньшей мере в 10 раз. Согласно вариантам осуществления изобретения, в которых имеет место более одной аминокислотной мутации, которые снижают аффинность связывания Fc-домена с Fc-рецептором, комбинация указанных аминокислотных мутаций может снижать аффинность связывания Fc-домена с Fc-рецептором по меньшей мере в 10 раз, по меньшей мере в 20 раз или по меньшей мере в 50 раз. В одном из вариантов осуществления изобретения иммуноконъюгат, содержащий сконструированный Fc-домен, характеризуется аффинностью, составляющей менее чем 20%, в частности, менее чем 10%, более предпочтительно менее чем 5% от аффинности связывания с Fc-рецептором, характерной для иммуноконъюгата, содержащего не подвергнутый инженерии Fc-домен. В одном из вариантов осуществления изобретения Fc-рецептор представляет собой активирующий Fc-рецептор. В конкретном варианте осуществления изобретения Fc-рецептор представляет собой Fcγ-рецептор, более конкретно FcγRIIIa-, FcγRI- или FcγRIIa-рецептор. Предпочтительно уменьшается связывание с каждым из этих рецепторов. Согласно некоторым вариантам осуществления изобретения снижается также аффинность связывания с компонентом системы комплемента, в частности, аффинность связывания с C1q. Согласно одному из вариантов осуществления изобретения не снижается аффинность связывания с неонатальным Fc-рецептором (FcRn). Практически такое же связывание с FcRn, т.е. сохранение аффинности связывания Fc-домена с указанным рецептором, достигается, когда Fc-домен (или иммуноконъюгат, содержащий указанный Fc-домен) характеризуется аффинностью связывания с FcRn, составляющей более чем примерно 70% от аффинности связывания с FcRn не подвергнутого инженерии Fc-домена (или иммуноконъюгата, содержащего указанную не подвергнутую инженерии форму Fc-домена). Fc-домены или иммуноконъюгаты, содержащие указанные Fc-домены, могут характеризоваться аффинностью, составляющей более чем примерно 80% и даже более чем примерно 90% от указанной выше аффинности. В одном из вариантов осуществления изобретения аминокислотная мутация представляет собой аминокислотную замену. В одном из вариантов осуществления изобретения Fc-домен содержит аминокислотную замену в положении Р329. В более конкретном варианте осуществления изобретения аминокислотная замена представляет собой Р329А или P329G, прежде всего P329G. В одном из вариантов осуществления изобретения Fc-домен содержит дополнительную аминокислотную замену в положении, выбранном из S228, Е233, L234, L235, N297 и Р331. В более конкретном варианте осуществления изобретения дополнительная аминокислотная замена представляет собой S228P, Е233Р, L234A, L235A, L235E, N297A, N297D или P331S. В конкретном варианте осуществления изобретения Fc-домен содержит аминокислотные замены в положениях Р329, L234 и L235. В более конкретном варианте осуществления изобретения Fc-домен содержит аминокислотные мутации L234A, L235A и P329G (LALA P329G). Такая комбинация аминокислотных замен практически полностью аннулирует связывание с Fcγ-рецептором Fc-домена человеческого IgG, что описано в WO 2012/130831, которая полностью включена в настоящее описание в качестве ссылки. В WO 2012/130831 описаны также методы получения указанных мутантных Fc-доменов и методы определения их свойств, таких как связывание с Fc-рецептором или эффекторные функции. Нумерация аминокислотных остатков в Fc-области или константном участке соответствует системе EU-нумерации, которую называют также EU-индекс, описанной у Kabat и до., Sequences of Proteins of Immunological Interest, 5-ое изд., изд-во Public Health Service, National Institutes of Health, Bethesda, MD, 1991.

Мутантные Fc-домены можно получать путем аминокислотной делеции, замены, инсерции или модификации, используя генетические или химические методы, хорошо известные в данной области и описанные, например, в WO 2012/146628. Генетические методы могут включать сайтспецифический мутагенез кодирующей последовательности ДНК, ПЦР, синтез генов и т.п. Правильность нуклеотидных замен можно подтверждать, например, секвенированием.

В одном из вариантов осуществления изобретения Fc-домен конструируют так, чтобы он обладал пониженной эффекторной функцией по сравнению с не подвергнутым инженерии Fc-доменом согласно методу, описанному в WO 2012/146628. Пониженная эффекторная функция может представлять собой (но не ограничиваясь только ими) пониженную(ые) одну или несколько из следующих функций: пониженная комплементзависимая цитотоксичность (CDC), пониженная антитело-обусловленная клеточнозависимая цитотоксичность(АВСС), пониженный антитело-обусловленный клеточнозависимый фагоцитоз (ADCP), пониженная секреция цитокинов, пониженное опосредованное иммунным комплексом поглощение антигена антигенпрезентирующими клетками, пониженное связывание с NK-клетками, пониженное связывание с макрофагами, пониженное связывание с моноцитами, пониженное связывание с полиморфоядерными клетками, пониженная непосредственная передача сигнала, индуцирующего апоптоз, пониженное перекрестное связывание связанных с мишенью антител, пониженное созревание дендритных клеток или пониженное Т-клеточное примирование.

Антитела подтипа IgG4 обладают пониженной аффинностью к связыванию с Fc-рецепторами и пониженными эффекторными функциями по сравнению с антителами подтипа IgG1. Таким образом, в некоторых вариантах осуществления изобретения Fc-домен Т-клеточных активирующих биспецифических антигенсвязывающих молекул, предлагаемых в изобретении, представляет собой Fc-домен IgG4, в частности Fc-домен человеческого IgG4. В одном из вариантов осуществления изобретения Fc-домен IgG4 содержит аминокислотные замены в положении S228, конкретно аминокислотную замену S228P. Для дополнительного снижения аффинности связывания с Fc-рецептором и/или его эффекторной функции в одном из вариантов осуществления изобретения Fc-домен IgG4 содержит аминокислотную замену в положении L235, прежде всего аминокислотную замену L235E. В другом варианте осуществления изобретения Fc-домен IgG4 содержит аминокислотную замену в положении Р329, прежде всего аминокислотную замену P329G. В конкретном варианте осуществления изобретения Fc-домен IgG4 содержит аминокислотные замены в положениях S228, L235 и Р329, прежде всего аминокислотные замены S228P, L235E и P329G. Указанные мутанты Fc-домена IgG4 и их особенности связывания с Fcγ-рецептором описаны в заявке на европейский патент WO 2012/130831, которая полностью включена в настоящее описание в качестве ссылки.

Антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, которая указана в настоящем описании, выбирают из группы, состоящей из:

243.55.S70, 243.55.Н1, 243.55.Н12, 243.55.Н37, 243.55.Н70, 243.55.Н89, 243.55.S1, 243.55.5, 243.55.8, 243.55.30, 243.55.34, 243.55.S37, 243.55.49, 243.55.51, 243.55.62 и 243.55.84.

Эти антитела описаны в WO 2010/77634 (последовательности представлены на фиг. 11 WO 2010/77634) и отличаются тем, что содержат следующие последовательности VH и VL, указанные в настоящем описании:

В одном из вариантов осуществления изобретения нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110,

и

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В одном из вариантов осуществления изобретения нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3; или

б) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

в) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В одном из вариантов осуществления изобретения нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3.

В одном из вариантов осуществления изобретения нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88.

В одном из вариантов осуществления изобретения нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110.

В одном из вариантов осуществления изобретения нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3.

В одном из вариантов осуществления изобретения нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106.

В одном из вариантов осуществления изобретения антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

В предпочтительном варианте осуществления изобретения нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, и

антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

В предпочтительном варианте осуществления изобретения нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, указанной в настоящем описании, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, и

антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

В контексте настоящего описания понятие «антитело» используется в его наиболее широком смысле, и оно относится к различным структурам антител, включая (но не ограничиваясь только ими) моноклональные антитела, поликлональные антитела и фрагменты антител, при условии, что они обладают требуемой антигенсвязывающей активностью.

Понятие «фрагмент антитела» относится к молекуле, отличной от интактного антитела, которая содержит часть интактного антитела, которая связывается с антигеном, с которым связывается интактное антитело. Примерами фрагментов антител являются (но не ограничиваясь только ими) Fv, Fab, Fab', Fab'-SH, F(ab')2, димерные антитела, линейные антитела, одноцепочечные молекулы антител (например, scFv) и однодоменные антитела. Обзор некоторых фрагментов антител см., например, у Hudson и др., Nat Med 9, 2003, сс.129-134. Обзор scFv-фрагментов см., например, у в: The Pharmacology of Monoclonal Antibodies, т. 113, под ред. Rosenburg и Moore, изд-во Springer-Verlag, New York, 1994, сс. 269-315; см. также WO 93/16185; и US 5571894 и 5587458. Обсуждение Fab- и F(ab')2-фрагментов, содержащих остатки эпитопа, связывающегося с рецептором спасения, и обладающих удлиненным временем полужизни in vivo, см. в US 5869046. Димерные антитела представляют собой фрагменты антител с двумя антигенсвязывающими сайтами, которые могут быть двухвалентными или биспецифическими (см., например, ЕР 404097; WO 1993/01161; Hudson и др., Nat Med 9, 2003, сс. 129-134; и Hollinger и др., Proc Natl Acad Sci USA 90, 1993, сс. 6444-6448. Тримерные (триабоди) и тетрамерные (тетрабоди) антитела описаны также у Hudson и др., Nat Med 9, 2003, сс. 129-134. Однодоменные антитела представляют собой фрагменты антител, содержащие весь вариабельный домен тяжелой цепи или его часть или весь вариабельный домен легкой цепи антитела или его часть. В некоторых вариантах осуществления изобретения однодоменное антитело представляет собой человеческое однодоменное антитело (фирма Domantis, Inc., Waltham М.А.; см., например, US 6248516 В1). Фрагменты антител можно создавать с помощью различных методик, включая (но не ограничиваясь только ими) протеолитическое расщепление интактного антитела, а также получать с использованием рекомбинантных клеток-хозяев (например, Е. coli или фага), как указано в настоящем описании.

Понятие «антигенсвязывающий домен» или «антигенсвязывающий участок антитела» в контексте настоящего описания относится к части антитела, которая содержит область, специфически связывающуюся и являющуюся комплементарной части антигена или полному антигену. Таким образом, понятие относится к аминокислотным остаткам антитела, которые ответственны за связывания антигена. Антигенсвязывающий домен может представлять собой, например, один или несколько вариабельных доменов антитела (которые называют также вариабельными областями антитела). Прежде всего, антигенсвязывающий домен содержит вариабельную область легкой цепи (VL) антитела и вариабельную область тяжелой цепи (VH) антитела. Антигенсвязывающий участок антитела содержит аминокислотные остатки из «гипервариабельных участков» или «CDR». «Каркасные» или «FR»-участки представляют собой участки вариабельного домена, остатки которых отличны от остатков гипервариабельного участка, как они определены в настоящем описании. Таким образом, вариабельные домены легких и тяжелых цепей антитела содержат в направлении от N- к С-концу домены FR1, CDR1, FR2, CDR2, FR3, CDR3 и FR4. CDR3 тяжелой цепи представляет собой основной участок, который обеспечивает главным образом связывание с антигеном и определяет свойства антитела. К CDR- и FR-участкам относятся участки, которые определяют согласно стандартному принципу Кэбота и др. (Sequences of Proteins of Immunological Interest, 5-ое изд., изд-во Public Health Service, National Institutes of Health, Bethesda, MD, 1991) и/или остатки из «гипервариабельной петли».

Понятие «вариабельная область» или «вариабельный домен» относится к домену тяжелой или легкой цепи антитела, который участвует в связывании антитела с антигеном. Вариабельные домены тяжелой цепи и легкой цепи (VH и VL соответственно) нативного антитела, как правило, имеют сходные структуры, при этом каждый домен содержит четыре консервативных каркасных участка (FR) и три гипервариабельных участка (HVR) (см., например, Kindt и др., Kuby Immunology, 6-ое изд., изд-во W.H. Freeman and Co., 2007, с.91). Одного VH- или VL-домена может быть достаточно для обеспечения специфичности связывания антигена.

Понятие «эпитоп» относится к белковой детерминанте антигена, такого как СЕА или человеческий PD-L1, которая обладает способностью специфически связываться с антителом. Эпитопы, как правило, состоят из химически активных поверхностных групп молекул, таких как аминокислоты или боковые цепи Сахаров, и, как правило, эпитопы имеют специфические трехмерные структурные характеристики, а также специфические характеристики заряда. Конформационные и неконформационные эпитопы различаются тем, что связывание с первыми, в отличие от связывания с последними, утрачивается в присутствии денатурирующих растворителей.

В контексте настоящего описания понятие «Fc-домен» или «Fc-область» относится к С-концевой области тяжелой цепи иммуноглобулина, которая содержит по меньшей мере часть константной области. Понятие относится к нативной последовательности Fc-областей и вариантам Fc-областей. Хотя пограничные последовательности Fc-области в тяжелой цепи IgG могут слегка варьироваться, как правило, Fc-область тяжелой цепи человеческого IgG простирается от Cys226 или от Pro230 до карбоксильного конца тяжелой цепи. Однако С-концевой лизин (Lys447) Fc-области может либо присутствовать, либо отсутствовать. Если специально не указано иное, то нумерация аминокислотных остатков в Fc-области или константном участке соответствует системе EU-нумерации, которую называют также EU-индекс, описанной у Kabat и до., Sequences of Proteins of Immunological Interest, 5-ое изд., изд-во Public Health Service, National Institutes of Health, Bethesda, MD, 1991. Fc-домен антитела не участвует непосредственно в связывании антитела с антигеном, но обладает различными эффекторными функциями. Понятие «Fc-домент антитела» хорошо известно специалисту в данной области и его определяют на основе расщепления антител папаином. В зависимости от аминокислотной последовательности константной области тяжелых цепей антитела или иммуноглобулины разделяют на следующие классы: IgA, IgD, IgE, IgG и IgM и некоторые из них можно дополнительно подразделять на подклассы (изотипы), например, IgG1, IgG2, IgG3 и IgG4, IgA1 и IgA2. На основе строения константных областей тяжелых цепей различные классы иммуноглобулинов обозначают как α, δ, ε, γ и μ соответственно. Fc-фрагмент антител непосредственно участвует в ADCC (антитело-обусловленная клеточнозависимая цитотоксичность) и CDC (комплементзависимая цитотоксичность) в результате активации комплемента, связывания C1q и связывания Fc-рецептора. Активация комплемента (CDC) инициируется связыванием фактора системы комплемента C1q с Fc-доменом большинства антител подклассов IgG. Хотя влияние антитела на систему комплемента зависит от определенных условий, связывание с С1q обусловлено определенными сайтами связывания в Fc-домене. Такие сайты связывания известны в данной области и описаны, например, у Boakle R.J. и др., Nature 282, 1979, сс.742-743; Lukas T.J. и др., J. Immunol. 127, 1981, сс.2555-2560; Brunhouse R. и Cebra J.J., Mol. Immunol. 16, 1979, сс. 907-917; Burton D.R. и др., Nature 288, 1980, сс.338-344; Thommesen J.E. и др., Mol. Immunol. 37, 2000, сс.995-1004; Idusogie E.E. и др., J. Immunol. 164, 2000, сс.4178-4184; Hezareh M. И др., J. Virology 75, 2001, cc. 12161-12168; Morgan А. и др., Immunology 86, 1995, сс.319-324; ЕР 0307434. Указанные сайты связывания представляют собой, например, L234, L235, D270, N297, Е318, K320, K322, Р331 и Р329 (нумерация согласно EU-нумерации по Кэботу, см. выше). Антитела подклассов IgG1, IgG2 и IgG3, как правило, обусловливают активацию комплемента и связывание C1q и С3, в то время как IgG4 не активирует систему комплемента и не связывается с C1q и С3.

В одном из вариантов осуществления изобретения представляющий собой антитело компонент иммуноцитокина, указанный в настоящем описании, содержит Fc-домен человеческого происхождения и предпочтительно все остальные участки человеческих константных областей. В контексте настоящего описания понятие «Fc-домен человеческого происхождения» относится к Fc-домену, который представляет собой либо Fc-домен человеческого антитела подкласса IgG1, IgG2, IgG3 или IgG4, предпочтительно Fc-домен человеческого подкласса IgG1, либо мутантный Fc-домен человеческого подкласса IgG1 (в одном из вариантов осуществления изобретения с мутацией L234A+L235A), либо Fc-домен человеческого подкласса IgG4, либо мутантный Fc-домен человеческого подкласса IgG4 (в одном из вариантов осуществления изобретения с мутацией S228P). В одном из предпочтительных вариантов осуществления изобретения константная область человеческой тяжелой цепи имеет SEQ ID NO: 58 (человеческий подкласс IgG1), в другом предпочтительном варианте осуществления изобретения константная область человеческой тяжелой цепи имеет SEQ ID NO: 59 (человеческий подкласс IgG1 с мутациями L234A и L235A), в другом предпочтительном варианте осуществления изобретения константная область человеческой тяжелой цепи имеет SEQ ID NO: 60 (человеческий подкласс IgG4), и еще в одном предпочтительном варианте осуществления изобретения константная область человеческой тяжелой цепи имеет SEQ ID NO: 61 (человеческий подкласс IgG4 с мутацией S228P). В одном из вариантов осуществления изобретения указанные антитела обладают пониженной или минимальной эффекторной функцией. В одном из вариантов осуществления изобретения минимальная эффекторная функция является результатом мутации Fc, приводящей к снижению эффекторной функции («effectorless»). В одном из вариантов осуществления изобретения «effectorless»-мутация Fc представляет собой L234A/L235A или L234A/L235A/P329G, или N297A, или D265A/N297A. В одном из вариантов осуществления изобретения «effectorless»-мутацию Fc выбирают для каждого из антител независимо друг от друга из группы, содержащей (состоящей из) L234A/L235A, L234A/L235A/P329G, N297A и D265A/N297A ((EU-нумерация).

В одном из вариантов осуществления изобретения антитела, представляющие собой компоненты иммуноцитокинов, или антитела, указанные в настоящем описании, представляют собой человеческий иммуноглобулин IgG-класса (т.е. подкласса IgG1, IgG2, IgG3 или IgG4).

В предпочтительном варианте осуществления изобретения антитела, представляющие собой компоненты иммуноцитокинов, или антитела, указанные в настоящем описании, представляют собой человеческий иммуноглобулин подкласса IgG1 или человеческий иммуноглобулин подкласса IgG4. В предпочтительном варианте осуществления изобретения антитела, представляющие собой компоненты иммуноцитокинов, или антитела, указанные в настоящем описании, представляют собой человеческий иммуноглобулин подкласса IgG4.

В одном из вариантов осуществления изобретения антитело, представляющее собой компонент иммуноцитокина, или антитело, указанное в настоящем описании, отличается тем, что содержит человеческие константные цепи. Указанные константные цепи хорошо известны в данной области и описаны, например, у Kabat Е.А. (см., например, Johnson G. и Wu, Т.Т., Nucleic Acids Res., 28, 2000, сс.214-218). Например, приемлемая человеческая константная область тяжелой цепи содержит аминокислотную последовательность SEQ ID NO: 114. Например, приемлемая человеческая константная область легкой цепи содержит аминокислотную последовательность константной области легкой каппа-цепи SEQ ID NO: 113.

Понятия «нуклеиновая кислота» или «молекула нуклеиновой кислоты» в контексте настоящего описания относятся к молекулам ДНК и молекулам РНК. Молекула нуклеиновой кислоты может быть одноцепочечной или двухцепочечной, но предпочтительно представляет собой двухцепочечную ДНК.

Понятие «аминокислота» в контексте настоящего описания обозначает группу встречающихся в естественных условиях карбокси-α-аминокислот, таких как аланин (трехбуквенный код: ala, однобуквенный код: А), аргинин (arg, R), аспарагин (asn, N), аспарагиновая кислота (asp, D), цистеин (cys, С), глутамин (gln, Q), глутаминовая кислота (glu, Е), глицин (gly, G), гистидин (his, Н), изолейцин (ile, I), лейцин (leu, L), лизин (lys, K), метионин (met, М), фенилаланин (phe, F), пролин (pro, Р), серин (ser, S), треонин (thr, Т), триптофан (trp, W), тирозин (tyr, Y) и валин (val, V).

«Процент (%) идентичности аминокислотной последовательности» относительно полипептидной референс-последовательности определяют как процент аминокислотных остатков в последовательности-кандидате, которые идентичны аминокислотным остаткам в полипептидной референс-последовательности, после выравнивания последовательностей и интродукции при необходимости брешей для достижения максимального процента идентичности последовательностей, и при этом какие-либо консервативные замены не учитываются при оценке идентичности последовательностей. Сравнительный анализ для определения процента идентичности аминокислотных последовательностей можно осуществлять различными путями, которые находятся в компетенции специалиста в данной области, например, с использованием публично доступных компьютерных программ, таких как программа BLAST, BLAST-2, ALIGN или Megalign (DNASTAR). Специалисты в данной области могут определять соответствующие параметры для выравнивания последовательностей, включая любые алгоритмы, необходимые для достижения максимального выравнивания по всей длине сравниваемых последовательностей. Однако для целей настоящего изобретения величину % идентичности аминокислотных последовательностей получают с использованием предназначенной для сравнения последовательностей компьютерной программы ALIGN-2. Предназначенная для сравнения последовательностей компьютерная программа ALIGN-2 разработана фирмой Genentech, Inc., и исходный код помещен на хранение вместе с документацией для пользователя в U.S. Copyright Office, Washington D.C., 20559, где он зарегистрирован под регистрационным номером U.S. Copyright Registration №TXU510087. Программа ALIGN-2 представляет собой публично доступную программу фирмы Genentech, Inc., Южный Сан-Франциско, шт.Калифорния, или ее можно компилировать из исходного кода. Программу ALIGN-2 можно компилировать для применения в операционной системе UNIX, включая цифровую версию UNIX V4.0D. В программе ALIGN-2 все параметры для сравнения последовательностей являются заданными и не должны изменяться. В ситуациях, когда ALIGN-2 применяют для сравнения аминокислотных последовательностей, % идентичности аминокислотных последовательностей данной аминокислотной последовательности А относительно или по сравнению с данной аминокислотной последовательностью Б (которую другими словами можно обозначать как данная аминокислотная последовательность А, которая имеет или отличается определенным % идентичности аминокислотной последовательности относительно или по сравнению с данной аминокислотной последовательностью Б), рассчитывают следующим образом:

100 × частное X/Y,

где X обозначает количество аминокислотных остатков, оцененных программой сравнительного анализа последовательностей ALIGN-2 как идентичные совпадения при сравнительном анализе последовательностей А и Б с помощью указанной программы, и где Y обозначает общее количество аминокислотных остатков в Б. Должно быть очевидно, что, когда длина аминокислотной последовательности А не равна длине аминокислотной последовательности Б, то % идентичности аминокислотной последовательности А относительно аминокислотной последовательности Б не должен быть равен % идентичности аминокислотной последовательности Б относительно аминокислотной последовательности А. Если специально не указано иное, то в контексте настоящего описания все величины % идентичности аминокислотных последовательностей получают согласно процедуре, описанной в последнем из предшествующих параграфов, с помощью компьютерной программы ALIGN-2.

Под нуклеиновой кислотой или полинуклеотидом, имеющей/имеющим нуклеотидную последовательность, которая, например, на 95% «идентична» нуклеотидной референс-последовательности, предлагаемой в настоящем изобретении, подразумевается, что нуклеотидная последовательность полинуклеотида идентична референс-последовательности за исключением того, что полинуклеотидная последовательность может включать вплоть до 5 точечных мутаций на каждые 100 нуклеотидов нуклеотидной референс-последовательности. Другими словами, для получения полинуклеотида, имеющего нуклеотидную последовательность, которая идентична по меньшей мере на 95% нуклеотидной референс-последовательности, вплоть до 5% нуклеотидов в референс-последовательности можно изымать путем делеции или заменять на другой нуклеотид, или вплоть до 5% нуклеотидов от общего количества нуклеотидов в референс-последовательности можно встраивать в референс-последовательность. Эти изменения референс-последовательности могут иметь место в положениях на 5'- или 3'-конце нуклеотидной референс-последовательности или в ином положении между этими концевыми положениями, и их встраивают либо индивидуально между остатками в референс-последовательности, либо их встраивают в референс-последовательность в виде одной или нескольких смежных групп. На практике решение вопроса о том, идентична ли конкретная полинуклеотидная последовательность по меньшей мере на 80%, 85%, 90%, 95%, 96%, 97%, 98% или 99% нуклеотидной последовательности, предлагаемой в настоящем изобретении, можно решать, как правило, с использованием известных компьютерных программ, например, указанных выше для полипептидов (например, ALIGN-2).

Понятие «кассета экспрессии» относится к полинуклеотиду, полученному с помощью рекомбинации или синтеза, который содержит серии специфических нуклеотидных элементов, которые обеспечивают транскрипцию конкретной нуклеиновой кислоты в клетке-мишени. Рекомбинантную кассету экспрессии можно встраивать в плазмиду, хромосому, митохондриальную ДНК, пластидную ДНК, вирус или фрагмент нуклеиновой кислоты. Как правило, рекомбинантная кассета экспрессии, представляющая собой часть экспрессионного вектора, включает среди прочих последовательностей подлежащую транскрипции нуклеотидную последовательность и промотор. В некоторых вариантах осуществления изобретения кассета экспрессии, предлагаемая в изобретении, содержит полинуклеотидные последовательности, которые кодируют полипептиды, предлагаемые в изобретении, или их фрагменты.

Понятие «вектор» или «экспрессионный вектор» является синонимом понятия «экспрессионная конструкция» и относится к молекуле ДНК, которую применяют для интродукции и обеспечения экспрессии конкретного гена, с которой он функционально связан, в клетке-мишени. Понятие включает вектор, представляющий собой самореплицирующуюся структуру нуклеиновой кислоты, а также вектор, встроенный в геном клетки-хозяина, в которую он интродуцирован. Экспрессионный вектор, предлагаемый в настоящем изобретении, содержит кассету экспрессии. Экспрессионные векторы позволяют осуществлять транскрипцию стабильной мРНК в больших количествах. Когда экспрессионный вектор находится внутри клетки-мишени, то молекула рибонуклеиновой кислоты или белок, который кодируется геном, продуцируется в результате клеточного механизма транскрипции и/или трансляции. В одном из вариантов осуществления изобретения экспрессионный вектор, предлагаемый в изобретении, содержит кассету экспрессии, которая включает полинуклеотидные последовательности, которые кодируют полипептиды, предлагаемые в изобретении, или их фрагменты.

Понятие «искусственный» относится к синтетической или не полученной из клетки-хозяина композиции, например, к синтезированному химически олигонуклеотиду.

В контексте настоящего описания понятия «клетка-хозяин», «линия клеток-хозяев» и «культура клеток-хозяев» используются взаимозаменяемо, и они относятся к клеткам, в которые интродуцирована экзогенная нуклеиновая кислота, включая потомство указанных клеток. К клеткам-хозяевам относятся «трансформанты» и «трансформированные клетки», которые включают первичные трансформированные клетки, а также потомство, выведенное из них, независимо от количества пересевов. Потомство может не быть строго идентичным родительской клетке по составу нуклеиновых кислот, а может нести мутации. Под данное понятие подпадает мутантное потомство, которое обладает такой же функцией или биологической активностью, что и отобранная путем скрининга или селекции исходная трансформированная клетка. Клетка-хозяин представляет собой клеточную систему любого типа, которую можно применять для создания полипептидов, предлагаемых в настоящем изобретении. В одном из вариантов осуществления изобретения клетку-хозяина конструируют так, чтобы можно было получать иммуноконъюгат с модифицированными олигосахаридами в его Fc-области. В некоторых вариантах осуществления изобретения клетки-хозяева можно подвергать манипуляциям для экспрессии повышенных уровней одного или нескольких полипептидов, обладающих активностью β(1,4)-N-ацетилглюкозамилтрансферазы III (GnTIII). В некоторых вариантах осуществления изобретения клетки-хозяева подвергают дополнительным манипуляциям для экспрессии повышенных уровней одного или нескольких полипептидов, обладающих активностью α-маннозидазы II (ManII). Клетки-хозяева включают культивируемые клетки, например, культивируемые клетки млекопитающих, такие как (но не ограничиваясь только ими) СНО-клетки, ВНK-клетки, NSO-клетки, SР2/0-клетки, клетки миеломы линии YO, клетки мышиной миеломы линий Р3Х63, PER-клетки, PER.-С6-клетки или клетки гибридомы, клетки дрожжей, клетки насекомых и клетки растений, но также клетки, находящиеся в трансгенном животном, трансгенном растении или в культивируемой растительной или животной ткани.

Нацеленные на опухоль иммуноцитокины, содержащие вариант IL-2, указанные в настоящем описании, можно получать, например, путем твердофазного пептидного синтеза (например, твердофазный синтез Меррифилда) или методом рекомбинации. Для рекомбинантного получения один или. несколько полинуклеотидов, кодирующих иммуноцитокин (фрагмент), например, описанный выше, выделяют и встраивают в один или несколько векторов для дополнительного клонирования и/или экспрессии в клетке-хозяине. Указанный полинуклеотид легко выделять и секвенировать с помощью общепринятых процедур. Одним из вариантов осуществления изобретения является вектор, предпочтительно экспрессионный вектор, содержащий один или несколько полинуклеотидов, предлагаемых в изобретении. Методы, хорошо известные специалистам в данной области, можно применять для конструирования экспрессионных векторов, содержащих кодирующую последовательность иммуноцитокина (фрагмента) наряду с приемлемыми контролирующими транскрипцию/трансляцию сигналами. Эти методы включают технологии рекомбинантной ДНК in vitro, методы синтеза и рекомбинации/генетической рекомбинации in vivo (см., например, методы, описанные у Maniatis и др., Maniatis и др., Molecular Cloning A Laboratory Manual, изд-во Cold Spring Harbor Laboratory, N.Y., 1989; и Ausubel и др., Current Protocols in Molecular Biology, изд-во Greene Publishing Associates and Wiley Interscience, N.Y., 1989). Экспрессионный вектор может представлять собой часть плазмиды, вируса или может представлять собой фрагмент нуклеиновой кислоты. Экспрессионный вектор включает кассету экспрессии, в которой полинуклеотид, кодирующий иммуноцитокин (фрагмент) (т.е. кодирующую область), клонируют с обеспечением функциональной связи с промотором и/или другими элементами, контролирующими транскрипцию или трансляцию. В контексте настоящего описания «кодирующая область» представляет собой часть нуклеиновой кислоты, которая состоит из кодонов, транслируемых в аминокислоты. Хотя «стоп-кодон» (TAG, TGA или ТАА) не транслируется в аминокислоту, он, в случае его присутствия, может рассматриваться как часть кодирующей области, однако любые фланкирующие последовательности, например, промоторы, сайты связывания рибосом, терминаторы транскрипции, интроны, 5'- и 3'-нетранслируемые области и т.п., не являются частью кодирующей области. Две или большее количество кодирующих областей может присутствовать в индивидуальной полинуклеотидной конструкции, например, индивидуальном векторе, или в отдельных полинуклеотидных конструкциях, например, отдельных (различных) векторах. Кроме того, любой вектор может содержать одну кодирующую область или может содержать две или большее количество кодирующих областей, например, вектор, предлагаемый в настоящем изобретении, может кодировать один или несколько полипептидов, которые пост- или котранляционно разделяются на конечные белки посредством протеолитического расщепления. Кроме того, вектор, полинуклеотид или нуклеиновая кислота, предлагаемый/предлагаемая в изобретении, может кодировать гетерологичные кодирующие области, либо слитые, либо не слитые с полинуклеотидом, который кодирует иммуноцитокин (фрагмент), предлагаемый в изобретении, или его вариант или производное. Гетерологичные кодирующие области включают (но не ограничиваясь только ими) специализированные элементы или мотивы, такие как секреторный сигнальный пептид или гетерологичный функциональный домен. Функциональная связь имеет место, когда кодирующая область генного продукта, например, полипептида, ассоциирована с одной или несколькими регуляторными последовательностями таким образом, чтобы экспрессия генного продукта находилась под воздействием или контролем регуляторной(ых) последовательности(ей). Два ДНК-фрагмента (таких как кодирующая область полипептида и ассоциированный с ней промотор) являются «функционально связанными», если индукция промоторной функции приводит к транскрипции мРНК, кодирующей требуемый генный продукт, и если природа связи между двумя ДНК-фрагментами не оказывает воздействия на способность регулирующих экспрессию последовательностей направлять экспрессию генного продукта, или не оказывает воздействия на способность ДНК-матрицы к транскрипции. Таким образом, промоторная область должна быть функционально связана с нуклеиновой кислотой, кодирующей полипептид, если промотор обладает способностью осуществлять транскрипцию нуклеиновой кислоты. Промотор может представлять собой специфический для клетки промотор, который обеспечивает значительную транскрипцию ДНК только в предварительно отобранных клетках. Другие контролирующие транскрипцию элементы, помимо промотора, например, энхансеры, операторы, репрессоры и сигналы терминации транскрипции, можно функционально связывать с полинуклеотидом для обеспечения специфической для клетки транскрипции. Приемлемые промоторы и другие контролирующие транскрипцию области представлены в настоящем описании. Специалистам в данной области известно широкое разнообразие контролирующих транскрипцию областей. Они включают (но не ограничиваясь только ими) контролирующие транскрипцию области, которые функционируют в клетках позвоночных животных, такие как (но не ограничиваясь только ими) сегменты промоторов и энхансеров из цитомегаловирусов (например, немедленно-ранний промотор в сочетании с интроном-А), обезьяньего вируса 40 (например, ранний промотор) и ретровирусов (таких как вирус саркомы Рауса). Другие контролирующие транскрипцию области включают области, выведенные из генов позвоночных животных, таких как ген актина, белка теплового шока, бычьего гормона роста и кроличьего β-глобина, а также другие последовательности, которые могут контролировать экспрессию генов в эукариотических клетках. Дополнительные приемлемые контролирующие транскрипцию области включают тканеспецифические промоторы и энхансеры, а также индуцибельные промоторы (например, промоторы, индуцируемые тетрациклином). Аналогично этому, обычным специалистам в данной области известно широкое разнообразие контролирующих трансляцию элементов. Они включают (но не ограничиваясь только ими) сайты связывания рибосом, кодоны инициации трансляции и терминирующие кодоны и элементы, выведенные из вирусных систем (в частности внутренний сайт связывания (посадки) рибосом или IRES, который обозначают также как CITE-последовательность). Кассета экспрессии может включать также другие характерные структуры, такие как сайт инициации репликации и/или интегрированные в хромосому элементы, такие как длинные концевые повторы (LTR) ретровирусов, или инвертированные концевые повторы (ITR) аденоассоциированного вируса (AAV).

Кодирующие области полинуклеотида и нуклеиновой кислоты, предлагаемые в настоящем изобретении, могут быть ассоциированы с дополнительными кодирующими областями, которые кодируют секреторные или сигнальные пептиды, которые направляют секрецию полипептида, кодируемого полинуклеотидом. Например, если требуется секреция иммуноцитокина, то ДНК, кодирующая сигнальную последовательность, можно помещать против хода транскрипции относительно нуклеиновой кислоты, кодирующей иммуноцитокины, предлагаемые в изобретении, или их фрагмент. Согласно гипотезе, касающейся сигналов, белки, секретируемые клетками млекопитающих, имеют сигнальный пептид или секреторную лидерную последовательность, который/которая отщепляется от зрелого белка после инициации экспорта растущей белковой цепи через шероховатый эндоплазматический ретикулум. Обычным специалистам в данной области должно быть очевидно, что полипептиды, секретируемые клетками позвоночных животных, как правило, имеют сигнальный пептид, слитый с N-концом полипептида, который отщепляется от транслируемого полипептида с образованием секретируемой или «зрелой» формы полипептида. В некоторых вариантах осуществления изобретения используют нативный сигнальный пептид, например, сигнальный пептид тяжелой цепи или легкой цепи иммуноглобулина или функциональное производное указанной последовательности, которое сохраняет способность обеспечивать секрецию полипептида, функционально связанного с ним. Альтернативно этому, можно применять гетерологичный сигнальный пептид млекопитающих или его функциональное производное. Например, лидерную последовательность дикого типа можно заменять на лидерную последовательность человеческого тканевого активатора плазминогена (TPА) или мышиной β-глюкуронидазы. Примеры аминокислотных и полинуклеотидных последовательностей секреторных сигнальных пептидов представлены в SEQ ID NO: 115-123.

ДНК, кодирующую короткую белковую последовательность, которую можно применять для облегчения дальнейшей очистки (например, гистидиновую метку), или предназначенную для мечения иммуноциокина, можно включать внутрь или на концы полинуклеотида, кодирующего иммуноцитокин (фрагмент).

Дополнительным вариантом осуществления изобретения является клетка-хозяин, содержащая один или несколько полинуклеотидов, указанных в настоящем описании. Некоторыми вариантами осуществления изобретения является клетка-хозяин, содержащая один или несколько векторов, указанных в настоящем описании. Полинуклеотиды и векторы могут обладать любыми особенностями, индивидуально или в сочетании, указанными в настоящем описании касательно полинуклеотидов и векторов соответственно. В одном из таких вариантов осуществления изобретения клетка-хозяин содержит (например, трансформирована или трансфектирована) вектором, содержащим полинуклеотид, который кодирует (часть) иммуноцитокин, указанный в настоящем описании. В контексте настоящего описания понятие «клетка-хозяин» относится к любому типу клеточной системы, которую можно конструировать для получения иммуноцитокинов или их фрагментов. Клетки-хозяева, пригодные для репликации и для поддержания экспрессии иммуноцитокинов, хорошо известны в данной области. Такие клетки можно трансфектировать или трансдуцировать соответствующим образом конкретным экспрессионным вектором и можно выращивать большее количество содержащих вектор клеток с целью внесения в ферментеры для крупномасштабных процессов получения иммуноцитокина в достаточных для клинических применений количествах. Приемлемыми клетками-хозяевами являются прокариотические микроорганизмы, такие как Е. coli, или различные эукариотические клетки, такие как клетки яичника китайского хомячка (СНО), клетки насекомых или т.п.Например, полипептиды можно получать в бактериях, в частности, когда отсутствует потребность в гликозилировании. После экспрессии полипептид можно выделять из пасты бактериальных клеток в растворимую фракцию и можно дополнительно очищать. Помимо прокариот, в качестве хозяев для клонирования или экспрессии векторов, которые кодируют полипептид, можно использовать эукариотические микроорганизмы, такие как нитчатые грибы или дрожжи, включая штаммы грибов и дрожжей, пути гликозилирования которых были «гуманизированы», что позволяет получать полипептид с частично или полностью человеческой схемой гликозилирования (см. Gerngross, Nat. Biotech. 22, 2004, cc. 1409-1414 и Li и др., Nat. Biotech. 24, 2006, cc. 210-215). Клетки-хозяева, которые можно использовать для экспрессии (гликозилированных) полипептидов, получают также из многоклеточных организмов (беспозвоночных и позвоночных животных). Примерами клеток беспозвоночных являются клетки насекомых, а также можно применять клетки растений. Были выявлены многочисленные бакуловирусные штаммы и соответствующие пригодные для них в качестве хозяев клетки насекомых, прежде всего для трансфекции клеток Spodoptera frugiperda. В качестве хозяев можно применять также культуры растительных клеток (см., например, US 5959177, 6040498, 6420548, 7125978 и 6417429 (описание технологии PLANTIBODIES™ для получения антител в трансгенных растениях). В качестве хозяев можно применять также клетки позвоночных животных. Например, можно использовать клеточные линии млекопитающих, которые адаптированы к росту в суспензии. Другими примерами приемлемых линий клеток-хозяев млекопитающих являются линия клеток почки обезьяны СV1, трансформированная с помощью SV40 (COS-7); линия клеток почки эмбриона человека (293 или клетки линии 293, субклонированные с целью выращивания в суспензионной культуре, Graham и др., J. Gen. Virol., 36, 1977, с.59); клетки почки детеныша хомяка (ВНК); клетки Сертоли мыши (ТМ4-клетки, описанные, например, у Mather, Biol. Reprod., 23, 1980, cc. 243-251); клетки почки обезьяны (CV1); клетки почки африканской зеленой мартышки (VERO-76,); клетки карциномы шейки матки человека (HELA); клетки почки собаки (MDCK); клетки печени бычьей крысы (BRL 3А); клетки легкого человека (W138); клетки печени человека (Hep G2); клетки опухоли молочной железы мыши (ММТ 060562); клетки TRI, описанные, например, у Mather и др., Annals N.Y. Acad. Sci., 383, 1982, cc. 44-68); клетки MRC 5 и клетки FS4. Другими ценными линиями клеток-хозяев млекопитающих являются клетки яичника китайского хомячка (СНО), включая dhfr--CHO-клетки (Urlaub и др., Proc. Natl. Acad. Sci. USA, 77, 1980, с. 4216); и клеточные линии миеломы, такие как Y0, NS0 и Sp2/0. Обзор конкретных линий клеток-хозяев млекопитающих, которые можно применять для производства белка, см., например, у Yazaki и Wu, в: Methods in Molecular Biology под ред. B.K.C. Lo, изд-во Humana Press, Totowa, NJ, т.248, 2003, cc. 255-268. Клетки-хозяева включают культивируемые клетки, например, культивируемые клетки млекопитающих, клетки дрожжей, клетки насекомых, клетки бактерий и клетки растений (но не ограничиваясь только ими), а также клетки, находящиеся в организме трансгенного животного, трансгенного растения или культивируемой растительной или животной ткани. В одном из вариантов осуществления изобретения клетка-хозяин представляет собой эукариотическую клетку, предпочтительно клетку млекопитающего, такую как клетка яичника китайского хомячка (СНО), клетка почки человеческого эмбриона (НЕK) или лимфоидная клетка (например, клетка Y0, NS0, Sp20).

В данной области известны стандартные технологии для экспрессии чужеродных генов в этих системах. Клетки, экспрессирующие полипептид, содержащий либо тяжелую, либо легкую цепь антитела, можно конструировать таким образом, чтобы в них происходила экспрессия других цепей антитела, например, таким образом, чтобы экспрессируемый продукт представлял собой антитело, которое имеет как тяжелую, так и легкую цепь.

Одним из вариантов осуществления изобретения является способ получения иммуноцитокина, указанного в настоящем описании, заключающийся в том, что культивируют клетку-хозяина, содержащую полинуклеотид, который кодирует иммуноцитокин, представленный в настоящем описании, в условиях, пригодных для экспрессии иммуноцитокина, и необязательно выделяют иммуноцитокин из клетки-хозяина (или культуральной среды клетки-хозяина). Компоненты иммуноцитокина генетически сливают друг с другом. Иммуноцитокины можно создавать так, чтобы их компоненты сливать друг с другом непосредственно или косвенно через линкерную последовательность. Состав и длину линкера можно определять с помощью методов, хорошо известных в данной области, и можно оценивать эффективность. Примеры линкерных последовательностей, расположенных между эффекторным фрагментом и Fc-доменом, представлены в последовательностях SEQ ID NO: 69, 70, 71, 72, 73, 79, 82, 83 и 84. Можно включать также дополнительные последовательности для встраивания сайта расщепления, если требуется разделение индивидуальных компонентов слияния, например, последовательность, распознаваемую эндопептидазой.

Ииммуноцитокин содержит по меньшей мере вариабельную область антитела, обладающую способностью связываться с антигенной детерминантой. Вариабельные области могут образовывать часть встречающихся в естественных условиях или не встречающихся в естественных условиях антител или их фрагментов или могут быть получены из них. Методы получения поликлональных антител и моноклональных антител хорошо известны в данной области (см., например, Harlow и Lane, «Antibodies: a Laboratory Manual», изд-во Cold Spring Harbor Laboratory, 1988). He встречающиеся в естественных условиях антитела можно создавать с помощью твердофазного пептидного синтеза, можно получать с помощью методов рекомбинации (например, описанных в US 4186567) или можно получать, например, путем скрининга комбинаторных библиотек, содержащих вариабельные области тяжелых цепей и вариабельные области легких цепей (см., например, US 5969108 на имя McCafferty). Антигенсвязывающие фрагменты и методы их получения описаны также подробно в публикации РСТ WO 2011/020783, полное содержание которой включено в настоящее описание в качестве ссылки.

Любые виды антител, фрагментов антител, антигенсвязывающих доменов или вариабельных областей животного происхождения можно применять в иммуноцитокинах, указанных в настоящем описании. Примерами антител, фрагментов антител, антигенсвязывающих доменов или вариабельных областей, которые можно применять согласно настоящему изобретению, являются (но не ограничиваясь только ими) конструкции, полученные из организма мышей, приматов или человека. Если иммуноцитокин предназначен для применения на человеке, то можно применять химерную форму антитела, в которой константные области антитела получают из человеческого антитела. Гуманизированную или полностью человеческую форму антитела можно получать также с помощью методов, хорошо известных в данной области (см., например, US 5565332 на имя Winter). Для осуществления гуманизации можно применять различные методы, такие как (но не ограничиваясь только ими) (а) трансплантация нечеловеческих (например, из антитела-донора) CDR в человеческий (например, антитело-реципиент) каркасный участок и константные области, сохраняющие или не сохраняющие имеющие решающее значение остатки каркасного участка (например, остатки, важные для сохранения хорошей антигенсвязывающей аффинности или функций антитела), (б) трансплантация только нечеловеческих определяющих специфичность участков (SDR или а-CDR; остатки имеют решающее значение для взаимодействия антитело-антиген) в человеческий каркасный участок и константные области, или (в) трансплантация полных нечеловеческих вариабельных доменов, но их «маскировка» напоминающим человеческий сегментом путем замены поверхностных остатков. Обзор гуманизированных антител и методов их получения см., например, у Almagro и Fransson, Front Biosci 13, 12008, сс. 1619-1633, и они описаны также, например, у Riechmann и др., Nature 332, 1988, сс. 323-329; Queen и др., Proc Natl Acad Sci USA 86, 1989, сс. 10029-10033; US 821337, 7527791, 6982321 и 7087409; Jones и др., Nature 321, 1986, сс. 522-525; Morrison и др., Proc Natl Acad Sci 81, 1984, сс. 6851-6855; Morrison и Oi, Adv Immunol 44, 1988, cc. 65-92; Verhoeyen и др., Science 239, 1988, сс. 1534-1536; Padlan, Molec Immun 31(3), 1994, cc. 169-217; Kashmiri и др., Methods 36, 2005, cc. 25-34) (описание трансплантации SDR (a-CDR)); Padlan, Mol Immunol 28, 1991, cc. 489-498 (описание «повторного покрытия»); Dall'Acqua и др., Methods 36, 2005, сс. 43-60 (описание «перестановки FR») и Osbourn и др., Methods 36, 2005, сс. 61-68, и Klimka и др., Br J Cancer 83, 2000, сс. 252-260 (описание подхода на основе «целенаправленной селекции» для перестановки FR). Человеческие антитела и человеческие вариабельные области можно получать с помощью различных методик, известных в данной области. Человеческие антитела описаны в целом у van Dijk и van de Winkel, Curr Opin Pharmacol 5, 2001, cc. 368-374 и Lonberg, Curr Opin Immunol 20, 2008, cc. 450-459. Человеческие вариабельные области могут образовывать часть человеческих моноклональных антител или могут быть получены из них с помощью метода гибридом (см., например, Monoclonal Antibody Production Techniques and Applications, изд-во Marcel Dekker, Inc., New York, 1987, cc. 51-63). Человеческие антитела и человеческие вариабельные области можно получать также путем введения иммуногена трансгенному животному, которое модифицировано таким образом, что может продуцировать интактные человеческие антитела или интактные антитела с человеческими вариабельными областями в ответ на контрольное заражение антигеном (см., например, Lonberg, Nat Biotech 23, 2005, сс.1117-1125). Человеческие антитела и человеческие вариабельные области можно создавать также путем выделения последовательностей вариабельных областей Fv-клона, отобранных из человеческих фаговых дисплейных библиотек (см., например, Hoogenboom и др. в: Methods in Molecular Biology, под ред. O'Brien и др., изд-во Human Press, Totowa, NJ, 178, 2001, cc. 1-37); и McCafferty и др., Nature 348, 552-554; Clackson и др., Nature 352, 1991, cc. 624-628). Фаг, как правило, экспонирует фрагменты антител либо в виде одноцепочечных Fv- (scFv)-фрагментов, либо в виде Fab-фрагментов. Подробное описание получения антигенсвязывающих фрагментов для иммуноконъюгатов с помощью фагового дисплея представлено в примерах, прилагаемых к публикации РСТ WO 2011/020783.

В некоторых вариантах осуществления изобретения антитела создают так, чтобы они обладали повышенной аффинностью связывания, например, с помощью методов, описанных в публикации РСТ WO 2011/020783 (см. примеры, касающиеся созревания аффинности) или публикации заявки на патент США №2004/0132066, полное содержание которых включено в настоящее описание в качестве ссылки. Способность иммуноцитокина связываться со специфической антигенной детерминантой можно оценивать количественно либо с помощью твердофазного ферментного анализа (ELISA), либо другими методиками, известными специалисту в данной области, например, с помощью метода поверхностного плазмонного резонанса (осуществляя анализ с использованием системы BIACORE Т100) (Liljeblad и др., Glyco J 17, 2000, сс. 323-329), и традиционных анализов связывания (Heeley, Endocr Res 28, 2002, сс. 217-229). Анализы в условиях конкуренции можно применять для идентификации антитела, фрагмента антитела, антигенсвязывающего домена или вариабельного домена, конкурирующего с референс-антителом за связывание с конкретным антигеном, например, антитела, которое конкурирует с антителом СН1А1А 98/99 2F1 за связывание с СЕА. В некоторых вариантах осуществления изобретения указанное конкурирующее антитело связывается с тем же эпитопом (например, линейным или конформационным эпитопом), с которым связывается референс-антитело. Подробные приведенные в качестве примеров методы картирования эпитопа, с которым связывается антитело, представлены у Morris, «Epitope Mapping Protocols», в: Methods in Molecular Biology, изд-во Humana Press, Totowa, NJ, т. 66, 1996. При осуществлении приведенного в качестве примера анализа в условиях конкуренции иммобилизованный антиген (например, СЕА) инкубируют в растворе, содержащем первое меченое антитело, которое связывается с антигеном (например, антитело СН1А1А 98/99 2F1), и вторым немеченым антителом, которое подлежит тестированию в отношении его способности конкурировать с первым антителом за связывание с антигеном. Второе антитело может присутствовать в супернатанте гибридомы. В качестве контроля иммобилизованный антиген инкубируют в растворе, содержащем первое меченое антитело, но не содержащем второе немеченое антитело. После инкубации в условиях, обеспечивающих связывание первого антитела с антигеном, избыток несвязанного антитела удаляют и оценивают количество метки, ассоциированной с иммобилизованным антигеном. Если количество метки, ассоциированной с иммобилизованным антигеном, существенно снижено в тестируемом образце по сравнению с контрольным образцом, то это свидетельствует о том, что второе антитело конкурирует с первым антителом за связывание с антигеном (см. Harlow и Lane. Antibodies: A Laboratory Manual, изд-во Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, гл. 14, 1988).

Иммуноцитокины, полученные с помощью представленных в настоящем описании методов, можно очищать с использованием известных в данной области методик, таких как жидкостная хроматография высокого разрешения, ионообменная хроматография, гель-электрофорез, аффинная хроматография, гель-фильтрация и т.п.Фактические условия, применяемые для очистки конкретного белка, зависят, в частности, от таких факторов, как чистый заряд, гидрофобность, гидрофильность и т.д., и они должны быть очевидны специалисту в данной области. Для очистки антитела с помощью аффинной хроматографии можно использовать лиганд, рецептор или антиген, с которым связывается иммуноцитокин. Например, для очистки с помощью аффинной хроматографии иммуноцитокинов можно использовать матрикс с белком А или белком G. Последовательное использование аффинной хроматографии на белке А или G и гель-фильтрации можно применять для выделения иммуноконъюгата, практически согласно методу, описанному в разделе «Примеры» в WO 2012/146628. Чистоту иммуноцитокина можно определять с помощью любого из широкого разнообразия хорошо известных аналитических методов, включая гель-электрофорез, жидкостную хроматографию высокого давления и т.п.Например, установлено, что иммуноцитокины могут быть интактными и правильно собранными по данным ДСН-ПААГ в восстанавливающих условиях.

Нацеленные на опухоль иммуноцитокины, содержащие вариант IL-2, указанные в настоящем описании, такие как нацеленные на СЕА иммуноцитокины, содержащие вариант IL-2, и нацеленные на FAP иммуноцитокины, содержащие вариант IL-2, можно получать с помощью методов, описанных в разделе «Примеры» в WO 2012/146628 и WO 2012/107417.

Антитела, представленные в настоящем описании, предпочтительно получают методами рекомбинации. Указанные методы хорошо известны в данной области и предусматривают экспрессию белка в прокариотических и эукариотических клетках с последующим выделением полипептида антитела и, как правило, очисткой до фармацевтически приемлемой чистоты. Для экспрессии белка нуклеиновые кислоты, кодирующие легкие и тяжелые цепи или их фрагменты, встраивают в экспрессионные векторы с помощью стандартных методов. Экспрессию осуществляют в приемлемых прокариотических или эукариотических клетках-хозяевах типа СНО-клеток, NS0-клеток, SP2/0-клеток, HEK293-клеток, COS-клеток, дрожжей или клеток Е. coli, и антитело выделяют из клеток (из супернатанта или клеток после лизиса).

Рекомбинантное получение антител хорошо известно в данной области и описано, например, в обзорных статьях Makrides S.C., Protein Expr. Purif., 17, 1999, сс. 183-202; Geisse S. и др., Protein Expr. Purif., 8, 1996, cc. 271-282; Kaufman R.J., Mol. Biotechnol., 16, 2000, cc. 151-161; Werner, R.G., Drug Res. 48, 1998, cc. 870-880.

Антитела могут присутствовать в целых клетках, в клеточном лизате или в частично очищенной или практически очищенной форме. Очистку осуществляют для удаления других клеточных компонентов или других загрязнителей, например, других клеточных нуклеиновых кислот или белков, стандартными методами, которые включают обработку щелочью/ДСН, CsCl-бэндинг, хроматографию на колонках, электрофорез в агарозном геле и другие методы, хорошо известные в данной области (см. в Current Protocols in Molecular Biology, под ред. Ausubel F. и др., изд-во Greene Publishing and Wiley Interscience, New York, 1987).

Экспрессия в NSO-клетках описана, например, у Barnes L.M. и др., Cytotechnology 32, 2000, сс.109-123; и Barnes L.M. и др., Biotech. Bioeng. 73, 2001, сс. 261-270. Кратковременная экспрессия описана, например, у Durocher Y. и др., Nucl. Acids. Res. 30, 2002, с. Е9. Клонирование вариабельных доменов описано у Orlandi R. и др., Proc. Natl. Acad. Sci. USA 86, 1989, cc. 3833-3837; Carter P. и др., Proc. Natl. Acad. Sci. USA 89, 1992, cc. 4285-4289; и Norderhaug L. и др., J. Immunol. Methods 204, 1997, cc. 77-87. Предпочтительная система кратковременной экспрессии (HEK 293) описана у Schlaeger E.-J. и Christensen K. в Cytotechnology 30, 1999, сс. 71-83 и у Schlaeger E.-J. в J. Immunol. Methods 194, 1996, cc. 191-199.

Вариабельные домены тяжелой и легкой цепи, предлагаемые в изобретении, объединяют с последовательностями промотора, инициации трансляции, константной области, 3'-нетранслируемой области, последовательностями полиаденилирования и терминации транскрипции с получением конструкций экспрессионных векторов. Конструкции для экспрессии тяжелой и легкой цепи можно объединять в одном векторе, их можно применять для котрансфекции, серийной трансфекции или раздельной трансфекции клеток-хозяев, которые затем можно сливать с получением индивидуальной клетки-хозяина, которая экспрессирует обе цепи.

Контролирующие последовательности, пригодные для прокариотических организмов, представляют собой, например, промотор, необязательно последовательность оператора и сайт связывания рибосом. Известно, что для эукариотических клеток применяют промоторы, энхансеры и сигналы полиаденилирования.

Нуклеиновая кислота «функционально связана», когда она находится в функциональной связи с другой нуклеотидной последовательностью. Например, ДНК предпоследовательности или лидерной секреторной последовательности функционально связана с ДНК полипептида, если при ее экспрессии образуется предбелок, который участвует в секреции полипептида; промотор или энхансер функционально связан с кодирующей последовательностью, если он оказывает воздействие на транскрипцию последовательности; или сайт связывания рибосом функционально связан с кодирующей последовательностью, если он расположен так, что облегчает трансляцию. Как правило, понятие «функционально связаны» означает, что последовательности ДНК, будучи связаны, являются смежными, а в случае лидерной секреторной последовательности, являются смежными и находятся в рамке считывания. Однако для энхансеров не является необходимым, чтобы они были смежными. Связывание осуществляют путем лигирования в соответствующих сайтах рестрикции. Если такие сайты не существуют, то в соответствии с принятой практикой применяют синтетические олигонуклеотидные адаптеры или линкеры.

Моноклональные антитела можно отделять от культуральной среды с помощью общепринятых методов очисти иммуноглобулинов, таких, например, как, хроматография на белок А-сефарозе, хроматография на гидроксилапатите, гель-электрофорез, диализ или аффинная хроматография. ДНК и РНК, которые кодируют моноклональные антитела, можно легко выделять и секвенировать с помощью общепринятых методов. Клетки гибридом могут служить источником таких ДНК и РНК. После выделения ДНК можно встраивать в экспрессионные векторы, которыми затем трансфектируют клетки-хозяева, такие как клетки HEK 293, СНО-клетки или клетки миеломы, которые иначе не могут продуцировать белок иммуноглобулина, для синтеза рекомбинантных моноклональных антител в клетках-хозяевах.

В контексте настоящего описания понятия «клетка», «клеточная линия» и «клеточная культура» используются взаимозаменяемо, и все такие определения включают потомство. Так, понятия «трансформанты» и «трансформированные клетки» относятся к первичной рассматриваемой клетке и полученным из нее культурам безотносительно к количеству пересевов. Следует понимать также, что все потомство может не быть полностью идентичным по составу ДНК из-за преднамеренных или случайных мутаций. Под объем изобретения подпадает вариант потомства, имеющий такую же функцию или биологическую активность, которая обнаружена у исходной трансформированной клетки.

Терапевтические способы и композиции

В изобретении предложен способ лечения пациента, нуждающегося в терапии, отличающийся тем, что вводят пациенту в терапевтически эффективном количестве комбинированную терапию на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предлагаемым в изобретении.

В изобретении предложено применение нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предлагаемым в изобретении, для комбинированной терапии, указанной в настоящем описании.

Одним из предпочтительных вариантов осуществления изобретения является комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в сочетании с антителом, которое связывается с человеческим PD-L1, предлагаемым в настоящем изобретении, предназначенная для лечения рака или опухоли.

Таким образом, одним из вариантов осуществления изобретения является нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, указанный в настоящем описании, который предназначен для лечения рака или опухоли в комбинации с антителом к PD-L1, указанным в настоящем описании.

Другим вариантом осуществления изобретения является антитело к PD-L1, указанное в настоящем описании, которое предназначено для применения для лечения рака или опухоли в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, указанным в настоящем описании.

Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, может представлять собой указанный нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, или нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, предлагаемый в изобретении.

Рак или опухоль может презентировать антиген на опухолевой клетке или в окружении опухолевой клетки. Мишень комбинированной терапии может презентироваться на опухолевой клетке или в окружении опухолевой клетки. Рак или опухоль может экспрессировать или сверхэкспрессировать СЕА или FAP. Лечению можно подвергать солидную опухоль. Солидная опухоль может экспрессировать или сверхэкспрессировать СЕА или FAP. Лечению можно подвергать карциному. Карцинома может экспрессировать или сверхэкспрессировать СЕА или FAP. Рак можно выбирать из группы, состоящей из колоректального рака, рака головы и шеи, немелкоклеточного рака легкого, рака молочной железы, рака поджелудочной железы, рака печени и рака желудка. Рак можно выбирать из группы, состоящей из рака легкого, рака ободочной кишки, рака желудка, рака молочной железы, рака головы и шеи, рака кожи, рака печени, рака почки, рака предстательной железы, рака поджелудочной железы, рака головного мозга и рака скелетной мышцы.

Понятие «рак» в контексте настоящего описания может обозначать, например, рак легкого, немелкоклеточный рак легкого (NSCL), бронхоальвеолярный рак легкого, рак кости, рак поджелудочной железы, рак кожи, рак головы или шеи, кожную или внутриглазную меланому, рак матки, рак яичника, ректальный рак, рак анальной области, рак желудка, гастральный рак, рак ободочной кишки, рак молочной железы, карциному фаллопиевых труб, карциному эндометрия, карциному шейки матки, карциному влагалища, карциному вульвы, болезнь Ходжкина, рак пищевода, рак тонкого кишечника, рак эндокринной системы, рак щитовидной железы, рак паращитовидной железы, рак надпочечника, саркому мягких тканей, рак мочеиспускательного канала, рак пениса, рак предстательной железы, рак мочевого пузыря, рак почки или мочеточника, почечноклеточную карциному, карциному почечной лоханки, мезотелиому, печеночно-клеточный рак, рак желчных протоков, неоплазмы центральной нервной системы (ЦНС), опухоли спинных позвонков, глиому ствола головного мозга, мультиформную глиобластому, астроцитомы, шваномы, эпендимоны, медуллобластомы, менингиомы, плоскоклеточные карциномы, аденому гипофиза, лимфому, лимфоцитарный лейкоз, включая устойчивые варианты любого из указанных выше видов рака, или комбинацию одного или нескольких из указанных выше видов рака. В одном из предпочтительных вариантов осуществления изобретения указанный рак представляет собой рак молочной железы, колоректальный рак, меланому, рак головы и шеи, рак легкого или рак предстательной железы. В одном из предпочтительных вариантов осуществления изобретения указанный рак представляет собой рак молочной железы, рак яичника, рак шейки матки, рак легкого или рак предстательной железы. В другом предпочтительном варианте осуществления изобретения указанный рак представляет собой рак молочной железы, рак легкого, рак ободочной кишки, рак яичника, меланому, рак мочевого пузыря, ренальный рак, рак почки, рак печени, рак головы и шеи, колоректальный рак, рак поджелудочной железы, гастральную карциному, рак пищевода, мезотелиому, рак предстательной железы, лейкоз, лимфому, миеломы. В одном из предпочтительных вариантов осуществления изобретения указанные виды рака отличаются также экспрессией или сверхэкспрессией СЕА или FAP.

Вариантом осуществления изобретения является нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, указанный в настоящем описании, в комбинации с антителом к PD-L1, указанным в настоящем описании, для применения для лечения любого из указанных выше видов раков или опухолей.

Другим вариантом осуществления изобретения является антитело к PD-L1, указанное в настоящем описании, в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании, для применения для лечения любого из указанных выше видов раков или опухолей.

Изобретение относится к комбинированной терапии на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2A, указанного в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании, которая предназначена для лечения рака.

Изобретение относится к комбинированной терапии на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2A, указанного в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании, которая предназначена для предупреждения или лечения метастазов.

Изобретение относится к комбинированной терапии на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2A, указанного в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании, которая предназначена для лечения воспалительных заболеваний.

Изобретение относится к комбинированной терапии на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2A, указанного в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании, которая предназначена для применения для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет.

Изобретение относится к комбинированной терапии на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2A, указанного в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании, которая предназначена для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность.

Изобретение относится к способу лечения рака у пациента, который нуждается в этом, отличающемуся тем, что вводят пациенту нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, указанный в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к способу предупреждения или лечения метастазов у пациента, который нуждается в этом, отличающемуся тем, что вводят пациенту нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, указанный в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к способу лечения воспалительных заболеваний у пациента, который нуждается в этом, отличающемуся тем, что вводят пациенту нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, указанный в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к способу лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, у пациента, который нуждается в этом, отличающемуся тем, что вводят пациенту нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, указанный в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к способу стимуляции иммунного ответа или функции, такой как Т-клеточная активность, у пациента, который нуждается в этом, отличающемуся тем, что вводят пациенту нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, указанный в настоящем описании, в сочетании с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к нацеленному на опухоль иммуноцитокину, содержащему вариант IL-2A, указанному в настоящем описании, для применения для лечения рака в комбинации с антителом к PD-L1, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для лечения рака в комбинации с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к нацеленному на опухоль иммуноцитокину, содержащему вариант IL-2A, указанному в настоящем описании, для применения для предупреждения или лечения метастазов в комбинации с антителом к PD-L1, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для предупреждения или лечения метастазов в комбинации с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к нацеленному на опухоль иммуноцитокину, содержащему вариант IL-2A, указанному в настоящем описании, для применения для лечения воспалительных заболеваний в комбинации с антителом к PD-L1, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для лечения воспалительных заболеваний в комбинации с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к нацеленному на опухоль иммуноцитокину, содержащему вариант IL-2A, указанному в настоящем описании, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, в комбинации с антителом к PD-L1, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, в комбинации с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к нацеленному на опухоль иммуноцитокину, содержащему вариант IL-2A, указанному в настоящем описании, для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, в комбинации с антителом к PD-L1, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, в комбинации с антителом к PD-L1, указанным в настоящем описании.

Изобретение относится к антителу к PD-L1, указанному в настоящем описании, для применения для лечения рака в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для лечения рака в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании.

Изобретение относится к антителу к PD-L1, указанному в настоящем описании, для применения для предупреждения или лечения метастазов в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для предупреждения или лечения метастазов лечения рака в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании.

Изобретение относится к антителу к PD-L1, указанному в настоящем описании, для применения для лечения воспалительных заболеваний в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для лечения воспалительных заболеваний в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании.

Изобретение относится к антителу к PD-L1, указанному в настоящем описании, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании.

Изобретение относится к антителу к PD-L1, указанному в настоящем описании, для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании, или в альтернативном варианте для приготовления лекарственного средства для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, в комбинации с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2A, указанным в настоящем описании.

В предпочтительном варианте осуществления изобретения нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, который используют в указанных выше комбинированных лечениях и в медицинских применениях представляет собой нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88,

и антитело, которое связывается с человеческим PD-L1, которое используют в комбинированных лечения, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

В предпочтительном варианте осуществления изобретения нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, который используют в указанных выше комбинированных лечениях и в медицинских применениях представляет собой нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81,

и антитело, которое связывается с человеческим PD-L1, которое используют в комбинированных лечения, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

Другим объектом настоящего изобретения является композиция, например, фармацевтическая композиция, которая содержит нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2A, указанный в настоящем описании, и антитело, которое связывается с человеческим PD-L1, или его антигенсвязывающий фрагмент, указанное/указанный в настоящем описании, приготовленная в сочетании с фармацевтически приемлемым носителем.

В контексте настоящего описания понятие «фармацевтически приемлемый носитель» относится к любому и ко всем растворителям, диспергирующим средам, покрытиям, антибактериальным и противогрибным агентам, регулирующим изотоничность и замедляющим абсорбцию/ресорбцию агентам и подобным веществам, которые являются физиологически совместимыми. Предпочтительно носитель должен быть пригоден для инъекции или инфузии.

Композицию, предлагаемую в настоящем изобретении, можно вводить различными методами, известными в данной области. Как должно быть очевидно специалисту в данной области, путь и/или механизм введения должен варьироваться в зависимости от требуемых результатов.

Фармацевтически приемлемые носители представляют собой стерильные водные растворы или дисперсии и стерильные порошки, предназначенные для приготовления стерильных инъецируемых растворов или дисперсии. Применение указанных сред и агентов для фармацевтических действующих веществ известно в данной области. Помимо воды носитель может представлять собой, например, изотонический забуференный физиологический раствор.

Вне зависимости от выбранного пути введения соединения, предлагаемые в настоящем изобретении, которые можно применять в приемлемой гидратированной форме, и/или фармацевтические композиции, предлагаемые в настоящем изобретении, приготавливают в виде фармацевтически приемлемых лекарственных форм с помощью общепринятых методов, известных специалистам в данной области.

Фактические уровни доз действующих веществ в фармацевтических композициях, предлагаемых в настоящем изобретении, могут варьироваться так, чтобы получать количество действующего вещества, которое является эффективным для получения требуемого терапевтического ответа у конкретного пациента при использовании конкретной композиции и пути введения, не является при этом токсичным для пациента (эффективное количество). Выбранный уровень доз должен зависеть от разнообразных

фармакокинетических факторов, таких как активность конкретных применяемых композиций, предлагаемых в настоящем изобретении, или их сложных эфиров, солей или амидов, путь введения, время введения, скорость экскреции конкретного применяемого соединения, другие лекарственные средства, соединения и/или материалы, применяемые в сочетании с конкретными композициями, возраст, пол, вес, общее состояние здоровья и предыдущая история болезни пациента, подлежащего лечению, и подобных факторов, которые хорошо известны в медицине.

Одним из объектов изобретения является набор, предназначенный для лечения заболеваний, который содержит в одном или в различных контейнерах (а) нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, указанный в настоящем описании, и (б) антитело, которое связывается с человеческим PD-L1, указанное в настоящем описании, и необязательно содержит также (в) листовку-вкладыш в упаковку, содержащую напечатанные инструкции по применению комбинированного лечения согласно методу лечения заболевания. Кроме того, набор может содержать (а) первый контейнер с находящейся в нем композицией, где композиция содержит антитело, которое связывается с человеческим PD-L1, указанное в настоящем описании; (б) второй контейнер с находящейся в нем композицией, где композиция содержит нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, указанный в настоящем описании; и необязательно (в) третий контейнер с находящейся в нем композицией, где композиция содержит дополнительный цитотоксический или иной терапевтический агент.Набор, представляющий собой указанный вариант осуществления изобретения, может включать также листовку-вкладыш в упаковку с информацией о том, что композиции можно применять для лечения конкретного состояния. В альтернативном или дополнительном варианте набор может содержать также третий (или четвертый) контейнер с находящемся в нем фармацевтически приемлемым буфером, таким как бактериостатическая вода для инъекций (БСВИ), забуференный фосфатом физиологический раствор, раствор Рингера и раствор декстрозы. Кроме того, он может включать другие материалы, необходимые с коммерческой точки зрения и с точки зрения потребителя, в частности, другие буферы, разбавители, фильтры, иглы и шприцы.

Одним из объектов изобретения является набор, предназначенный для лечения заболевания, содержащий (а) контейнер с находящемся в нем нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, указанным в настоящем описании, и (б) листовку-вкладыш в упаковку, содержащую инструкции по применению нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в комбинированной терапии в сочетании с антителом к PD-L1, указанным в настоящем описании, согласно методу лечения заболевания.

Другим объектом изобретения является набор, предназначенный для лечения заболевания, содержащий (а) контейнер с находящемся в нем антителом к PD-L1, указанным в настоящем описании, и (б) листовку-вкладыш в упаковку, содержащую инструкции по применению антитела к PD-L1 в комбинированной терапии в сочетании с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, указанным в настоящем описании, согласно методу лечения заболевания.

Следующим объектом изобретения является лекарственное средство, предназначенное для лечения заболевания, которое содержит нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, указанный в настоящем описании, где указанное лекарственное средство предназначено для применения в комбинированной терапии в сочетании с антителом, которое связывается с человеческим PD-L1, указанным в настоящем описании, и необязательно содержит листовку-вкладыш в упаковку, содержащую напечатанные инструкции по применению комбинированного лечения согласно методу лечения заболевания.

Еще одним объектом изобретения является лекарственное средство, предназначенное для лечения заболевания, содержащее антитело, которое связывается с человеческим PD-L1, указанное в настоящем описании, где указанное лекарственное средство предназначено для применения в комбинированной терапии в сочетании с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, указанным в настоящем описании, и необязательно содержит листовку-вкладыш в упаковку, содержащую напечатанные инструкции по применению комбинированного лечения согласно методу лечения заболевания.

Понятие «метод лечения» или его эквивалент применительно, например, к раку, относится к процедуре или процессу действия, который создают для снижения или элиминации количества раковых клеток у пациента или для облегчения симптомов рака. «Метод лечения» рака или другого пролиферативного нарушения не обязательно означает, что раковые клетки или другое нарушение должны быть фактически элиминированы, что количество клеток или уровень нарушения должны быть фактически снижены или что симптомы рака или другого нарушения должны быть фактически облегчены. Часто метод лечения рака следует осуществлять даже при невысокой вероятности успеха, но, даже если, исходя из истории болезни и ожидаемой продолжительности жизни пациента, лечение может оказывать общее благоприятное действие.

Понятия «применение в сочетании с» или «совместное применение», «совместное введение», «комбинированная терапия» или «комбинированное лечение» относятся к применению нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, указанного в настоящем описании, и антитела, которое связывается с человеческим PD-L1, указанного в настоящем описании, например, в виде раздельных препаратов/обработок (или в виде одного препарата/одной обработки). Совместное применение может быть одновременным или последовательным в любом порядке, предпочтительно в период времени, в течение которого оба (или все) действующие вещества одновременно проявляют их биологическую активность. Указанные действующие вещества применяют совместно либо одновременно, либо последовательно (например, внутривенно (i.v.) с помощью непрерывной инфузии. Когда оба терапевтических агента применяют совместно последовательно, то применяемую дозу либо вводят в тот же день в виде двух отдельных обработок, либо одно из средств вводят в день 1, а второе применяют для совместного введения в день 2-7, предпочтительно в день 2-4. Таким образом, в одном из вариантов осуществления изобретения понятие «последовательно» означает в пределах 7 дней после дозирования первого компонента, предпочтительно в пределах 4 дней после дозирования первого компонента; и понятие «одновременно» означает введение в одно и то же время. Понятие «совместное введение (применение)» касательно поддерживающих доз нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и/или антитела к PD-L1 означает, что поддерживающие дозы можно вводить одновременно, если цикл лечения является приемлемым для обоих лекарственных средств, например, еженедельно. Или поддерживающие дозы вводят совместно последовательно, например, введение доз нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела к PD-L1 осуществляют на чередующихся неделях.

Как должно быть очевидно, антитела вводят пациенту в «терапевтически эффективном количестве» (или просто в «эффективном количестве»), представляющем собой количество соответствующего соединения или комбинации, которое по предположению исследователя, ветеринара, лечащего врача или другого клинициста должно вызывать биологический или медицинский ответ в ткани, системе, животном или человеке.

Количество, применяемое для совместного введения, и время совместного введения должны зависеть от типа (вид, пол, возраст, вес и т.д.) и состояния подлежащего лечению пациента и серьезности заболевания или состояния, подлежащего лечению. Указанные нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, и/или антитело к PD-L1 можно применять для совместного введения пациенту одновременно или в виде серий обработок, например, в один и тот же день или на следующий день или с недельными интервалами.

Например, нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, и/или антитело к PD-L1, можно вводить одновременно на неделе 1 с использованием поддерживающих доз нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела к PD-L1, чередуя обработки через неделю, например, начиная с нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, например, в течение 3 недель. Например, нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, и/или антитело к PD-L1 можно вводить одновременно на неделе 1 с использованием поддерживающих доз нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела к PD-L1, например, каждую неделю, например, в течение всего периода лечения, например, 2 недель. Например, нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, и/или антитело к PD-L1 можно вводить одновременно на неделе 1 с использованием поддерживающих доз нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела к PD-L1, например, каждую неделю, например, в течение всего периода лечения, например, 5 недель (что можно обозначать также как схема лечения нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, и антителом к PD-L1, предусматривающая одновременное совместное применение один раз в неделю в течение 5 недель). В одном из вариантов осуществления изобретения нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят один раз каждые 2 недели, один раз каждые 3 недели или один раз каждые 4 недели. В одном из вариантов осуществления изобретения антитело к PD-L1 вводят один раз каждые 2 недели или один раз каждые 3 недели. В одном из вариантов осуществления изобретения первые обработки нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, и антителом к PD-L1 осуществляют последовательно в первый день цикла лечения.

В зависимости от типа и серьезности заболевания доза, составляющая примерно от 0,1 до 50 мг/кг (например, 0,1-20 мг/кг) указанного нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и/или антитела к PD-L1, представляет собой начальную возможную дозу при совместном введении обоих лекарственных средств пациенту. Кроме того, доза указанного нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и/или антитела к PD-L1 может представлять собой плоскую фиксированную дозу, которая не зависит от веса пациента. Например, максимальную плоскую дозу 1 мг/кг или 40 мг, исходную плоскую дозу 10 мг, которую вводят еженедельно или через неделю, или дозу 0,05-0,5 мг/кг, которую вводят еженедельно или через неделю, можно выбирать для нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2. В одном из вариантов осуществления плоскую фиксированную дозу 5-50 мг, например, 5, 6, 10, 15, 20, 25, 30, 35, 40, 45 или 50 мг нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, вводят каждые 2 недели, каждые 3 недели или каждые 4 недели. Например, если для антитела к PD-L1 используют пониженную дозу 10 мг/кг, то можно выбирать максимальную дозу 20 мг/кг q3w. В одном из вариантов осуществления изобретения плоскую фиксированную дозу 800 мг антитела к PD-L1 вводят каждые 2 недели. В другом варианте осуществления изобретения плоскую фиксированную дозу 1200 мг антитела к PD-L1 вводят каждые 3 недели. В изобретении предложено применение нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела к PD-L1, предлагаемых в изобретении, для лечения пациента, страдающего раком, прежде всего раком ободочной кишки, печени или поджелудочной железы.

Помимо нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в комбинации с антителом к PD-L1, можно использовать также химиотерапевтическое средство.

В одном из вариантов осуществления изобретения указанные дополнительные химиотерапевтические средства, которые можно применять вместе с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, и антителом к PD-L1, указанными в настоящем описании, представляет собой (но не ограничиваясь только ими) антинеопластические средства, такие как алкилирующие вещества, включая: азотистые производные горчичного газа, такие как мехлорэтамин, циклофосфамид, ифосфамид, мелфалан и хлорамбуцил; нитрозомочевины, такие как кармустин (BCNU), ломустин (CCNU) и семустин (метил-CCNU); Temodal™ (темозоламид), этиленимины/метилмеламины, такие как триэтиленмеламин (ТЕМ), триэтилен, тиофосфорамид (тиотепа), гексаметилмеламин (НММ, алтретамин; алкилсульфонаты, такие как бусульфан; триазины, такие как дакарбазин (DTIC)); антиметаболиты, включая аналоги фолиевой кислоты, такие как метотрексат и триметрексат, аналоги пиримидина, такие как 5-фторурацил (5FU), фтордезоксиуридин, гемцитабин, цитозинарабинозид (AraC, цитарабин), 5-азацитидин, 2,2'-дифтордезоксицитидин, аналоги пурина, такие как 6-меркаптопурин, 6-тиогуанин, азатиоприн, Т-дезоксикоформицин (пентостатин), эритрогидроксинониладенин (EHNA), флударабина фосфат и 2-хлордезоксиаденозин (кладрибин, 2-CdA); антимитотические лекарственные средства, полученные из природных продуктов, такие как паклитаксел, алкалоиды барвинка, включая винбластин (VLB), винкристин и винорелбин, таксотер, эстрамустин и эстрамустина фосфат; эпиподофилотоксины, такие как этопозид, тенипозид; антибиотики, такие как актиномицин D, дауномицин (рубидомицин), доксорубицин, митоксантрон, идарубицин, блеомицины, пликамицин (митрамицин), митомицин С и актиномицин; ферменты, такие как L-аспарагиназа; модификаторы биологического ответа, такие как интерферон-альфа, IL-2, G-CSF, GM-CSF; смешанные вещества, включая координированные комплексы на основе платины, такие как оксалиплатин, цисплатин и карбоплатин, антраценодионы, такие как митоксантрон, замещенная мочевина, такая как гидроксимочевина, производные метилгидразина, включая N-метилгидразин (МIH) и прокарбазин, адренокортикальные депрессанты, такие как митотан (o,p'-DDD) и аминоглутетимид; гормоны и антагонисты, включая адренокортикостероидные антагонисты, такие как преднизон и его эквиваленты, дексаметазон и аминоглутетимид; Gemzar™ (гемцитабин), прогестин, такой как гидроксипрогестерона капроат, медропрогестерона ацетат и мегестрола ацетат; эстрогены, такие как диэтилстилбестол и эквиваленты этинилэстрадиола; антиэстроген, такой как тамоксифен; андрогены, включая тестостерона пропионат и флуоксиместерон/эквиваленты; антиандрогены, такие как флутамид, аналоги гонадотропинвысвобождающего гормона и леупролид; и нестероидные антиандрогены, такие как флутамид. Терапии, мишенью которых является эпигенетический механизм, включают (но не ограничиваясь только ими) применение ингибиторов гистондеацетилаз, деметилирующих агентов (например, вайдаза) и терапий, обеспечивающих высвобождение факторов репрессии транскрипции (ATRA (полностью транс-ретиноевая кислота), можно объединять также с антигенсвязывающими белками. В одном из вариантов осуществления изобретения химиотерапевтическое средство выбирают из группы, включающей таксаны (например, паклитаксел (таксол), доцетаксел (таксотер), модифицированный паклитаксел (например, абраксан и опаксио, доксорубицин, сунитиниб (сутент), сорафениб (нексавар) и другие мулькиназные ингибиторы, оксалиплатин, цисплатин и карбоплатин, этопозид, гемцитабин и винбластин. В одном варианте осуществления изобретения химиотерапевтическое средство выбирают из группы, включающей таксаны (такие, например, как таксол (паклитаксел), доцетаксел (таксотер), модифицированный паклитаксел (например, абраксан и опаксио)).

В одном варианте осуществления изобретения химиотерапевтическое средство выбирают из 5-фторурацила (5-FU), леоковорина, иринотекана или оксалиплатина. В одном варианте осуществления изобретения химиотерапевтическое средство представляет собой 5-фторурацил, леуковорин и иринотекан (FOLFIRI (фолфири)). В одном варианте осуществления изобретения химиотерапевтическое средство представляет собой 5-фторурацил и оксалиплатин (FOLFOX (фолфокс)).

Конкретные примеры комбинированных терапий с применением дополнительных химиотерапевтических средств включают, например, терапии в сочетании с таксанами (например, доцетакселом или паклитакселом) или модифицированным паклитакселом (например, абраксан или опаксио), доксорубицином, капецитабином и/или бевацизумабом (авастин) для лечения рака молочной железы; терапии в сочетании с карбоплатином, оксалиплатином, цисплатином, паклитакселом, доксорубицином (или модифицированным доксорубицином (келикс или доксил)) или топотеканом (гикамтин) для лечения рака яичника, терапии в сочетании с мультикиназным ингибитором, MKI, (сутент, нексавар или AMG 706) и/или доксорубицином для лечения рака почки; терапии в сочетании с оксалиплатином, цисплатином и/или облучением для лечения плоскоклеточной карциномы; терапии в сочетании с таксолом и/или карбоплатином для лечения рака легкого.

Таким образом, в одном из вариантов осуществления изобретения дополнительное химиотерапевтическое средство выбирают из группы, включающей таксаны (доцетаксел или паклитаксел, или модифицированный паклитаксел (абраксан или опаксио)), доксорубицин, капецитабин и/или бевацизумаб, для лечения рака молочной железы.

В одном из вариантов осуществления изобретения комбинированная терапия на основе нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2/антитела к PD-L1, не предусматривает применение никаких химиотерапевтических средств.

Изобретение относится также к способу лечения пациента, страдающего указанным заболеванием.

Изобретение относится также к способу приготовления фармацевтической композиции, которая содержит предлагаемый в изобретении нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, указанный в настоящем описании, и предлагаемое в изобретении антитело к PD-L1, указанное в настоящем описании, в сочетании с фармацевтически приемлемым носителем, и к применению предлагаемых в изобретении нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела к PD-L1, указанных в настоящем описании, в указанном способе.

В изобретении предложено также применение в эффективном количестве предлагаемого в изобретении нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, указанного в настоящем описании, и предлагаемого в изобретении антитела к PD-L1, указанного в настоящем описании, для приготовления фармацевтического средства в сочетании с фармацевтически приемлемым носителем, которое предназначено для лечения пациента, страдающего раком.

Представленные ниже примеры, перечень последовательностей и чертежи даны с целью лучшего понимания настоящего изобретения, истинный объем которого изложен в прилагаемой формуле изобретения. Очевидно, что можно осуществлять модификации в изложенных процедурах без отклонения от сущности изобретения.

Описание последовательностей

SEQ ID NO: 1 пример Fc-области человеческого IgG1;

SEQ ID NO: 2 человеческий IL-2 (С125A);

SEQ ID NO: 3 четверной мутант человеческого IL-2 (IL-2 qm);

SEQ ID NO: 4 человеческий PD-L1 (включая сигнальную последовательность);

SEQ ID NO: 5 вариабельный домен легкой цепи, МАт 3F2;

SEQ ID NO: 6 вариабельный домен легкой цепи, МАт 3F2 (YS);

SEQ ID NO: 7 вариабельный домен тяжелой цепи, МАт 3F2;

SEQ ID NO: 8 вариабельный домен легкой цепи, МАт 3D9;

SEQ ID NO: 9 вариабельный домен тяжелой цепи, МАт 3D9;

SEQ ID NO: 10 вариабельный домен тяжелой цепи, МАт 3D9 (ТА);

SEQ ID NO: 11 вариабельный домен легкой цепи, МАт 4G8;

SEQ ID NO: 12 вариабельный домен тяжелой цепи, Мат 4G8;

SEQ ID NO: 13 вариабельный домен легкой цепи, МАт 4 В3;

SEQ ID NO: 14 вариабельный домен тяжелой цепи, МАт 4 В3;

SEQ ID NO: 15 вариабельный домен легкой цепи, МАт 4D6;

SEQ ID NO: 16 вариабельный домен тяжелой цепи, МАт 4D6;

SEQ ID NO: 17 вариабельный домен легкой цепи, МАт 2С6;

SEQ ID NO: 18 вариабельный домен тяжелой цепи, МАт 2С6;

SEQ ID NO: 19 вариабельный домен легкой цепи, МАт 5Н5;

SEQ ID NO: 20 вариабельный домен тяжелой цепи, МАт 5Н5;

SEQ ID NO: 21 вариабельный домен легкой цепи, МАт 2С4;

SEQ ID NO: 22 вариабельный домен тяжелой цепи, МАт 2С4;

SEQ ID NO: 23 вариабельный домен легкой цепи, МАт 2D9;

SEQ ID NO: 24 вариабельный домен тяжелой цепи, МАт 2D9;

SEQ ID NO: 25 вариабельный домен легкой цепи, МАт 4 В8;

SEQ ID NO: 26 вариабельный домен тяжелой цепи, МАт 4 В8;

SEQ ID NO: 27 вариабельный домен легкой цепи, МАт 7А1;

SEQ ID NO: 28 вариабельный домен тяжелой цепи, МАт 7А1;

SEQ ID NO: 29 вариабельный домен легкой цепи, МАт 13С2;

SEQ ID NO: 30 вариабельный домен тяжелой цепи, МАт 13С2;

SEQ ID NO: 31 вариабельный домен легкой цепи, МАт 13Е8;

SEQ ID NO: 32 вариабельный домен тяжелой цепи, МАт 13Е8;

SEQ ID NO: 33 вариабельный домен легкой цепи, МАт 14С10;

SEQ ID NO: 34 вариабельный домен тяжелой цепи, МАт 14С10;

SEQ ID NO: 35 вариабельный домен легкой цепи, МАт 17А11;

SEQ ID NO: 36 вариабельный домен тяжелой цепи, МАт 17А11;

SEQ ID NO: 37 вариабельный домен легкой цепи, МАт 19G1;

SEQ ID NO: 38 вариабельный домен тяжелой цепи, МАт 19G1;

SEQ ID NO: 39 вариабельный домен легкой цепи, МАт 20G8;

SEQ ID NO: 40 вариабельный домен тяжелой цепи, МАт 20G8;

SEQ ID NO: 41 вариабельный домен легкой цепи, МАт 4 В9;

SEQ ID NO: 42 вариабельный домен тяжелой цепи, МАт 4 В9;

SEQ ID NO: 43 вариабельный домен легкой цепи, МАт 5 В8;

SEQ ID NO: 44 вариабельный домен тяжелой цепи, МАт 5 В8;

SEQ ID NO: 45 вариабельный домен легкой цепи, МАт 5F1;

SEQ ID NO: 46 вариабельный домен тяжелой цепи, МАт 5F1;

SEQ ID NO: 47 вариабельный домен легкой цепи, МАт 14 В3;

SEQ ID NO: 48 вариабельный домен тяжелой цепи, МАт 14 В3;

SEQ ID NO: 49 вариабельный домен легкой цепи, МАт 16F1;

SEQ ID NO: 50 вариабельный домен тяжелой цепи, МАт 16F1;

SEQ ID NO: 51 вариабельный домен легкой цепи, МАт 16F8;

SEQ ID NO: 52 вариабельный домен тяжелой цепи, МАт 16F8;

SEQ ID NO: 53 вариабельный домен легкой цепи, МАт О3С9;

SEQ ID NO: 54 вариабельный домен тяжелой цепи, МАт О3С9;

SEQ ID NO: 55 вариабельный домен легкой цепи, МАт O2D7;

SEQ ID NO: 56 вариабельный домен тяжелой цепи, МАт O2D7;

SEQ ID NO: 57 вариабельный домен легкой цепи, МАт 28Н1;

SEQ ID NO: 58 вариабельный домен тяжелой цепи, МАт 28Н1;

SEQ ID NO: 59 вариабельный домен легкой цепи, МАт 22A3;

SEQ ID NO: 60 вариабельный домен тяжелой цепи, МАт 22А3;

SEQ ID NO: 61 вариабельный домен легкой цепи, МАт 29 В11;

SEQ ID NO: 62 вариабельный домен тяжелой цепи, МАт 29 В11;

SEQ ID NO: 63 вариабельный домен легкой цепи, МАт 23С10;

SEQ ID NO: 64 вариабельный домен тяжелой цепи, МАт 23С10;

SEQ ID NO: 65 вариабельный домен легкой цепи, МАт СН1А1А 98/99 2F1;

SEQ ID NO: 66 вариабельный домен тяжелой цепи, МАт СН1А1А 98/99 2F1;

SEQ ID NO: 67 вариабельный домен легкой цепи, МАт СН1А1А 98/99 2F1;

SEQ ID NO: 68 вариабельный домен тяжелой цепи, МАт СН1А1А 98/99 2F1;

SEQ ID NO: 69 28Н1 Fab HC-Fc «выступ» (LALA P329G)-IL-2 qm;

SEQ ID NO: 70 4G8 Fab HC-Fc «выступ» (LALA P329G)-IL-2 qm;

SEQ ID NO: 71 4B9 Fab HC-Fc «выступ» (LALA P329G)-IL-2 qm;

SEQ ID NO: 72 28H1 Fab HC-Fc «выступ» (LALA P329G)-IL-2 qm (2);

SEQ ID NO: 73 4B9 Fab HC-Fc «выступ» (LALA P329G)-IL-2 qm (2);

SEQ ID NO: 74 28H1 Fab HC-Fc «впадина» (LALA P329G);

SEQ ID NO: 75 4G8 Fab HC-Fc «впадина» (LALA P329G);

SEQ ID NO: 76 4B9 Fab HC-Fc «впадина» (LALA P329G);

SEQ ID NO: 77 4G8 Fab LC;

SEQ ID NO: 78 3F2 Fab LC;

SEQ ID NO: 79 4B9 Fab HC-Fc «выступ» (LALA P329G)-IL-2 qm (2);

SEQ ID NO: 80 4B9 Fab HC-Fc «впадина» (LALA P329G);

SEQ ID NO: 81 3F2 Fab LC;

SEQ ID NO: 82 CH1A1A 98/99 2F1 Fab HC-Fc «выступ» (wt)-IL-2 qm;

SEQ ID NO: 83 CH1A1A 98/99 2F1 Fab HC-Fc «выступ» (wt)-IL-2 qm;

SEQ ID NO: 84 CH1A1A 98/99 2F1 Fab HC-Fc «выступ» (LALA P329G)-IL-2 qm;

SEQ ID NO: 85 CH1A1A 98/99 2F1 Fab HC-Fc «впадина» (wt);

SEQ ID NO: 86 CH1A1A 98/99 2F1 Fab HC-Fc «впадина» (LALA P329G);

SEQ ID NO: 87 CH1A1A 98/99 2F1 Fab LC;

SEQ ID NO: 88 CH1 A1A 98/99 2F1 Fab LC;

SEQ ID NO: 89 вариабельный домен тяжелой цепи VH, вариант 1, анти-PD-L1 243.55;

SEQ ID NO: 90 вариабельный домен тяжелой цепи VH, вариант 2, анти-PD-Ll 243.55;

SEQ ID NO: 91 вариабельный домен тяжелой цепи VH, вариант 3, анти-PD-L1 243.55;

SEQ ID NO: 92 вариабельный домен легкой цепи VL, вариант 1, анти-PD-L1 243.55;

SEQ ID NO: 93 вариабельный домен легкой цепи VL, вариант 2, анти-PD-L1 243.55;

SEQ ID NO: 94 вариабельный домен легкой цепи VL, вариант 3, анти-PD-L1 243.55;

SEQ ID NO: 95 вариабельный домен легкой цепи VL, вариант 4, анти-PD-L1 243.55;

SEQ ID NO: 96 вариабельный домен легкой цепи VL, вариант 5, анти-PD-L1 243.55;

SEQ ID NO: 97 вариабельный домен легкой цепи VL, вариант 6, анти-PD-L1 243.55;

SEQ ID NO: 98 вариабельный домен легкой цепи VL, вариант 7, анти-PD-L1 243.55;

SEQ ID NO: 99 вариабельный домен легкой цепи VL, вариант 8, анти-PD-L1 243.55;

SEQ ID NO: 100 вариабельный домен легкой цепи VL, вариант 9, анти-PD-L1 243.55;

SEQ ID NO: 101 вариабельный домен легкой цепи VL, вариант 10, анти-PD-L1 243.55;

SEQ ID NO: 102 вариабельный домен легкой цепи VL, вариант 11, анти-PD-L1 243.55;

SEQ ID NO: 103 вариабельный домен легкой цепи VL, вариант 12, анти-PD-L1 243.55;

SEQ ID NO: 104 вариабельный домен легкой цепи VL, вариант 13, анти-PD-L1 243.55;

SEQ ID NO: 105 вариабельный домен легкой цепи VL, вариант 14, анти-PD-L1 243.55;

SEQ ID NO: 106 вариабельный домен легкой цепи VL, вариант 15, анти-PD-L1 243.55;

SEQ ID NO: 107 вариабельный домен легкой цепи VL, вариант 16, анти-PD-L1 243.55;

SEQ ID NO: 108 muCEA HC-Fc (DD)-muIL2v;

SEQ ID NO: 109 muCEA HC-Fc (KK);

SEQ ID NO: 110 muCEA LC;

SEQ ID NO: 111 YW243.55.S70 PD-L1 muIgG1 DAPG HC;

SEQ ID NO: 112 YW243.55.S70 PD-L1 muIgG1 DAPG LC;

SEQ ID NO: 113 константная область человеческой легкой каппа-цепи;

SEQ ID NO: 114 константная область человеческой тяжелой цепи, полученная из IgG1;

SEQ ID NO: 115 лидерная последовательность;

SEQ ID NO: 116 лидерная последовательность;

SEQ ID NO: 117 лидерная последовательность;

SEQ ID NO: 118 лидерная последовательность;

SEQ ID NO: 119 лидерная последовательность;

SEQ ID NO: 120 лидерная последовательность;

SEQ ID NO: 121 лидерная последовательность;

SEQ ID NO: 122 лидерная последовательность;

SEQ ID NO: 123 лидерная последовательность;

SEQ ID NO: 124 muFAP HC-Fc (DD)-muIL2v;

SEQ ID NO: 125 muFAP HC-Fc (KK);

SEQ ID NO: 126 muFAP LC.

Описанные ниже варианты осуществления изобретения включают:

1. А) Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, предназначенный для применения в качестве комбинированной терапии для лечения рака, для применения в качестве комбинированной терапии для предупреждения или лечении метастазов, для применения в комбинированной терапии для лечения воспалительный заболеваний, для применения в комбинированной терапии для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, или для применения в комбинированной терапии для стимуляции иммунного ответа или функции, такой как Т-клеточная активность; или

Б) применение нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, для приготовления лекарственного средства, предназначенного для применения для лечения рака, для применения для предупреждения или лечении метастазов, для применения для лечения воспалительный заболеваний, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, или для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1; или

В) нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, предназначенный для применения для лечения рака, для применения для предупреждения или лечении метастазов, для применения для лечения воспалительный заболеваний, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, или для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность, где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1;

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

2. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по варианту осуществления изобретения 1, для применения для лечения рака.

3. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по варианту осуществления изобретения 2, для применения для лечения рака молочной железы, рака легкого, рака ободочной кишки, рака яичника, рака кожи, рака мочевого пузыря, ренального рака, рака почки, рака печени, рака головы и шеи, колоректального рака, меланомы, рака поджелудочной железы, гастральной карциномы, рака пищевода, мезотелиомы, рака предстательной железы, лейкоза, лимфом, миелом.

4. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по варианту осуществления изобретения 1, для применения для предупреждения или лечения метастазов.

5. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по варианту осуществления изобретения 1, для применения для лечение воспалительных заболеваний.

6. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по варианту осуществления изобретения 1, для применения для лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет.

7. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по варианту осуществления изобретения 1, для применения для стимуляции иммунного ответа или функции, такой как Т-клеточная активность.

8.А) Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, предназначенный для применения для

I) ингибирования роста опухоли, которая экспрессирует мишень для иммуноцитокина; и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую мишень для иммуноцитокина,

где мишень презентируется на опухолевой клетке или в окружении опухолевой клетки;

или

Б) применение нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, для приготовления лекарственного средства, предназначенного для применения для

I) ингибирования роста опухоли, которая экспрессирует мишень для иммуноцитокина; и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую мишень для иммуноцитокина;

где мишень презентируется на опухолевой клетке или в окружении опухолевой клетки,

в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое специфически связывается с человеческим PD-L1;

или

В) нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, для применения для

I) ингибирования роста опухоли, которая экспрессирует мишень для иммуноцитокина; и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую мишень для иммуноцитокина;

где мишень презентируется на опухолевой клетке или в окружении опухолевой клетки,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1;

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидную последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

9. А) Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, предназначенный для применения для

I) ингибирования роста опухоли, которая экспрессирует СЕА, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую СЕА;

или

Б) применение нацеленного на СЕА иммуноцитокина, содержащего вариант IL-2, для приготовления лекарственного средства, предназначенного для применения для

I) ингибирования роста опухоли, которая экспрессирует СЕА, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую СЕА; или

В) Нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, предназначенный для применения для

I) ингибирования роста опухоли, которая экспрессирует СЕА, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую СЕА;

где нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1;

где нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110;

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

10. А) Нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, предназначенный для применения для

I) ингибирования роста опухоли, которая экспрессирует FAP, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую FAP;

или

Б) применение нацеленного на FAP иммуноцитокина, содержащего вариант IL-2, для приготовления лекарственного средства, предназначенного для применения для

I) ингибирования роста опухоли, которая экспрессирует FAP, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую FAP; или

В) нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, предназначенный для применения для

I) ингибирования роста опухоли, которая экспрессирует FAP, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую FAP;

где нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, применяют в комбинации с антителом, которое связывается с человеческим PD-L1;

где нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

в) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126;

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

11. А) Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, предназначенный для лечения пациента, имеющего экспрессирующую СЕА опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, имеющего экспрессирующую FAP опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или опухоль, ассоциированную с экспрессией или сверхэкспрессией СЕА или FAP, и где иммуноцитокин вводят в комбинации с антителом, которое связывается с человеческим PD-L1,

или

Б) применение нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, для приготовления лекарственного средства, предназначенного для применения для лечения пациента, имеющего экспрессирующую СЕА опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, имеющего экспрессирующую FAP опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или опухоль, ассоциированную с экспрессией или сверхэкспрессией СЕА или FAP, и в котором иммуноцитокин вводят в комбинации с антителом, которое связывается с человеческим PD-L1,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

12. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение согласно одному из предыдущих вариантов осуществления изобретения,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88, или

полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81,

и где антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

13. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по одному из предыдущих вариантов осуществления изобретения, отличающийся/отличающееся тем, что антитело, представляющее собой компонент иммуноцитокина, и антитело относятся к человеческому IgG1-подклассу или человеческому IgС4-подклассу.

14. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по одному из предыдущих вариантов осуществления изобретения, отличающийся/отличающееся тем, что указанные антитела обладают пониженной или минимальной эффекторной функцией.

15. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по одному из предыдущих вариантов осуществления изобретения, где минимальная эффекторная функция является результатом «effectorless»-мутации Fc.

16. Нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, в комбинации с антителом, которое связывается с человеческим PD-L1, или применение по одному из предыдущих вариантов осуществления изобретения, где «effectorless»-мутация Fc представляет собой L234A/L235A или L234A/L235A/P329G, или N297A, или D265A/N297A (EU-нумерация).

17. А) Способ

I) ингибирования роста опухоли, которая экспрессирует мишень для иммуноцитокина; и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют опухоль, экспрессирующую мишень для иммуноцитокина;

в котором мишень презентируется на опухолевой клетке или в окружении опухолевой клетки,

в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1;

или

Б) способ лечения пациента, который имеет экспрессирующую СЕА опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, имеющий экспрессирующую FAP опухоль или опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или который имеет опухоль, ассоциированную с экспрессией или сверхэкпрессией СЕА или FAP, в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1,

в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

18. Способ лечения рака у пациента, который нуждается в этом, предупреждения или лечения метастазов у пациента, который нуждается в этом, лечения воспалительных заболеваний у пациента, который нуждается в этом, лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, у пациента, который нуждается в этом, или стимуляции иммунного ответа или функции, такой как Т-клеточная активность, у пациента, который нуждается в этом,

заключающийся в том, что вводят пациенту нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, и антитело к PD-L1,

в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

19. Способ по варианту осуществления изобретения 18, предназначенный для лечения рака.

20. Способ по варианту осуществления изобретения 19, предназначенный для лечения рака молочной железы, рака легкого, рака ободочной кишки, рака яичника, рака кожи, рака мочевого пузыря, ренального рака, рака почки, рака печени, рака головы и шеи, колоректального рака, меланомы, рака поджелудочной железы, гастральной карциномы, рака пищевода, мезотелиомы, рака предстательной железы, лейкоза, лимфом, миелом.

21. Способ по одному из вариантов осуществления изобретения 17-20, в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, применяемый в комбинированной терапии, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88 или

полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81,

и в котором антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

22. Способ по одному из вариантов осуществления изобретения 17-21, отличающийся тем, что антитело, представляющее собой компонент иммуноцитокина, и антитело относятся к человеческому IgG1-подклассу или человеческому IgG4-подклассу.

23. Способ по одному из вариантов осуществления изобретения 17-22, отличающийся тем, что указанные антитела обладают пониженной или минимальной эффекторной функцией.

24. Способ по одному из вариантов осуществления изобретения 17-23, в котором минимальная эффекторная функция является результатом «effectorless»-мутации Fc.

25. Способ по одному из вариантов осуществления изобретения 17-24, в котором «effectorless»-мутация Fc представляет собой L234A/L235A или L234A/L235A/P329G, или N297A, или D265A/N297A (EU-нумерация).

26. Способ по одному из вариантов осуществления изобретения 17-25, в котором указанный нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, и антитело, которое связывается с человеческим PD-L1, вводят одновременно или последовательно.

27. Способ по одному из вариантов осуществления изобретения 17-26, дополнительно предусматривающий введение указанному пациенту химиотерапевтического средства.

28. Набор, предназначенный для лечения рака у пациента, который нуждается в этом, предупреждения или лечения метастазов у пациента, который нуждается в этом, лечения воспалительных заболеваний у пациента, который нуждается в этом, лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, у пациента, который нуждается в этом, или стимуляции иммунного ответа или функции, такой как Т-клеточная активность,

содержащий в одном и том же или в различных контейнерах (а) нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, (б) антитело, которое связывается с человеческим PD-L1, и (в) необязательно листовку-вкладыш в упаковку, содержащую напечатанные инструкции по применению нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для комбинированной терапии,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

29. Набор, предназначенный для лечения рака у пациента, который нуждается в этом, предупреждения или лечения метастазов у пациента, который нуждается в этом, лечения воспалительных заболеваний у пациента, который нуждается в этом, лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, у пациента, который нуждается в этом, или стимуляции иммунного ответа или функции, такой как Т-клеточная активность,

в который входит (а) контейнер, содержащий нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, и (б) листовка-вкладыш в упаковку с инструкциями по применению нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, в комбинированной терапии в сочетании с антителом, которое связывается с человеческим PD-L1, согласно способу лечения заболевания,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

30. Набор, предназначенный для лечения рака у пациента, который нуждается в этом, предупреждения или лечения метастазов у пациента, который нуждается в этом, лечения воспалительных заболеваний у пациента, который нуждается в этом, лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, у пациента, который нуждается в этом, или стимуляции иммунного ответа или функции, такой как Т-клеточная активность,

в который входит (а) контейнер, содержащий антитело, которое связывается с человеческим PD-L1, и (б) листовка-вкладыш в упаковку с инструкциями по применению антитела, которое связывается с человеческим PD-L1, в комбинированной терапии в сочетании с нацеленным на опухоль иммуноцитокином, содержащим вариант IL-2, согласно способу лечения заболевания,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

31. Набор по вариантам осуществления изобретения 28-30, предназначенный для лечения рака.

32. Набор по варианту осуществления изобретения 31, предназначенный для лечения рака молочной железы, рака легкого, рака ободочной кишки, рака яичника, рака кожи, рака мочевого пузыря, ренального рака, рака почки, рака печени, рака головы и шеи, колоректального рака, меланомы, рака поджелудочной железы, гастральной карциномы, рака пищевода, мезотелиомы, рака предстательной железы, лейкоза, лимфом, миелом.

33. Набор по одному из вариантов осуществления изобретения 28-32, в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88 или

полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81,

в котором антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

34. Набор по одному из вариантов осуществления изобретения 28-33, отличающийся тем, что антитело, представляющее собой компонент иммуноцитокина, и антитело относятся к человеческому IgG1-подклассу или человеческому IgG4-подклассу.

35. Набор по одному из вариантов осуществления изобретения 28-34, отличающийся тем, что указанные антитела обладают пониженной или минимальной эффекторной функцией.

36. Набор по одному из вариантов осуществления изобретения 28-35, в котором минимальная эффекторная функция является результатом «effectorless»-мутации Fc.

37. Набор по одному из вариантов осуществления изобретения 28-36, в котором «effectorless»-мутация Fc представляет собой L234A/L235A или L234A/L235A/P329G, или N297А, или D265A/N297A (EU-нумерация).

38. Лекарственное средство, предназначенное для лечения рака у пациента, который нуждается в этом, предупреждения или лечения метастазов у пациента, который нуждается в этом, лечения воспалительных заболеваний у пациента, который нуждается в этом, лечения или замедления прогрессирования иммунопатологического заболевания, такого как противоопухолевый иммунитет, у пациента, который нуждается в этом, или стимуляции иммунного ответа или функции, такой как Т-клеточная активность,

которое включает нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2,

где указанное лекарственное средство предназначено для применения в комбинированной терапии в сочетании с антителом, которое связывается с человеческим PD-L1, и необязательно содержит листовку-вкладыш в упаковку, содержащую напечатанные инструкции по применению нацеленного на опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для комбинированной терапии,

где нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 68, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 67, и полипептидую последовательность SEQ ID NO: 3, или

б) полипептидную последовательность SEQ ID NO: 84 или SEQ ID NO: 86, или SEQ ID NO: 88, или

в) полипептидные последовательности SEQ ID NO: 84 и SEQ ID NO: 86, и SEQ ID NO: 88, или

г) полипептидные последовательности SEQ ID NO: 108 и SEQ ID NO: 109, и SEQ ID NO: 110, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 42, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 41, и полипептидную последовательность SEQ ID NO: 3, или

е) полипептидную последовательность SEQ ID NO: 79 или SEQ ID NO: 80, или SEQ ID NO: 81, или

ж) полипептидные последовательности SEQ ID NO: 79 и SEQ ID NO: 80, и SEQ ID NO: 81, или

з) полипептидные последовательности SEQ ID NO: 124 и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92, или

б) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 93, или

в) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 94, или

г) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 95, или

д) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 96, или

е) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 97, или

ж) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 98, или

з) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 99, или

и) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 100, или

к) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 101, или

л) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 102, или

м) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 103, или

н) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 104, или

о) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 105, или

п) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 90, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 106, или

р) вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 91, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 107.

39. Лекарственное средство по варианту осуществления изобретения 38, предназначенное для лечения рака.

40. Лекарственное средство по варианту осуществления изобретения 39, предназначенное для лечения рака молочной железы, рака легкого, рака ободочной кишки, рака яичника, рака кожи, рака мочевого пузыря, ренального рака, рака почки, рака печени, рака головы и шеи, колоректального рака, меланомы, рака поджелудочной железы, гастральной карциномы, рака пищевода, мезотелиомы, рака предстательной железы, лейкоза, лимфом, миелом.

41. Лекарственное средство по одному из вариантов осуществления изобретения 38-40,

в котором нацеленный на опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88 или

полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81,

и в котором антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

вариабельный домен тяжелой цепи VH, имеющий SEQ ID NO: 89, и вариабельный домен легкой цепи VL, имеющий SEQ ID NO: 92.

42. Лекарственное средство по одному из вариантов осуществления изобретения 38-41, отличающееся тем, что антитело, представляющее собой компонент иммуноцитокина, и антитело относятся к человеческому IgG1-подклассу или человеческому IgG4-подклассу.

43. Лекарственное средство по одному из вариантов осуществления изобретения 38-42, отличающийся тем, что указанные антитела обладают пониженной или минимальной эффекторной функцией.

44. Лекарственное средство по одному из вариантов осуществления изобретения 38-43, в котором минимальная эффекторная функция является результатом «effectorless»-мутации Fc.

45. Лекарственное средство по одному из вариантов осуществления изобретения 38-44, в котором «effectorless»-мутация Fc представляет собой L234A/L235A или L234A/L235A/P329G, или N297A, или D265A/N297A (EU-нумерация).

Примеры

Эффективность in vivo нацеленного на СЕА иммуноконъюгата, содержащего IL2v, на сингенных моделях, созданных с использованием клеточных линий мышиных опухолей, индивидуально и в комбинации с МАт к PD-L1

Нацеленный на СЕА иммуноконъюгат, содержащий IL2v, тестировали индивидуально и в комбинации с МАт к PD-L1 в отношении противоопухолевой эффективности на нескольких сингенных моделях.

Материалы

В опытах применяли указанные ниже молекулы. Мышинизированную суррогатную молекулу нацеленного на СЕА иммуноцитокина, содержащего вариант IL-2, EA-IL2v, который обозначали как muCEA-muIL2v, создавали для применения на моделях опухолей in vivo, для получения которых использовали полностью иммунокомпетентных мышей для снижения выработки антител к лекарственному средству (ADA). Кроме того, создавали мышинизированную химерную версию нацеленного на FAP иммуноцитокина, содержащего вариант IL-2, FAP-IL2v, который обозначали как muFAP-muIL2v, соответственно для применения на моделях опухолей in vivo, для получения которых использовали полностью иммунокомпетентных мышей для снижения выработки антител к лекарственному средству (ADA). В мышинизированных суррогатных молекулах мутации в Fc-домене типа «выступ-во-впадину» заменяли на мутации DDKK в muIgG1 и мутации LALA P329G заменяли на мутации DAPG в muIgG1.

Например, muCEA-muIL2v характеризовался следующими особенностями. В качестве родительского антитела применяли человеческое-мышиное химерное антитело IgG1-подкласса с человеческими(гуманизированными) вариабельными областями, но с мышиными константными областями. Во избежание возможной иммуногенности применяли соответствующий аллотип Black 6 (последовательность, опубликованная в Mouse Genomes Project). Связывание с muIL2Rα элиминировали с помощью трех мутаций, гомологичных тем, которые идентифицированы в человеческом IL-2v, и удаляли соответствующий сайт О-гликозилирования: Т23А (O-Glyco), F76A, Y79A, L106G. Кроме того, аналогично тому, что характерно для альдеслейкина, остаток цистеина заменяли во избежание агрегации с помощью мутации С160А (нумерация на основе UniProt ID Р04351, включая сигнальный пептид). Хотя muIgG1 уже обладал пониженной способностью связываться с FcγR, способность связываться с мышиными FcγR полностью элиминировали путем интродукции мутаций DAPG (D265A, P329G), в то время как способность связываться с muFcRn сохраняли. muIL-2v сливали с неиммуногенным коннектором (G4S)2 только с С-концом одной тяжелой цепи антитела muIgG1. Для этой цели создавали иммуноцитокин с использованием воздействия на электростатические силы с помощью мутаций DDKK в Fc-домене, что обеспечивало гетеродимеризацию в мышином генотипе.

Полипептидные последовательности muCEA-muIL2v представлены ниже:

Тяжелая цепь с мутацией DD и со слитым muIL2v (SEQ ID NO: 108):

Тяжелая цепь с мутацией KK (SEQ ID NO: 109):

Легкая цепь (SEQ ID NO: 110):

Полипептидные последовательности muFAP-muIL2v представлены ниже:

Тяжелая цепь с мутацией DD и со слитым muIL2v (SEQ ID NO: 124):

Тяжелая цепь с мутацией KK (SEQ ID NO: 125):

Легкая цепь (SEQ ID NO: 126):

В опытах применяли человеческие/мышиные кроссреактивные антитела к PD-L1. Например, создавали суррогатное антитело к мышиному PD-L1 на основе антитела YW243.55.S70 PD-L1, описанного в WO 2010/077634 (последовательность представлена на фиг. 11), которое обозначено как YW243.55.S70 PD-L1 muIgG1, для применяли на моделях опухолей in vivo. Это антитело содержало мутацию DAPG для элиминации взаимодействия с FcγR. Вариабельную область YW243.55.S70 присоединяли к константному домену мышиного IgG1 с мутациями DAPG в Fc.

Полипептидные последовательности YW243.55.S70 PD-L1 muIgG1 представлены ниже:

YW243.55.S70 PD-L1 muIgG1 LC (SEQ ID NO: 112):

Пример 1

Сингенная модель метастатического рака печени МС38-СЕА

Мышиный суррогатный нацеленный на СЕА иммуноконъюгат, содержащий IL2v, тестировали, применяя для трансфекции клетки мышиной колоректальной карциномы линии МС38-СЕА, которые инъецировали в воротную вену дважды трансгенных мышей Black 6-huCEA-huFcγRIII. В этом опыте применяли человеческое/мышиное кроссреактивное антитело к PD-L1 YW243.55.S70 PD-L1 muIgG1.

Клетки колоректальной карциномы МС38-СЕА исходно получали от фирмы City of Норе (шт.Калифорния, США) и после размножения депонировали во внутреннем банке клеток фирмы Roche-Glycart. Опухолевую линию клеток культивировали с использованием общепринятого метода в среде DMEM, содержащей 10% FCS (фирма Gibco) и G418 (генитицин; фирма Gibco), при 37°С в насыщенной водяным паром атмосфере, содержащей 5% СО2. Для трансплантации использовали пассаж 9, жизнеспособность которого составляла 96,3%. В воротную вену мышей инъецировали 5×105 клеток на животное с помощью 0,3-миллилитрового туберкулинового шприца (фирма BD Biosciences, Германия). Для этого делали небольшой разрез в средней части брюшного отдела анестезированной трансгенной мыши линии Black 6-CEA-FcγRIII. Вскрывали брюшную стенку и осторожно отделяли кишки. 100 мкл (5×105 клеток МС38-СЕА в среде RPMI) клеточной суспензии инъецировали в воротную вену. Разрезы брюшной стенки и кожи зашивали с помощью рассасывающегося шовного материала 5/0.

Самок мышей линии Black 6-CEA-FcγRIII фирма (Roche-Glycart; Швейцария), возраст которых в начале эксперимента составлял 8-9 недель (которые разводили на фирме Charles Rivers, Лион, Франция), содержали в среде, в которой отсутствовали специфические патогены, с суточным циклом 12 ч света/12 ч темноты согласно принятым руководствам (GV-Solas; Felasa; TierschG). Протокол экспериментального исследования был проверен и утвержден местным административным органом (Р 2011-128). После доставки животных выдерживали в течение 1 недели, давая пройти акклиматизацию к новым условиям окружающей среды, и для обследования. Постоянный мониторинг состояния здоровья проводили на регулярной основе.

Мышам инъецировали в воротную вену в день опыта 0 5×105 клеток МС38-huCEA, произвольно разделяли на группы и взвешивали. Через 1 неделю после инъекции опухолевых клеток мышам инъецировали i.v. CEA-IL-2v, МАт к PD-L1 или комбинацию CEA-IL-2v+МАт к PD-L1. Через 1 день после первого введения комбинации PD-L1+CEA-IL2v (неделя 1) одно животное в этой группе погибло. У остальных мышей обнаружены клинические признаки, такие как пилоэрекция, горб и пониженная локомоция, которые исчезали в течение 2 дней. Мышь, погибшую через 24 ч после первого введения терапевтического средства, не включали в эксперимент по оценке конечной выживаемости. С недели 2 по 4 вводили CEA-IL2v и PD-L1 в чередующиеся недели и у мышей не обнаружено клинических признаков при использовании указанной новой схемы дозирования. Всем мышам инъецировали i.v. 200 мкл соответствующего раствора. Мышам в обрабатываемой наполнителем группе инъецировали гистидиновый буфер, а экспериментальной группе вводили конструкцию СЕA-IL-2v или МАт к PD-L1, или комбинацию CEA-IL-2v+МАт PD-L1. Для получения соответствующего количества иммуноконъюгата на 200 мкл маточные растворы при необходимости разводили гистидиновым буфером.

На фиг. 1 и в таблице 1А продемонстрировано, что комбинация CEA-IL-2v+МАт к PD-L1 обладала более высокой эффективностью касательно повышенной медианной и общей выживаемости по сравнению с индивидуальной обработкой CEA-IL-2v и МАт к PD-L1.

Пример 2

Подкожная сингенная модель МС38-СЕА

Мышиный суррогатный нацеленный на СЕА иммуноконъюгат, содержащий IL2v, тестировали, применяя для трансфекции клетки мышиной колоректальной карциномы линии МС38-СЕА, которые инъецировали подкожно трансгенным мышам линии Black 6-CEA-FcγRIII. В этом опыте применяли человеческое/мышиное кроссреактивное антитело к PD-L1.

Клетки колоректальной карциномы МС38-СЕА исходно получали от фирмы City of Норе (шт. Калифорния, США) и после размножения депонировали во внутреннем банке клеток фирмы Roche-Glycart. Опухолевую линию клеток культивировали с использованием общепринятого метода в среде DMEM, содержащей 10% FCS (фирма Gibco) и G418 (генитицин; фирма Gibco), при 37°С в насыщенной водяным паром атмосфере, содержащей 5% СО2. Для трансплантации использовали пассаж 6, жизнеспособность которого составляла 97,9%. 5×105 клеток на животное инъецировали подкожно в 100 мкл среды для культуры клеток RPMI (фирма Gibco) в боковую область мышей с помощью 0,3-миллилитрового туберкулинового шприца (фирма BD Biosciences, Германия).

Самок мышей линии Black 6-CEA-FcγRIII фирма (Roche-Glycart; Швейцария), возраст которых в начале эксперимента составлял 8-9 недель (которые разводили на фирме Charles Rivers, Лион, Франция), содержали в среде, в которой отсутствовали специфические патогены, с суточным циклом 12 ч света/12 ч темноты согласно принятым руководствам (GV-Solas; Felasa; TierschG). Протокол экспериментального исследования был проверен и утвержден местным административным органом (Р 2011-128). После доставки животных выдерживали в течение 1 недели, давая пройти акклиматизацию к новым условиям окружающей среды, и для обследования. Постоянный мониторинг состояния здоровья проводили на регулярной основе.

Мышам инъецировали подкожно в день опыта 0 5×105 клеток МС38-huCEA, произвольно разделяли на группы и взвешивали. Через 2 недели после инъекции опухолевых клеток (объем опухолей>200 мм3) мышам инъецировали i.v. CEA-IL-2v, МАт к PD-L1 или комбинацию CEA-IL-2v+МАт к PD-L1 один раз в неделю в течение 2 недель. Всем мышам инъецировали i.v. 200 мкл соответствующего раствора. Мышам в обрабатываемой наполнителем группе инъецировали гистидиновый буфер, а экспериментальной группе вводили конструкцию CEA-IL-2v или МАт к PD-L1, или комбинацию CEA-IL-2v+МАт PD-L1. Для получения соответствующего количества иммуноконъюгата на 200 мкл маточные растворы при необходимости разводили гистидиновым буфером.

На фиг. 2 и в таблице 2А продемонстрировано, что комбинация CEA-IL-2v+МАт к PD-L1 обладала более высокой эффективностью касательно ингибирования роста опухолей по сравнению с индивидуальным применением CEA-IL-2v и МАт к PD-L1 и комбинациями с более низкими дозами CEA-IL2v.

Пример 3

Сингенная модель рака поджелудочной железы Рапс02-СЕА

Мышиный суррогатный нацеленный на СЕА иммуноконъюгат, содержащий IL2v, тестировали, применяя для трансфекции клетки рака поджелудочной железы мышей линии Panc02-СЕА, которые инъецировали в поджелудочную железу трансгенным мышам линии Black 6-CEA-FcγRIII. В этом опыте применяли человеческое/мышиное кроссреактивное антитело к PD-L1.

Клетки Panc02-Н7 (карцинома поджелудочной железы мышей) исходно получали из ракового центра MD Anderson (шт. Техас, США) и после размножения депонировали во внутреннем банке клеток фирмы Roche-Glycart. Клетки линии Panc02-H7-huCEA получали на фирме заявителей с помощью трансфекции кальцием и методов пересевов. Клетки Panc02-H7-huCEA культивировали в среде RPMI, содержащей 10% FCS (фирма Sigma), 4 мкг/мл пуромицина и 1% Glutamax. Клетки культивировали при 37°С в насыщенной водяным паром атмосфере, содержащей 5% СО2. Для трансплантации использовали пассаж 21. Жизнеспособность клеток составляла 93,1%. 1×105 клеток на животное инъецировали в поджелудочные железы мышей с помощью 0,3-миллилитрового туберкулинового шприца (фирма BD Biosciences, Германия). Для этого делали небольшой разрез в левой части брюшного отдела анестезированной трансгенной мыши линии Black 6-CEA-FcγRIII. Вскрывали брюшную стенку и осторожно с помощью пинцета отделяли поджелудочные железы. 10 мкл (5×105 клеток Panc02-H7-huCEA в среде RPMI) клеточной суспензии инъецировали в хвост поджелудочной железы. Разрезы брюшной стенки и кожи зашивали с помощью рассасывающегося шовного материала 5/0.

Самок мышей линии Black 6-CEA-FcγRIII фирма (Roche-Glycart; Швейцария), возраст которых в начале эксперимента составлял 8-9 недель (которые разводили на фирме Charles Rivers, Лион, Франция), содержали в среде, в которой отсутствовали специфические патогены, с суточным циклом 12 ч света/12 ч темноты согласно принятым руководствам (GV-Solas; Felasa; TierschG). Протокол экспериментального исследования был проверен и утвержден местным административным органом (Р 2011-128). После доставки животных выдерживали в течение 1 недели, давая пройти акклиматизацию к новым условиям окружающей среды, и для обследования. Постоянный мониторинг состояния здоровья проводили на регулярной основе.

Мышам инъецировали внутрь поджелудочной железы в день опыта 0 1×105 клеток Panc02-СЕА, произвольно разделяли на группы и взвешивали. Через 1 неделю после инъекции опухолевых клеток мышам инъецировали i.v. CEA-IL-2v, МАт к PD-L1 или комбинацию CEA-IL-2v+МАт к PD-L1 один раз в неделю в течение 5 недель.

Всем мышам инъецировали i.v. 200 мкл соответствующего раствора. Мышам в обрабатываемой наполнителем группе инъецировали гистидиновый буфер, а экспериментальной группе вводили конструкцию CEA-IL-2v или МАт к PD-L1, или комбинацию CEA-IL-2v+МАт PD-L1. Для получения соответствующего количества иммуноконъюгата на 200 мкл маточные растворы при необходимости разводили гистидиновым буфером.

На фиг. 3 и в таблице 3А продемонстрировано, что комбинация CEA-IL-2v+МАт к PD-L1 обладала более высокой эффективностью касательно повышенной медианной и общей выживаемости по сравнению с индивидуальной обработкой CEA-IL-2v и МАт к PD-L1.

Пример 4

Сингенная модель рака поджелудочной железы Panc02-СЕА

Мышиный суррогатный нацеленный на СЕА иммуноконъюгат, содержащий CEA-IL2v, тестировали в сравнении с ненацеленным иммунтоконъюгатом DP47-IL2v, применяя для трансфекции клетки рака поджелудочной железы мышей линии Panc02-СЕА, которые инъецировали в поджелудочную железу трансгенным мышам линии Black 6-CEA-FcγRIII. В этом опыте применяли человеческое/мышиное кроссреактивное антитело к PD-L1.

Клетки Panc02-Н7 (карцинома поджелудочной железы мышей) исходно получали из ракового центра MD Anderson (шт. Техас, США) и после размножения депонировали во внутреннем банке клеток фирмы Roche-Glycart. Клетки линии Panc02-H7-huCEA получали на фирме заявителей с помощью трансфекции кальцием и методов пересевов. Клетки Panc02-H7-huCEA культивировали в среде RPMI, содержащей 10% FCS (фирма Sigma), 4 мкг/мл пуромицина и 1% Glutamax. Клетки культивировали при 37°С в насыщенной водяным паром атмосфере, содержащей 5% СО2. Для трансплантации использовали пассаж 12. Жизнеспособность клеток составляла 94%. 1×105 клеток на животное инъецировали в поджелудочные железы мышей с помощью 0,3-миллилитрового туберкулинового шприца (фирма BD Biosciences, Германия). Для этого делали небольшой разрез в левой части брюшного отдела анестезированных трансгенных мышей линии Black 6-CEA-FcγRIII. Вскрывали брюшную стенку и осторожно с помощью пинцета отделяли поджелудочные железы. 10 мкл (5×105 клеток Panc02-H7-huCEA в среде RPMI) клеточной суспензии инъецировали в хвост поджелудочной железы. Разрезы брюшной стенки и кожи зашивали с помощью рассасывающегося шовного материала 5/0.

Самок мышей линии Black 6-CEA-FcγRIII фирма (Roche-Glycart; Швейцария), возраст которых в начале эксперимента составлял 8-9 недель (которые разводили на фирме Charles Rivers, Лион, Франция), содержали в среде, в которой отсутствовали специфические патогены, с суточным циклом 12 ч света/12 ч темноты согласно принятым руководствам (GV-Solas; Felasa; TierschG). Протокол экспериментального исследования был проверен и утвержден местным административным органом (Р 2011-128). После доставки животных выдерживали в течение 1 недели, давая пройти акклиматизацию к новым условиям окружающей среды, и для обследования. Постоянный мониторинг состояния здоровья проводили на регулярной основе.

Мышам инъецировали внутрь поджелудочной железы в день опыта 0 1×105 клеток Panc02-СЕА, произвольно разделяли на группы и взвешивали. Через 1 неделю после инъекции опухолевых клеток мышам инъецировали i.v. CEA-IL-2v, МАт к PD-L1 или комбинацию CEA-IL-2v+МАт к PD-L1 один раз в неделю в течение 4 недель.

Всем мышам инъецировали i.v. 200 мкл соответствующего раствора. Мышам в обрабатываемой наполнителем группе инъецировали гистидиновый буфер, а экспериментальной группе вводили конструкцию CEA-IL-2v или МАт к PD-L1, или комбинацию CEA-IL-2v+МАт PD-L1. Для получения соответствующего количества иммуноконъюгата на 200 мкл маточные растворы при необходимости разводили гистидиновым буфером. Дозы, применяемые для CEA-IL2v и DP47-IL2v, выбирали на основе их соответствия со сходными уровнями при 24-часовой экспозиции после их введения, для измерения которых использовали ELISA-анализ для IL2-рецептора (см. фиг. 4Б).

На фиг. 4А и в таблице 4А продемонстрировано, что комбинация CEA-IL-2v+МАт к PD-L1 обладала более высокой эффективностью касательно повышенной медианной и общей выживаемости по сравнению с индивидуальной обработкой CEA-IL-2v, DP47-IL2v и МАт к PD-L1 и комбинацией DP47-IL2v+MAt к PD-L1.

Пример 5

Повышающая регуляция PD-L1 после обработки CEA-IL2v

Выделяли РВМС из свежей крови. В целом, метод состоял в следующем: кровь разводили в соотношении 3:1 с помощью ЗФР. Примерно 30 мл смеси кровь/ЗФР наслаивали на 15 мл Histopaque (фирма Sigma) и центрифугировали в течение 30 мин при 450×g без перерыва. Лимфоциты собирали с помощью 5-миллилитровой пипетки в 50-миллилитровые пробирки, содержащие ЗФР. Пробирки заполняли до 50 мл ЗФР и центрифугировали в течение 10 мин при 350×g. Супернатант отбрасывали, дебрис ресуспендировали в 50 мл ЗФР и центрифугировали в течение 10 мин при 300×g. Стадии промывки повторяли один раз. Клетки ресуспендировали в RPMI, содержащей 10% FCS и 1% глутамина.

А549 (ЕСАСС 86012804) представляют собой клеточную линию карциномы легкого человека европеоидной расы (аденокарцинома; первичная опухоль). Клетки культивировали в DMEM, содержащей 10% FCS и 1% глутамина. Клетки расщепляли каждые 2-4 дня до достижения конфлюэнтности.

А549-клетки собирали за 1 день до начала анализа и высевали в 6-луночные планшеты с плотностью 1 млн клеток на лунку в 1 мл среды. На следующий день среду удаляли и добавляли РВМС с получением конечного соотношения Е:Т 10:1 или 1:1, или добавляли только среду. Клетки обрабатывали 100 нМ СЕА-IL2v, 10 нМ CEA-IL2v или только средой в течение 48 ч в инкубаторе. После обработки А549-клетки собирали с помощью буфера для диссоциации клеток и экспрессию PD-L1 анализировали с помощью проточной цитометрии.

А549-клетки собирали через 48 ч с помощью буфера для диссоциации клеток и применяли для FACS-анализа. Клетки центрифугировали в течение 4 мин при 400×g и промывали однократно ЗФР, содержащим 0,1% БСА (FACS-буфер). Затем к клеткам добавляли 40 мкл на лунку разведенного антитела к PD-L1 (фирма BioLegend, 5 мкл в 40 мкл FACS-буфера) или соответствующий контроль изотипа. Клетки инкубировали в течение 30 мин в холодильнике. Затем клетки промывали дважды FACS-буфером и ресуспендировали в 200 мкл FACS-буфера, содержащего 2% PFA, на лунку. Анализ осуществляли с помощью устройства BD FACS Fortessa.

На фиг. 5 продемонстрировано, что обработка опухолевых клеток А549 только CEA-IL2v не приводила к индукции экспрессии PD-L1 на А549-клетках. Однако, когда А549-клетки обрабатывали CEA-IL2v в присутствии РВМС, была обнаружена зависящая от концентрации повышающая регуляция PD-L1 на А549-клетках. Повышающая регуляция PD-L1 зависела также от количества РВМС, которые присутствовали в совместной культуре.

Пример 6

Сингенная подкожная модель опухоли MC38-FAP

Мышиный суррогатный нацеленный на FAP иммуноконъюгат FAP-IL2v тестировали, применяя для трансфекции клетки колоректальной карциномы мышей линии MC38-FAP, которые инъецировали подкожно мышам линии Black 6. В этом опыте применяли человеческое/мышиное кроссреактивное антитело к PD-L1 YW243.55.S70 PD-L1 muIgG1.

Клетки MC38-FAP invipa (которые пересевали in vivo) получали на фирме Roche-Glycart и после размножения депонировали во внутреннем банке клеток фирмы Glycart. Указанные клетки культивировали с использованием общепринятого метода в среде DMEM (фирма GIBCO, Швейцария), дополненной 10% фетальной бычьей сыворотки (фирма Invitrogen, Швейцария), 1 мМ пируватом и 1% NEAA плюс 6 мкг/мл пуромицина, при 37°С в насыщенной водяным паром атмосфере, содержащей 5% СО2. Пересев культуры осуществляли с помощью трипсина/ЭДТА, 1×(фирма GIBCO, Швейцария), осуществляя расщепление каждый второй день. В день осуществления инъекции опухолевые клетки собирали с помощью трипсина-ЭДТА (фирма Gibco, Швейцария) из культуральных колб (фирма Greiner Bio-One) и переносили в 50 мл культуральной среды, промывали и ресуспендировали в бессывороточной среде RPMI (фирма Gibco, Швейцария). После дополнительной промывки с помощью RPMI определяли концентрацию клеток с использованием устройства для подсчета клеток. Для инъекции конечный титр доводили до 20×106 клеток/мл, что соответствовало 2×106 клеток в 100 мкл среды RPMI в среде для культуры клеток.

Самок мышей линии Black 6 покупали на фирме Charles Rivers, содержали в среде, в которой отсутствовали специфические патогены, с суточным циклом 12 ч света/12 ч темноты согласно принятым руководствам (GV-Solas; Felasa; TierschG). Протокол экспериментального исследования был проверен и утвержден местным административным органом (Р ZH193/2014). После доставки животных выдерживали в течение 1 недели, давая пройти акклиматизацию к новым условиям окружающей среды, и для обследования. Постоянный мониторинг состояния здоровья проводили на регулярной основе

Мышам инъецировали s.c. в день опыта 0 клетки MC38-muFAP (2×106 клеток/100 мкл/мышь); пассаж 7, жизнеспособность которого составляла 94,4%. Наполнитель и терапевтическое средство на основе антител (muFAP-IL2v; в дозе

2 мг/кг и muPD-L1 в дозе 10 мг/кг, а также их комбинацию) инъецировали i.v. в день х (объем опухолей свыше 100 мм3), день х+7,+14,+21 и т.д. Максимальное количество обработок каждой мыши составляло 5.

Всем мышам инъецировали i.v. 200 мкл соответствующего раствора. Мышам в обрабатываемой наполнителем группе инъецировали гистидиновый буфер, а экспериментальной группе вводили антитело. Для получения соответствующего количества иммуноконъюгата на 200 мкл маточные растворы при необходимости разводили гистидиновым буфером.

На фиг. 6А и 6Б и в таблице 5 продемонстрировано, что комбинация FAP-IL-2v+МАт к PD-L1 обладала более высокой эффективностью касательно повышенной медианной и общей выживаемости по сравнению с индивидуальной обработкой FAP-IL-2v и МАт к PD-L1.

1. Применение нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для лечения рака или для предупреждения или лечения метастазов, где нацеленный на злокачественную опухоль иммуноцитокин, содержащий вариант IL-2, включает

а) полипептидные последовательности SEQ ID NO: 84, и SEQ ID NO: 86, и SEQ ID NO: 88, или

б) полипептидные последовательности SEQ ID NO: 108, и SEQ ID NO: 109, и SEQ ID NO: 110, или

в) полипептидные последовательности SEQ ID NO: 79, и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124, и SEQ ID NO: 125, и SEQ ID NO: 126,

а антитело, которое связывается с человеческим PD-L1, содержит вариабельный домен тяжелой цепи VH SEQ ID NO: 89 и вариабельный домен легкой цепи VL SEQ ID NO: 92.

2. Применение по п. 1 для предупреждения или лечения метастазов.

3. Применение комбинации нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для

I) ингибирования роста злокачественной опухоли, которая экспрессирует мишень для иммуноцитокина; и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую мишень для иммуноцитокина, где мишень презентируется на злокачественной опухолевой клетке или в окружении злокачественной опухолевой клетки,

где нацеленный на злокачественную опухоль иммуноцитокин, содержащий вариант IL-2, включает

а) полипептидные последовательности SEQ ID NO: 84, и SEQ ID NO: 86, и SEQ ID NO: 88, или

б) полипептидные последовательности SEQ ID NO: 108, и SEQ ID NO: 109, и SEQ ID NO: 110, или

в) полипептидные последовательности SEQ ID NO: 79, и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124, и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит вариабельный домен тяжелой цепи VH SEQ ID NO: 89 и вариабельный домен легкой цепи VL SEQ ID NO: 92.

4. Применение комбинации нацеленного на карциноэмбриональный антиген (СЕА) иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим фибробластным активирующим белком (PD-L1), для

I) ингибирования роста злокачественной опухоли, которая экспрессирует СЕА, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую СЕА,

где нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, вводят в комбинации с антителом, которое связывается с человеческим PD-L1;

где нацеленный на СЕА иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) полипептидные последовательности SEQ ID NO: 84, и SEQ ID NO: 86, и SEQ ID NO: 88, или

б) полипептидные последовательности SEQ ID NO: 108, и SEQ ID NO: 109, и SEQ ID NO: 110;

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH SEQ ID NO: 89 и вариабельный домен легкой цепи VL SEQ ID NO: 92.

5. Применение комбинации нацеленного на фибробластный активирующий белок (FAP) иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для

I) ингибирования роста злокачественной опухоли, которая экспрессирует FAP, и/или

II) повышения медианной и/или общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую FAP;

где нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, применяют в комбинации с антителом, которое связывается с человеческим PD-L1;

где нацеленный на FAP иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что содержит

а) полипептидные последовательности SEQ ID NO: 79, и SEQ ID NO: 80, и SEQ ID NO: 81, или

б) полипептидные последовательности SEQ ID NO: 124, и SEQ ID NO: 125, и SEQ ID NO: 126;

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит вариабельный домен тяжелой цепи VH SEQ ID NO: 89 и вариабельный домен легкой цепи VL SEQ ID NO: 92.

6. Применение по любому из предыдущих пунктов,

где нацеленный на злокачественную опухоль иммуноцитокин, содержащий вариант IL-2, включает

а) полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88, или

б) полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81,

и где антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит вариабельный домен тяжелой цепи VH SEQ ID NO: 89 и вариабельный домен легкой цепи VL SEQ ID NO: 92.

7. Применение по любому из предыдущих пунктов, где антитело относится к человеческому IgG1-подклассу или человеческому IgG4-подклассу.

8. Применение по любому из предыдущих пунктов, где указанное антитело обладает пониженной или минимальной эффекторной функцией.

9. Применение по любому из предыдущих пунктов, где минимальная эффекторная функция является результатом «effectorless»-мутации Fc.

10. Применение по любому из предыдущих пунктов, где «effectorless»-мутация Fc представляет собой L234A/L235A, или L234A/L235A/P329G, или N297A, или D265A/N297A.

11. Комбинация нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, которые определены в п. 1, предназначенная для лечения рака.

12. Комбинация по п. 11, предназначенная для лечения рака молочной железы, рака легкого, рака ободочной кишки, рака яичника, рака кожи, рака мочевого пузыря, ренального рака, рака почки, рака печени, рака головы и шеи, колоректального рака, меланомы, рака поджелудочной железы, гастральной карциномы, рака пищевода, мезотелиомы, рака предстательной железы, лейкоза, лимфом, миелом.

13. Комбинация нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, предназначенная для лечения пациента, имеющего экспрессирующую СЕА злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, имеющего экспрессирующую FAP злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или злокачественную опухоль, ассоциированную с экспрессией или сверхэкспрессией СЕА или FAP,

где нацеленный на злокачественную опухоль иммуноцитокин, содержащий вариант IL-2, который применяют в комбинированной терапии, отличается тем, что включает

а) полипептидные последовательности SEQ ID NO: 84, и SEQ ID NO: 86, и SEQ ID NO: 88, или

б) полипептидные последовательности SEQ ID NO: 108, и SEQ ID NO: 109, и SEQ ID NO: 110, или

в) полипептидные последовательности SEQ ID NO: 79, и SEQ ID NO: 80, и SEQ ID NO: 81, или

г) полипептидные последовательности SEQ ID NO: 124, и SEQ ID NO: 125, и SEQ ID NO: 126,

и антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH SEQ ID NO: 89 и вариабельный домен легкой цепи VL SEQ ID NO: 92.

14. Комбинация по любому из пп. 11-13,

где нацеленный на злокачественную опухоль иммуноцитокин, содержащий вариант IL-2, включает

полипептидные последовательности SEQ ID NO: 84, SEQ ID NO: 86 и SEQ ID NO: 88, или

полипептидные последовательности SEQ ID NO: 79, SEQ ID NO: 80 и SEQ ID NO: 81,

и где антитело, которое связывается с человеческим PD-L1, применяемое в комбинированной терапии, отличается тем, что содержит

а) вариабельный домен тяжелой цепи VH SEQ ID NO: 89 и вариабельный домен легкой цепи VL SEQ ID NO: 92.

15. Комбинация любому из пп. 11-14, где антитело относится к человеческому IgG1-подклассу или человеческому IgG4-подклассу.

16. Комбинация по любому из пп. 11-15, где указанное антитело обладает пониженной или минимальной эффекторной функцией.

17. Комбинация по любому из пп. 11-16, где минимальная эффекторная функция является результатом «effectorless»-мутации Fc.

18. Комбинация по любому из пп. 11-17, где «effectorless»-мутация Fc представляет собой L234A/L235A, или L234A/L235A/P329G, или N297A, или D265A/N297A.



 

Похожие патенты:

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая фармацевтическую композицию для лечения заболевания или расстройства, поддающегося излечению посредством ингибирования активности GDF8 (варианты), и применение вышеуказанной фармацевтической композиции для получения лекарственного средства для лечения пациента, страдающего заболеванием или расстройством, которое поддается излечению посредством ингибирования активности GDF8, для диагностики такого заболевания или расстройства или для лечения пациента с риском развития такого заболевания или расстройства.

Изобретение относится к биотехнологии. Описан поксвирусный вектор для десенсибилизации, индукции переносимости или подавления аллергической реакции у субъекта на аллерген арахиса, который содержит нуклеотидную последовательность, кодирующую слитый белок, содержащий (i) по меньшей мере четыре аллергена арахиса, выбранных из группы, состоящей из ara h1, ara h2, ara h3, ara h4, ara5, ara h6, ara h7, ara h8, ara h9, ara h10 и ara h11, или их часть, содержащие аминокислотную последовательность, которая может быть объединена с MHC класса I и презентирована Т-лимфоцитам после деградации, и (ii) убиквитин для усиления внутриклеточной деградации слитого белка, последовательность контроля транскрипции и стартовый кодон для облегчения экспрессии слитого белка.

Изобретение относится к области биотехнологии, конкретно к композиции для инъекций, содержащей частицы, образованные посредством самосборки из полипептидов с SEQ ID NO: 1, индуцирующих адгезию и активацию тромбоцитов, и может быть использовано в медицине.

Настоящее изобретение относится к иммунологии. Предложены варианты человеческого нейтрализующего моноклонального антитела против IL-33, а также молекула кодирующей нуклеиновой кислоты, вектор, клетка-хозяин и способ получения упомянутых вариантов антитела.

Изобретение относится к выделенному антителу или его антигенсвязывающему фрагменту, которое специфически связывается с Psl Pseudomonas, и фармацевтической композиции, содержащей указанное антитело.

Группа изобретений относится к способу получения раствора иммуноглобулинов. Способ получения раствора иммуноглобулинов из исходного раствора иммуноглобулинов со степенью чистоты не менее 96%, концентрацией от 1 до 10 мг/мл, содержащего от 2 до 6% (мас./об.) полиэтиленгликоля (PEG) или полипропиленгликоля (PPG), включает стадии а) добавления каприловой кислоты или ее солей к исходному раствору до достижения концентрации от 9 до 15 мМ; б) подведения pH раствора, полученного на стадии а), до рН 5,0-5,2; в) инкубирования раствора, полученного на стадии б), в течение периода времени и при температуре, необходимых для инактивации оболочечных вирусов; и г) выполнения стадии ультрафильтрации/диафильтрации раствора, полученного на стадии в).

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая антитело или антигенсвязывающий фрагмент, специфически связывающееся с ИЛ-21, конъюгат для ингибирования функциональной активности ИЛ-21, содержащий вышеуказанное антитело, фармацевтическую композицию для лечения или профилактики аутоиммунного заболевания или расстройства или реакции «трансплантат против хозяина» (GVHD), ассоциированной с ИЛ-21, способ лечения или профилактики аутоиммунного заболевания или расстройства у субъекта, способ определения уровней экспрессии ИЛ-21 и способ лечения или профилактики реакции «трансплантат против хозяина», ассоциированной с ИЛ-21.

Настоящее изобретение относится к иммунологии. Предложен связывающий домен против EGFRvIII, содержащий его химерный антигенный рецептор, кодирующие нуклеиновые кислоты, вектор, клетка, а также применения указанных изобретений в производстве лекарственного средства, способы создания клетки и получения популяции клеток, способ обеспечения иммунитета, способ лечения.

Изобретение относится к медицине и касается инактивации вируса в потоке исходных материалов продукта в процессе производства терапевтического полипептида. Способ включает этап обработки потока исходных материалов детергентом, при этом детергент является экологически безопасным.

Изобретение относится к области биотехнологии, конкретно к рекомбинантному получению в клетках Escherichia coli гибридного белка, и может быть использовано для очистки биотехнологических субстанций от бактериальных липополисахаридов.

Изобретение относится к области биохимии, в частности к моноклональному антителу или фрагменту антитела, содержащему его антигенсвязывающий участок, которое связывается с белком фосфолипазы D4 (PLD4), а также его применению для лечения или профилактики заболевания, вызванного активированными В-клетками, для супрессии активированных В-клеток, а также для лечения заболевания, вызванного активированными В-клетками.

Изобретение относится к области биохимии, в частности к применению композиции, содержащей моноклональное антитело или его фрагмент против MASP-3, которое специфически связывается с частью MASP-3 человека и ингибирует созревание фактора D, для получения лекарственного средства для лечения субъекта.

Изобретение относится к биохимии. Описано выделенное антитело или его антигенсвязывающий фрагмент для доставки цитотоксина, содержащие домен CH1 IgG, где домен CH1 IgG содержит остаток аспарагина в положении аминокислоты 114 в соответствии с нумерацией Kabat, где боковая цепь указанного остатка аспарагина связана с гликаном.

Изобретение относится к биотехнологии. Описан способ лечения воспалительного заболевания, включающий введение нуждающемуся в этом индивидууму антитела к ENO1, где антитело специфически связывается с эпитопом на ENO1 и ингибирует активность ENO1 в качестве рецептора плазминогена, где эпитоп расположен в области, состоящей из последовательности 296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS336 (SEQ ID NO:39) ENO1 человека, где воспалительное заболевание выбрано из группы, состоящей из рассеянного склероза, ревматоидного артрита, болезни Крона, язвенного колита, системной красной волчанки, хронической обструктивной болезни легких (ХОБЛ), астмы, аллергии, псориаза, атеросклероза и их сочетания.

Изобретение относится к области биотехнологии, конкретно к иммуногенным эпитопам URLC10, и может быть использовано в медицине для лечения пациента, страдающего раком.

Настоящее изобретение относится к области иммунологии. Предложены способы очистки слитого белка.

Изобретение относится к биотехнологии и представляет собой клетку-хозяина для получения выделенного антитела или его антигенсвязывающего фрагмента, которое специфически связывает PCSK9.

Настоящее изобретение относится к биотехнологии, а именно к получению терапевтических и диагностических антител. Заявлен полипептид антитела со специфичностью связывания для калликреина-2 человека (hK2).

Изобретение относится к биотехнологии, конкретно к получению модифицированных экзотоксинов Pseudomonas, и может быть использовано в медицине для противоопухолевой терапии.

Изобретение относится к биотехнологии. Предложены клетка-хозяин E.coli для получения анти-VEGF антитела или антигенсвязывающего фрагмента анти-VEGF, свободных от ошибки включения норлейцина, клетка-хозяин E.coli для получения антитела против фактора D или антигенсвязывающего фрагмента против фактора D, свободных от ошибки включения норлейцина, и Клетка-хозяин E.coli для получения анти-МЕТ антитела или антигенсвязывающего фрагмента анти-МЕТ, свободных от ошибки включения норлейцина.

Изобретение относится к конъюгату лиганда с цитотоксическим лекарственным средством общей формулы PC-L-D, способу его получения и содержащим его фармацевтическим композициям для получения лекарственных средств для лечения рака.

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая применение нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для лечения рака или для предупреждения или лечения метастазов, применение комбинации нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для ингибирования роста злокачественной опухоли, которая экспрессирует мишень для иммуноцитокина, иили повышения медианной иили общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую мишень для иммуноцитокина, применение комбинации нацеленного на карциноэмбриональный антиген иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим фибробластным активирующим белком, для ингибирования роста злокачественной опухоли, которая экспрессирует СЕА, иили повышения медианной иили общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую СЕА, применение комбинации нацеленного на фибробластный активирующий белок иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для ингибирования роста злокачественной опухоли, которая экспрессирует FAP, иили повышения медианной иили общей выживаемости индивидуумов, которые имеют злокачественную опухоль, экспрессирующую FAP, комбинацию нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, для лечения рака, комбинацию нацеленного на злокачественную опухоль иммуноцитокина, содержащего вариант IL-2, и антитела, которое связывается с человеческим PD-L1, предназначенную для лечения пациента, имеющего экспрессирующую СЕА злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией СЕА, имеющего экспрессирующую FAP злокачественную опухоль или злокачественную опухоль, отличающуюся экспрессией или сверхэкспрессией FAP, или злокачественную опухоль, ассоциированную с экспрессией или сверхэкспрессией СЕА или FAP. Изобретение расширяет арсенал средств для лечения рака. 6 н. и 12 з.п. ф-лы, 8 ил., 11 табл., 6 пр.

Наверх